DTASelect v2.0.16
/data/1/catclw/Projects/Jamie
/garibaldi/people-b/applications/yates/dbase/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
-p 1 --fp 0.1 --modstat --sp --noxc --nodcn --extra -e con
Jump to the summary table.

sequest.params modifications:
*STY80.0
#X0.0
@X0.0
StaticC57.0
trueUse criteria
0.0Minimum peptide confidence
0.1Peptide false positive rate
0.0Minimum protein confidence
1.0Protein false positive rate
1Minimum charge state
16Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
falseMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
trueRemove subset proteins
IgnoreLocus validation handling
conExclude protein names matching
0Minimum modified peptides per locus
1000Minimum redundancy for low coverage loci
1Minimum peptides per locus

Locus Key:

Validation StatusLocusSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Similarity Key:

Locus# of identical peptides# of differing peptides

UYIL002W-A101298.6%6977294.7YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_6.04434.04434.24.45950.2929100.0%1448.01221448.529716.99276.9%1M.TRDTPEDVSTAGAK.D2
*Jamie_phos_01_itms_29.12617.12617.23.3460.303697.0%2197.73222197.317615.67547.4%1M.TRDT*PEDVSTAGAKDILDVL.N2
*Jamie_phos_01_itms_42.17482.17482.22.86120.257596.9%2584.8922585.914614.68434.8%1M.TRDTPEDVSTAGAKDILDVLNLLK.G2
*Jamie_phos_01_itms_42.17559.17559.34.64690.3524100.0%2585.78442585.914615.49639.1%2M.TRDTPEDVSTAGAKDILDVLNLLK.G3
*Jamie_phos_01_itms_41.17181.17181.46.56520.4347100.0%3086.57643086.423317.87429.8%2M.TRDTPEDVSTAGAKDILDVLNLLKGGEEK.I4
*Jamie_phos_01_itms_53.21561.21561.44.5290.274100.0%4758.01664759.37845.44115.1%1M.TRDTPEDVSTAGAKDILDVLNLLKGGEEKISEVELKLDEMEKK.M4
*Jamie_phos_01_itms_45.18682.18682.22.76040.19190.1%2329.6722328.622824.29731.0%1R.DTPEDVSTAGAKDILDVLNLLK.G2
*Jamie_phos_01_itms_15.07602.07602.23.47630.211100.0%1564.37221563.803615.52970.8%1K.ISEVELKLDEMEK.K2
*Jamie_phos_01_itms_14.07351.07351.22.82430.359100.0%1690.33221691.977715.98465.4%1K.ISEVELKLDEMEKK.M2
*Jamie_phos_01_itms_25.11452.11452.33.8530.258493.5%2858.54442858.1528424.65926.0%1K.MDSLLVQLEDLHRDNNDLAKSSSQK.-3

UYBR109C5560.5%147161354.3CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_48.19545.19545.35.45920.4057100.0%4110.23444109.52617.28527.1%1R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q3
*Jamie_phos_01_itms_10.05821.05821.23.1210.269999.3%1761.71221760.898614.97260.7%1S.RQLKSNDSEQELLEA.F2
*Jamie_phos_01_itms_21.10003.10003.24.00720.3397100.0%1510.49221510.597516.51770.8%1K.SNDSEQELLEAFK.V2
*Jamie_phos_01_itms_38.16155.16155.33.63180.285898.7%3371.30443368.65115.13828.3%1T.SIGEKLTDAEVDDMLREVSDGSGEINIQQFA.A3
*Jamie_phos_01_itms_45.18507.18507.35.41760.4282100.0%3366.14433366.721718.07525.0%1K.LTDAEVDDMLREVSDGSGEINIQQFAALLSK.-3

UYKL042W344859.5%363422717.9SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_22.10033.10033.24.40760.2404100.0%2531.73222528.754615.71852.6%2R.LYDDYYNIPYQYSNPTPMNR.D2
*Jamie_phos_01_itms_23.10655.10655.23.65710.3241100.0%2607.8722608.754616.75150.0%1R.LYDDYYNIPYQYSNPT*PMNR.D2
*Jamie_phos_01_itms_24.10791.10791.23.93970.341994.1%2608.43212608.754615.2750.0%1R.LYDDYYNIPYQYS*NPTPMNR.D2
*Jamie_phos_01_itms_23.10755.10755.33.80610.251197.8%3549.02443548.821314.85328.6%1R.LYDDYYNIPYQYSNPTPMNRDYNDVGSRI.N3
*Jamie_phos_01_itms_4.03347.03347.22.04870.225997.4%927.1122925.9303644.7271.4%2R.DYNDVGSR.I2
*Jamie_phos_01_itms_9.05505.05505.22.68340.211999.3%1039.13221039.089814.97581.2%1R.DYNDVGSRI.N2
*Jamie_phos_01_itms_11.06035.06035.33.61220.2938100.0%1575.53431575.805215.46454.2%2R.INADKLVPEEYKR.N3
*Jamie_phos_01_itms_11.06094.06094.23.79860.2851100.0%1575.61221575.805215.43883.3%3R.INADKLVPEEYKR.N2
*Jamie_phos_01_itms_8.05135.05135.23.14750.215595.4%1462.27221462.645814.56277.3%1I.NADKLVPEEYKR.N2
*Jamie_phos_01_itms_17.08429.08429.25.10750.4922100.0%2079.6722080.227518.3867.6%1K.VKDPMVDDDPVSENYDQI.N2
*Jamie_phos_01_itms_15.07762.07762.23.36940.281100.0%2517.1722518.754625.68245.2%1K.VKDPMVDDDPVSENYDQINVPK.H2
*Jamie_phos_01_itms_16.07839.07839.35.47460.3216100.0%2519.75442518.754616.20740.5%1K.VKDPMVDDDPVSENYDQINVPK.H3
*Jamie_phos_01_itms_6.04323.04323.22.61070.3204100.0%1192.67211192.279736.09370.0%2K.HRAPDATGNPR.T2
*Jamie_phos_01_itms_1.00137.00137.23.98850.3813100.0%1552.95211553.582817.22180.8%3R.TTNKVSNTSDQDSR.L2
*Jamie_phos_01_itms_21.09819.09819.22.74350.3619100.0%1297.27221297.555436.69275.0%1R.TLSVLTNYVMR.S2
*Jamie_phos_01_itms_31.13566.13566.22.80960.3755100.0%1377.25221377.555416.18875.0%1R.TLS*VLTNYVMR.S2
*Jamie_phos_01_itms_29.12891.12891.35.20.322896.6%2845.61432846.05816.03637.5%1R.SEDGNNDRMS*PLPSPLNTILPINNR.L3
*Jamie_phos_01_itms_32.13677.13677.33.98820.292898.0%2846.99442846.05835.42132.3%1R.SEDGNNDRMSPLPS*PLNTILPINNR.L3
*Jamie_phos_01_itms_33.14307.14307.34.48970.3297.0%2926.88432926.05815.87535.4%3R.SEDGNNDRMS*PLPS*PLNTILPINNR.L3
*Jamie_phos_01_itms_23.10494.10494.22.83050.286897.6%2039.63222038.162415.38943.8%1K.VNPS*DDDIMMYESAELK.R2
*Jamie_phos_01_itms_32.13944.13944.35.34120.3561100.0%3195.62433192.583716.48935.2%1R.KLSLNNQLQELQSMMDGDDNIKLDNVSK.H3
*Jamie_phos_01_itms_33.14163.14163.36.36420.4128100.0%3271.85423272.583717.40939.8%2R.KLS*LNNQLQELQSMMDGDDNIKLDNVSK.H3
*Jamie_phos_01_itms_30.13233.13233.33.61780.2693100.0%2952.05442951.2502605.40425.0%1L.SLNNQLQELQSMMDGDDNIKLDNVSK.H3
*Jamie_phos_01_itms_10.05745.05745.35.62440.034197.5%3104.72443104.0266115.60628.0%1R.HSS*QSSRDYSPSSDACLECSNDLYEK.N3
*Jamie_phos_01_itms_11.06177.06177.34.04630.2388100.0%3294.05443294.317915.34630.6%2R.HSSQSSRDYSPSSDACLECSNDLYEKNR.V3
*Jamie_phos_01_itms_12.06669.06669.24.69030.3533100.0%2255.8722254.254616.70866.7%2R.DYSPSSDACLECSNDLYEK.N2
*Jamie_phos_01_itms_16.07965.07965.22.75430.289697.7%2334.21222334.254615.36452.8%1R.DY*SPSSDACLECSNDLYEK.N2
*Jamie_phos_01_itms_14.07425.07425.24.92630.5036100.0%2334.53222334.254617.48961.1%1R.DYS*PSSDACLECSNDLYEK.N2
*Jamie_phos_01_itms_17.08325.08325.24.69330.113100.0%2413.49222414.254616.93261.1%1R.DYS*PSS*DACLECSNDLYEK.N2
*Jamie_phos_01_itms_17.08339.08339.25.69990.1001100.0%2416.71222414.254616.56566.7%1R.DY*SPSS*DACLECSNDLYEK.N2
*Jamie_phos_01_itms_8.05105.05105.23.02950.3166100.0%1973.71221975.008315.73250.0%1S.SDACLECSNDLYEKNR.V2
*Jamie_phos_01_itms_9.05595.05595.33.33950.227898.6%2419.58422418.6465345.18626.2%1K.NRVKPENNMSETFATPTPNNR.-3
*Jamie_phos_01_itms_9.05301.05301.24.88380.46100.0%2147.77222148.35518.26963.9%2R.VKPENNMSETFATPTPNNR.-2
*Jamie_phos_01_itms_9.05326.05326.33.86060.24796.3%2228.48442228.35515.25241.7%1R.VKPENNMSETFAT*PTPNNR.-3

UYOR257W4544.1%161187514.6CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_46.18783.18783.44.9930.3846100.0%4780.97664781.21515.37417.1%1R.SSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELK.V4
*Jamie_phos_01_itms_28.12340.12340.24.38260.4751100.0%1667.63221667.766718.5180.8%1R.EILDLIDEYDSEGR.H2
*Jamie_phos_01_itms_15.07489.07489.23.24260.189298.9%1776.37221774.965814.91760.0%2R.VAKELGETLTDEELRA.M2
*Jamie_phos_01_itms_13.06840.06840.23.74490.3205100.0%1406.15221405.501616.24981.8%1K.ELGETLTDEELR.A2

UYPL124W121343.5%253292809.5SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_8.05097.05097.24.00780.3603100.0%1905.47221905.929826.29366.7%1K.LREENFSSNT*SELGNK.K2
*Jamie_phos_01_itms_17.08422.08422.33.42460.298998.6%2800.43432801.1523305.20725.0%1R.QLREGNTRLPPPPFSSYGMPPTNRS.N3
*Jamie_phos_01_itms_13.06772.06772.22.85820.2585100.0%1312.41221312.467945.61563.6%1R.EGNTRLPPPPFS.S2
*Jamie_phos_01_itms_7.04810.04810.23.38570.4269100.0%1504.41221504.553516.23366.7%1R.TS*SPVRTDKFASQ.N2
*Jamie_phos_01_itms_18.08572.08572.25.10390.4454100.0%1694.45211694.882118.5875.0%1R.IVYDQGTVIDNLTSR.I2
*Jamie_phos_01_itms_27.12006.12006.24.2690.4411100.0%1808.31211808.041617.74266.7%1R.IVYDQGTVIDNLTSRI.T2
*Jamie_phos_01_itms_22.10117.10117.23.48040.3731100.0%1908.49221908.153716.33953.3%1T.YGLQMGGLYENDMPYR.R2
*Jamie_phos_01_itms_12.06567.06567.24.3580.3013100.0%1923.79221923.985516.37960.0%2R.SSQIHIENEST*EDILK.I2
*Jamie_phos_01_itms_20.09519.09519.24.6380.3483100.0%2037.61222037.144926.85865.6%1R.SSQIHIENEST*EDILKI.L2
*Jamie_phos_01_itms_28.12490.12490.24.33890.296697.3%2151.79222150.304225.54652.9%1R.SSQIHIENES*TEDILKIL.S2
*Jamie_phos_01_itms_29.12869.12869.23.16590.244394.2%2323.47222324.460715.26152.6%1R.SSQIHIENEST*EDILKILSS.S2
*Jamie_phos_01_itms_33.14110.14110.35.27180.363694.1%2810.87432809.960416.39840.2%1R.SSQIHIENES*TEDILKILSSSFHN.-3

UYDL130W3340.6%106106684.0RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_18.08776.08776.23.23170.2655100.0%1396.09221394.526616.02477.3%1A.NVDNVWADVYAK.A2
*Jamie_phos_01_itms_31.13501.13501.23.92050.3658100.0%3257.79223258.185515.91931.7%1A.AAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.-2
*Jamie_phos_01_itms_32.13684.13684.23.37670.3595100.0%3045.95213044.949216.3229.6%1A.GGDAAAEEEKEEEAAEES*DDDMGFGLFD.-2

UYIL149C586838.2%16791951406.0MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.09064.09064.23.76080.4237100.0%1714.27221714.915816.77169.2%1L.NVLVDEIKSQYYSR.I2
*Jamie_phos_01_itms_8.04887.04887.24.71870.3624100.0%1819.55211819.836317.3176.7%1R.DQGNDSLNDDLNKENK.L2
*Jamie_phos_01_itms_17.08244.08244.23.04610.224498.3%1405.65221405.713724.85270.0%1R.KLMEMENILQR.C2
*Jamie_phos_01_itms_8.05176.05176.22.48760.4133100.0%1747.09221747.8564356.13560.7%1K.NLKDTAS*VEKAEFSK.E2
*Jamie_phos_01_itms_10.05764.05764.22.89180.138396.9%1537.67211537.6764334.67354.2%1R.SQLTSLEKDCSLR.A2
*Jamie_phos_01_itms_20.09309.09309.35.33830.3772100.0%2601.83422601.66616.93940.5%2K.NDDNSCRNPEHTDVIDELIDTK.L3
*Jamie_phos_01_itms_16.07890.07890.24.20050.4591100.0%2202.51222202.419717.6758.3%1R.LQNIVMDCTKEEEATMTTS.A2
*Jamie_phos_01_itms_22.10197.10197.33.08970.3138100.0%1503.86441503.871715.51447.9%1T.VGKLFSDIKVLKR.Q3
*Jamie_phos_01_itms_47.19163.19163.33.98540.3211100.0%3069.29443069.484615.59229.2%1R.NQKFQLQNQLEDFILELEHKTPELI.S3
*Jamie_phos_01_itms_48.19601.19601.45.46320.3274100.0%3061.37653061.504616.65932.6%2K.FQLQNQLEDFILELEHKTPELISFK.E4
*Jamie_phos_01_itms_9.05489.05489.22.23770.106993.5%1241.31211241.4331194.47461.1%1R.TKSLEHELKR.S2
*Jamie_phos_01_itms_17.08273.08273.23.73660.3818100.0%1322.01221321.510717.23277.3%1R.STELLETVSLTK.R2
*Jamie_phos_01_itms_16.08025.08025.24.15250.3606100.0%2101.31232100.37716.78747.2%1S.AIQETASPLSQDELISLRK.I2
*Jamie_phos_01_itms_15.07776.07776.24.85490.2563100.0%2249.21222246.436315.70457.9%2K.ILESSNIVNENDSQAIITER.L2
*Jamie_phos_01_itms_14.07241.07241.23.4460.3903100.0%1548.77221549.72117.37879.2%1R.LVEFSNVNELQEK.N2
*Jamie_phos_01_itms_10.05931.05931.23.95930.2534100.0%1765.51221764.973115.40660.7%1R.ILADKLENYEGKQDK.T2
*Jamie_phos_01_itms_18.08793.08793.24.24140.3004100.0%1343.47221343.519936.22377.3%1K.DAIIELENINAK.M2
*Jamie_phos_01_itms_18.08789.08789.22.56090.272998.6%1244.33221244.343414.87477.8%1K.TTLEDFENFK.G2
*Jamie_phos_01_itms_20.09571.09571.22.96690.249799.0%1614.59221613.807624.88257.7%1K.TTLEDFENFKGLAK.E2
*Jamie_phos_01_itms_6.04356.04356.23.54120.2263100.0%1428.33221428.541915.24277.3%1R.LKESEISHNENK.M2
*Jamie_phos_01_itms_25.11405.11405.22.86370.3100.0%1759.65221759.997665.58846.4%2R.LRSDLQSKIQEIESI.R2
*Jamie_phos_01_itms_21.09832.09832.22.05670.204993.3%1647.75221646.83812004.44346.2%1R.SDLQSKIQEIESIR.S2
*Jamie_phos_01_itms_17.08469.08469.23.63530.2149100.0%1705.87221706.93125.84557.1%1K.SLLTELSNKETTIEK.L2
*Jamie_phos_01_itms_25.11412.11412.23.28690.2427100.0%1820.87221820.090515.77453.3%1K.SLLTELSNKETTIEKL.S2
*Jamie_phos_01_itms_10.05608.05608.23.01270.2456100.0%1148.23221148.255415.35588.9%1K.LSSEIENLDK.E2
*Jamie_phos_01_itms_16.07876.07876.23.91030.3599100.0%1807.59221807.954816.55453.3%1K.FLDQNSDASTLEPTLR.K2
*Jamie_phos_01_itms_39.16571.16571.23.53620.3846100.0%2694.99222693.924316.92532.6%1K.DANSQIQAYEEIISSNENALIELK.N2
*Jamie_phos_01_itms_12.06576.06576.22.96050.221798.3%1614.39221614.841834.82453.8%1K.LKEGALHFVQQSEK.L2
*Jamie_phos_01_itms_7.04770.04770.22.98360.3092100.0%1591.65221592.709536.60957.7%1R.LEKDAADCQAELTK.T2
*Jamie_phos_01_itms_7.04771.04771.23.09370.3751100.0%1221.61221222.260417.2880.0%1K.DAADCQAELTK.T2
*Jamie_phos_01_itms_13.06967.06967.22.9490.2898100.0%1761.61221762.917225.95946.4%1K.SSLYSAQDLLDKHER.K2
*Jamie_phos_01_itms_16.07845.07845.23.24040.3045100.0%1532.41221532.690916.2279.2%1R.ELISNIEQTESLR.V2
*Jamie_phos_01_itms_7.04775.04775.22.73310.2667100.0%1373.53221373.4254365.26460.0%1T.QTLSEKEYQCS.A2
*Jamie_phos_01_itms_10.05712.05712.23.22970.239596.0%1398.45211398.645614.63881.8%1V.NILKENNAILQK.S2
*Jamie_phos_01_itms_10.05854.05854.22.52540.271296.8%1813.25221814.0297124.70646.2%1K.ILVYESEMEQCKQR.Y2
*Jamie_phos_01_itms_5.03862.03862.22.51360.153198.4%1138.25221138.222414.81481.2%1R.YQDLSQQQK.D2
*Jamie_phos_01_itms_7.04816.04816.24.62070.385100.0%1476.43211476.5417.42876.9%1K.LSSAENANADLENK.F2
*Jamie_phos_01_itms_11.05999.05999.24.05230.3566100.0%1587.39221587.729416.6979.2%1K.DKLEQDLHFENAK.V2
*Jamie_phos_01_itms_5.03515.03515.22.47970.2777100.0%1156.57211157.179115.21375.0%1K.TANSSSDAFEK.L2
*Jamie_phos_01_itms_10.05848.05848.22.83260.287899.6%1787.29221788.903115.12550.0%1K.STSSEAEYSKDIETLK.K2
*Jamie_phos_01_itms_10.05778.05778.23.40560.3084100.0%1365.39221365.485716.30283.3%1K.RKEELEEEFR.K2
*Jamie_phos_01_itms_22.10294.10294.35.15520.340694.4%3348.32453347.48716.38430.2%2K.LKENAGSLTFLDNKGS*GEDAEEELWNSPSK.G3
*Jamie_phos_01_itms_21.09881.09881.35.74160.282696.4%3351.38433347.48716.20129.3%1K.LKENAGSLTFLDNKGSGEDAEEELWNS*PSK.G3
*Jamie_phos_01_itms_25.11307.11307.46.13710.403293.8%5003.81645004.30573066.40415.6%4K.LKENAGSLTFLDNKGSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N4
*Jamie_phos_01_itms_25.11205.11205.44.51720.355798.0%5085.01665084.305775.36618.5%1K.LKENAGSLTFLDNKGS*GEDAEEELWNS*PSKGNSERPSAVAGFINQK.N4
*Jamie_phos_01_itms_24.11083.11083.34.50660.345397.2%3107.03443106.153655.69623.1%1K.ENAGSLTFLDNKGS*GEDAEEELWNSPSK.G3
*Jamie_phos_01_itms_24.10995.10995.45.50110.304797.3%4762.57674762.972665.68418.6%1K.ENAGSLTFLDNKGSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N4
*Jamie_phos_01_itms_13.06921.06921.33.39420.314598.1%3159.32453161.192655.30526.9%1T.FLDNKGSGEDAEEELWNS*PSKGNSERPS.A3
*Jamie_phos_01_itms_16.07818.07818.35.59040.265998.0%3334.46443331.403815.33631.9%3T.FLDNKGSGEDAEEELWNS*PSKGNSERPSAV.A3
*Jamie_phos_01_itms_15.07641.07641.34.60720.388290.9%3401.39433402.482716.62529.2%1T.FLDNKGSGEDAEEELWNS*PSKGNSERPSAVA.G3
*Jamie_phos_01_itms_13.07005.07005.24.81150.214190.7%1818.17211815.758225.21960.0%1K.GSGEDAEEELWNSPS*K.G2
*Jamie_phos_01_itms_18.08835.08835.34.73270.314397.6%3471.89433472.576715.57131.5%1K.GSGEDAEEELWNSPS*KGNSERPSAVAGFINQK.N3
*Jamie_phos_01_itms_10.05820.05820.24.00230.234899.3%1675.41221675.841814.9860.0%1K.GNSERPSAVAGFINQK.N2
*Jamie_phos_01_itms_35.15028.15028.33.9480.324195.0%4351.7644353.794424.73217.3%1K.AIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLR.T3
*Jamie_phos_01_itms_11.06216.06216.22.51680.062498.0%1212.03221212.4319994.77965.0%1R.TLNIQPEVAVK.A2
*Jamie_phos_01_itms_18.08775.08775.24.19760.536100.0%2053.4122054.177718.81152.6%1K.AAINFSNVTDLTNNSTDGAK.I2
*Jamie_phos_01_itms_18.08797.08797.32.99170.204794.3%2054.63432054.177714.68438.2%1K.AAINFSNVTDLTNNSTDGAK.I3
*Jamie_phos_01_itms_17.08563.08563.25.5090.5386100.0%1983.11221983.09919.24869.4%1A.AINFSNVTDLTNNSTDGAK.I2

UYOL039W2237.7%106107464.0RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_10.05902.05902.22.91740.2967100.0%1333.99221334.422916.76977.3%1K.SVDELITEGNEK.L2
*Jamie_phos_01_itms_32.13673.13673.24.65580.4143100.0%3075.07233074.975318.09637.0%1A.SGDAAAEEEKEEEAAEES*DDDMGFGLFD.-2

UYDL081C1134.9%106109083.9RPP1A SGDID:S000002239, Chr IV from 310122-309802, reverse complement, Verified ORF, "Ribosomal protein P1 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_27.11883.11883.35.2540.4553100.0%3812.69433813.817117.34725.7%1A.GVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.-3

UYFR031C-A7834.3%2542740811.1RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins"
UYIL018W7834.3%2542740811.1RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_10.05616.05616.23.16630.3073100.0%1262.85221262.41115.32981.8%1R.KGAGSIFTSHTR.L2
Jamie_phos_01_itms_24.10911.10911.34.88080.252698.8%3181.64433177.582315.12230.8%1K.KASLNVGNVLPLGSVPEGTIVSNVEEKPGDR.G3
Jamie_phos_01_itms_12.06403.06403.23.30470.2494100.0%1843.45211842.018325.34446.9%1R.ASGNYVIIIGHNPDENK.T2
Jamie_phos_01_itms_11.06315.06315.34.17340.3515100.0%2099.12432099.3108536.09531.9%1R.ASGNYVIIIGHNPDENKTR.V3
Jamie_phos_01_itms_11.06306.06306.24.06220.3905100.0%2099.19212099.310817.19855.6%2R.ASGNYVIIIGHNPDENKTR.V2
Jamie_phos_01_itms_3.02733.02733.22.53550.11599.6%1261.65221262.4086595.13454.2%1K.ASTISRGAVSGQK.A2
Jamie_phos_01_itms_6.04461.04461.22.57160.1675100.0%1304.33221304.4459205.21168.2%1R.TGLLRGSQKTQD.-2

UYDR382W1132.7%110110504.1RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_25.11333.11333.34.47850.334997.1%3642.44433642.62115.80322.1%1A.AAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.-3

UYMR142C4430.7%1992252511.1RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05067.05067.22.64020.3964100.0%965.03217965.097126.80883.3%1K.AAGLTAAYAR.T2
Jamie_phos_01_itms_10.05669.05669.22.83370.2888100.0%1333.31211334.431335.22475.0%1R.NQEIFDANVQR.L2
*Jamie_phos_01_itms_27.12034.12034.34.3940.182798.7%2955.53442955.2512205.14724.1%1R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A3
Jamie_phos_01_itms_8.04883.04883.22.74250.3527100.0%1193.83221194.246218.22180.0%1R.AVQDNGESAFR.T2

UYPL131W5729.6%297337156.8RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_32.13857.13857.35.29280.3681100.0%3500.18433500.794416.69226.7%2K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V3
*Jamie_phos_01_itms_25.11152.11152.23.46630.2775100.0%2363.33232361.474915.55945.0%1L.GLDETYKGVEEVEGEYELTEA.V2
*Jamie_phos_01_itms_35.14937.14937.24.08880.3206100.0%2096.1522094.28515.82859.4%1R.FPGWDFETEEIDPELLR.S2
*Jamie_phos_01_itms_47.19353.19353.35.07680.4266100.0%3343.97443343.60217.09630.6%2R.SYIFGGHVSQYMEELADDDEERFSELFK.G3
*Jamie_phos_01_itms_9.05518.05518.22.52920.2397100.0%1140.83221141.356115.20681.8%1R.VAAKIAALAGQQ.-2

UYJR053W131528.2%574660875.9BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_25.11441.11441.23.65680.227297.4%2458.8922457.567115.52547.5%2L.TLNGLDEPETS*FEELNTTLPR.F2
*Jamie_phos_01_itms_21.09857.09857.23.55910.328100.0%1785.87221786.938416.77760.7%2R.TGPFKNDIFAEEFDR.K2
*Jamie_phos_01_itms_2.01997.01997.22.41910.25898.3%864.71216863.9462144.82271.4%1K.LSNSVTSR.N2
*Jamie_phos_01_itms_42.17315.17315.35.25070.359896.0%4173.95464171.168516.21622.9%1K.FSS*DDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F3
*Jamie_phos_01_itms_5.03516.03516.22.51760.239998.3%1152.95211153.23714.82277.8%1K.FSDVDTANRK.A2
*Jamie_phos_01_itms_17.08499.08499.33.60230.128997.8%2300.57452301.626214.81840.8%1R.ATSRNQKVIGNMILDEQNLR.W3
*Jamie_phos_01_itms_18.08713.08713.23.80710.3487100.0%1516.01221515.76816.35579.2%1K.VIGNMILDEQNLR.W2
*Jamie_phos_01_itms_35.14897.14897.23.26550.2039100.0%2684.21222682.00215.39535.4%1R.WVSVSEEEADPFAGIPEINLPPVGK.S2
*Jamie_phos_01_itms_31.13619.13619.22.81360.189792.0%2397.45212396.6562444.41829.5%1V.SVSEEEADPFAGIPEINLPPVGK.S2
*Jamie_phos_01_itms_12.06382.06382.24.25460.4041100.0%2290.25222288.389217.31250.0%1R.SKSQVNTPFVSNDNDGVYQST.A2
*Jamie_phos_01_itms_10.05922.05922.33.4960.252893.8%2784.38432785.943814.63627.0%1R.SKSQVNTPFVSNDNDGVYQSTAAQAR.L3
*Jamie_phos_01_itms_11.06340.06340.34.67880.421191.7%2866.10422865.943816.54431.0%1R.S*KSQVNTPFVSNDNDGVYQSTAAQAR.L3
*Jamie_phos_01_itms_12.06652.06652.25.20980.5418100.0%2570.99222570.691719.4443.5%1K.SQVNTPFVSNDNDGVYQSTAAQAR.L2

UYBR048W3324.4%1561774910.8RPS11B SGDID:S000000252, Chr II from 332829-332873,333385-333810, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Ap and has similarity to E. coli S17 and rat S11 ribosomal proteins"
UYDR025W3324.4%1561774910.8RPS11A SGDID:S000002432, Chr IV from 491511-491555,491895-492320, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.04885.04885.22.23310.2514100.0%1225.23221225.3843265.5465.0%1K.TAIEGSYIDKK.C2
Jamie_phos_01_itms_18.08599.08599.22.26470.3687100.0%1149.29221150.329327.63566.7%1K.CPFTGLVSIR.G2
Jamie_phos_01_itms_12.06700.06700.23.06510.3136100.0%1859.07211857.126615.7653.1%1R.VQVGDIVTVGQCRPISK.T2

UYJL177W4423.9%1842055110.9RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins"
UYKL180W4423.9%1842054910.9RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_3.02466.02466.22.76560.2819100.0%1237.07211237.35791586.01359.1%1M.ARYGATSTNPAK.S2
Jamie_phos_01_itms_6.04444.04444.22.78430.210898.1%1482.73221482.5931244.76342.9%1R.YGATSTNPAKSASAR.G2
Jamie_phos_01_itms_7.04552.04552.22.90130.2828100.0%1166.19211166.319515.96685.0%1R.TAQGKEFGVTK.A2
Jamie_phos_01_itms_16.08147.08147.24.94920.2392100.0%1647.53221645.855816.30473.3%1K.FVQGLLQNAAANAEAK.G2

UYHR174W6723.3%437469146.0ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_10.05959.05959.22.58020.3638100.0%1416.37221417.55616.63662.5%1R.GNPTVEVELTTEK.G2
Jamie_phos_01_itms_53.21298.21298.23.37620.3547100.0%3259.55223259.55115.69726.6%1R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A2
Jamie_phos_01_itms_53.21303.21303.34.08350.2568100.0%3260.27443259.55146.26321.9%1R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A3
*Jamie_phos_01_itms_10.05790.05790.24.630.3203100.0%1773.37221771.877916.03967.9%1K.DGKYDLDFKNPESDK.S2
Jamie_phos_01_itms_42.17344.17344.35.16260.3003100.0%2985.92432986.26917.34138.0%2K.RYPIVSIEDPFAEDDWEAWSHFFK.T3
Jamie_phos_01_itms_38.15868.15868.22.83040.3412100.0%1822.49221823.009916.35850.0%1R.SGETEDTFIADLVVGLR.T2

UYFL010C1123.2%211226554.5WWM1 SGDID:S000001884, Chr VI from 115737-115102, reverse complement, Verified ORF, "WW domain containing protein of unknown function; binds to Mca1p, a caspase-related protease that regulates H2O2-induced apoptosis; overexpression causes Gi phase growth arrest and clonal death that is suppressed by overexpression of MCA1"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_54.21979.21979.44.58010.254395.1%5708.81645709.14261444.71814.2%1A.DQAPPPYSSQSTPQVQAGAQAQQPRYYQPQQPQYPQYPQQQRYYPQQAP.M4

UYDR447C2222.8%1361580310.5RPS17B SGDID:S000002855, Chr IV from 1355543-1355541,1355226-1354819, reverse complement, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Ap and has similarity to rat S17 ribosomal protein"
UYML024W2222.8%1361578810.5RPS17A SGDID:S000004486, Chr XIII from 225889-225891,226290-226697, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Bp and has similarity to rat S17 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_16.08160.08160.23.57240.2871100.0%1720.03221720.9215.64364.3%1R.KDQYVPEVSALDLSR.S2
Jamie_phos_01_itms_13.06731.06731.23.40980.3905100.0%1702.89221703.846716.72760.0%1R.SNGVLNVDNQTSDLVK.S2

UYBL072C3322.0%2002249010.7RPS8A SGDID:S000000168, Chr II from 89123-88521, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Ap and has similarity to rat S8 ribosomal protein"
UYER102W3322.0%2002249010.7RPS8B SGDID:S000000904, Chr V from 363096-363698, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Bp and has similarity to rat S8 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_10.05964.05964.22.77320.284999.6%1668.53221668.89311215.13942.9%1R.IAGVVYHPSNNELVR.T2
Jamie_phos_01_itms_9.05460.05460.23.11190.3949100.0%1396.99221397.484517.61979.2%1K.IESSVESQFSAGR.L2
Jamie_phos_01_itms_35.14975.14975.23.73360.4739100.0%1950.33221949.133418.95260.0%1R.CDGYILEGEELAFYLR.R2

UYNL225C91121.5%581674006.0CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_21.09813.09813.35.4510.351192.3%3377.00443377.475816.53526.8%2R.LDS*PVS*ENGEIKDGEPIPQNWLNENHVGK.S3
*Jamie_phos_01_itms_37.15821.15821.25.00790.4308100.0%2420.77222420.693618.94662.5%1K.SILPLFVNPEDVINCNFSNAR.D2
*Jamie_phos_01_itms_22.10081.10081.24.68660.2358100.0%1899.35221897.020315.96873.3%2L.FVNPEDVINCNFSNAR.D2
*Jamie_phos_01_itms_6.04455.04455.33.82890.264996.7%1776.68431776.90195.17248.2%1K.NEKDKS*PIGTDVHKK.D3
*Jamie_phos_01_itms_4.02985.02985.22.78210.295690.3%1277.19211277.333525.09875.0%1K.DKS*PIGTDVHK.K2
*Jamie_phos_01_itms_9.05375.05375.35.13620.430390.0%3047.51443046.922616.70628.8%1R.ANEQASAQPTDEHTS*PDIS*IEDCNGAK.I3
*Jamie_phos_01_itms_50.20343.20343.33.61190.251897.9%2906.03442906.258514.77227.1%1R.KAELFEIPIGILFFDLYDSEENSSK.L3
*Jamie_phos_01_itms_50.20433.20433.45.3680.283497.8%3882.25663883.38714.84322.4%1R.KAELFEIPIGILFFDLYDSEENSSKLDHILQEK.Y4
*Jamie_phos_01_itms_50.20490.20490.34.70050.3136100.0%3883.70433883.38745.44121.9%1R.KAELFEIPIGILFFDLYDSEENSSKLDHILQEK.Y3

UYER131W2220.2%1191344710.9RPS26B SGDID:S000000933, Chr V from 423948-424307, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Ap and has similarity to rat S26 ribosomal protein"
UYGL189C2220.2%1191350510.8RPS26A SGDID:S000003157, Chr VII from 148594-148235, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Bp and has similarity to rat S26 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05151.05151.22.70910.2713100.0%943.0122943.09125.79193.8%1R.NIVEAAAVR.D2
Jamie_phos_01_itms_20.09334.09334.23.7740.3373100.0%1683.13221682.867616.02267.9%1R.DLSEASVYPEYALPK.T2

UYMR230W1120.0%105127389.1RPS10B SGDID:S000004843, Chr XIII from 732413-732464,732875-733140, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10"
UYOR293W1120.0%105127398.8RPS10A SGDID:S000005819, Chr XV from 867095-867146,867584-867849, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Bp and has similarity to rat ribosomal protein S10"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_42.17434.17434.24.51020.3771100.0%2742.69212740.984917.46345.0%1K.TQFSWQYYYYTLTEEGVEYLR.E2

UYGR192C7719.9%332357477.0TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall "
UYJR009C7719.9%332358477.0TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall "
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_10.05909.05909.22.40420.2699.3%1089.25221089.285844.97672.2%1M.VRVAINGFGR.I2
Jamie_phos_01_itms_8.05049.05049.22.65440.165590.6%1374.83221375.52173064.31546.4%1R.TASGNIIPSSTGAAK.A2
Jamie_phos_01_itms_9.05411.05411.22.52870.4381100.0%1454.81211455.521716.79967.9%1R.TAS*GNIIPSSTGAAK.A2
Jamie_phos_01_itms_7.04595.04595.22.06580.317699.6%1127.37221127.23651115.03181.2%1K.ETTYDEIKK.V2
Jamie_phos_01_itms_17.08289.08289.33.07070.174996.7%2629.97442633.876725.17230.0%1Q.LS*PKFVKLVSWYDNEYGYSTR.V3
Jamie_phos_01_itms_17.08289.08289.23.67680.3257100.0%1753.65221753.865117.69461.5%1K.LVSWYDNEYGYSTR.V3
Jamie_phos_01_itms_11.06053.06053.23.71120.2744100.0%1180.31211180.389817.01485.0%1R.VVDLVEHVAKA.-2

UYLR150W3319.8%273299959.7STM1 SGDID:S000004140, Chr XII from 440468-441289, Verified ORF, "Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_1.00207.00207.22.71730.267499.6%1282.79221281.405615.18868.2%1R.SKDVTDSATTKK.S2
*Jamie_phos_01_itms_21.09835.09835.34.03750.2939100.0%2867.42432864.144315.33532.3%1K.TAQLSLQDYLNQQANNQFNKVPEAK.K3
*Jamie_phos_01_itms_2.01529.01529.23.57940.4051100.0%1733.81211733.835618.61162.5%1R.KGNNTANATNSANTVQK.N2

UYBR181C5519.5%2362699610.4RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein"
UYPL090C5519.5%2362699610.4RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_12.06406.06406.32.60130.235798.7%2390.06452386.62333765.12325.0%1R.VFFDKRIGQEVDGEAVGDEFK.G3
Jamie_phos_01_itms_12.06406.06406.24.40750.4163100.0%1593.71221593.687418.21578.6%1R.IGQEVDGEAVGDEFK.G3
Jamie_phos_01_itms_21.09783.09783.33.51670.208491.5%2188.10422188.3984904.59132.9%1R.IGQEVDGEAVGDEFKGYVFK.I3
Jamie_phos_01_itms_27.12178.12178.23.29270.3298100.0%2301.6122301.557915.53635.0%1R.IGQEVDGEAVGDEFKGYVFKI.S2
Jamie_phos_01_itms_16.08137.08137.34.66010.2739100.0%2103.32452103.345715.46238.9%1R.NAQAQREAAAEYAQLLAKR.L3

UYBR171W1119.4%206242317.2SEC66 SGDID:S000000375, Chr II from 578359-578979, Verified ORF, "Non-essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and Lhs1p forms a channel competent for SRP-dependent and post-translational SRP-independent protein targeting and import into the ER"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_26.11735.11735.44.67230.040195.2%4833.37654830.4643385.06116.2%1V.YTPLIY*VFILVVSLVMFAS*SYRKKQAKKISEQPSIFDEND.A4

UReverse_YNL046W1118.6%1721935010.2YNL046W SGDID:S000004991, Chr XIV from 542305-542823, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_52.21131.21131.22.24950.16495.7%3507.53223507.9368565.30421.0%1F.IFS*LWSSVASFPSLLPGVLGTLLGTYPT*GMFS.A2

UYGR120C1118.3%262303254.6COG2 SGDID:S000003352, Chr VII from 730826-730038, reverse complement, Verified ORF, "Essential component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_35.14976.14976.44.28090.235691.4%5855.05665858.1961644.9914.9%1D.DYLTFSNT*Y*TDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEI.I4

UYOR373W191917.4%851941047.0NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_24.11064.11064.22.98260.268797.1%1404.09221404.473515.59181.8%1K.DLS*GVLETNTFK.R2
*Jamie_phos_01_itms_16.07962.07962.22.45350.24294.4%1480.23221480.661184.48654.2%1K.DLSGVLETNTFKR.H2
*Jamie_phos_01_itms_30.12987.12987.34.80850.2892100.0%2861.81452862.890917.39639.4%1K.VSSSFSDDS*DSGPAAEAHDVFDGILQK.Q3
*Jamie_phos_01_itms_30.12964.12964.23.58140.117491.4%2863.9122862.890925.16334.6%1K.VSSSFSDDS*DSGPAAEAHDVFDGILQK.Q2
*Jamie_phos_01_itms_34.14421.14421.34.33680.160297.9%2941.76442942.890915.4631.7%1K.VSSSFS*DDS*DSGPAAEAHDVFDGILQK.Q3
*Jamie_phos_01_itms_11.06059.06059.23.38430.2379100.0%1724.95211724.73816.20164.3%1K.SNYLVGSYPS*NSNNK.N2
*Jamie_phos_01_itms_11.06088.06088.23.11380.347599.6%2070.75222069.0114.9941.2%1R.TKEEDEEDTSNSFEFSSS.S2
*Jamie_phos_01_itms_5.03852.03852.22.47680.2791100.0%1079.73221080.185725.2672.2%1T.STKPGDVGYR.Q2
*Jamie_phos_01_itms_23.10533.10533.35.57590.339292.9%3286.04443284.38516.45534.6%1K.KIQEEENLANSDDT*PLDT*PKFNDLFTK.N3
*Jamie_phos_01_itms_11.06118.06118.24.54080.3885100.0%2130.19212130.226818.20855.6%1K.IQEEENLANSDDTPLDTPK.F2
*Jamie_phos_01_itms_11.05989.05989.24.01470.3711100.0%2210.01222210.226816.27750.0%1K.IQEEENLANSDDT*PLDTPK.F2
*Jamie_phos_01_itms_27.11895.11895.34.14020.418696.3%3154.97443156.21116.21126.0%1K.IQEEENLANSDDT*PLDT*PKFNDLFTK.N3
*Jamie_phos_01_itms_27.11937.11937.23.71690.3696100.0%3155.79223156.21116.23730.0%1K.IQEEENLANSDDT*PLDT*PKFNDLFTK.N2
*Jamie_phos_01_itms_24.10881.10881.35.37080.239297.7%3006.02443005.04625.56232.3%1K.TFPAERVEDITSIS*EVNT*SFNETEK.Q3
*Jamie_phos_01_itms_18.08655.08655.24.99670.4638100.0%2222.9122223.265917.66358.3%1R.VEDITSISEVNTS*FNETEK.Q2
*Jamie_phos_01_itms_20.09654.09654.24.34480.4095100.0%2223.1522223.265917.14150.0%1R.VEDITSIS*EVNTSFNETEK.Q2
*Jamie_phos_01_itms_21.09699.09699.24.65820.2967100.0%2303.53222303.265917.31255.6%1R.VEDITSIS*EVNTS*FNETEK.Q2
*Jamie_phos_01_itms_10.05736.05736.22.99960.349100.0%1471.63221471.5216.4562.5%1K.LSGSPSYDSDWEK.I2
*Jamie_phos_01_itms_11.06261.06261.23.0110.287296.4%1550.55211551.5235.78458.3%1K.LSGS*PSYDSDWEK.I2

UYPL255W5517.4%385453846.5BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_24.10761.10761.23.40580.347100.0%1462.21221462.571426.41275.0%1K.DALFGTDIS*PSMK.Y2
*Jamie_phos_01_itms_13.07031.07031.22.41980.115591.5%1541.19211540.546155.15254.2%1R.SNS*WSGLDSTLHR.K2
*Jamie_phos_01_itms_14.07369.07369.23.5420.3425100.0%1264.37221264.297716.39783.3%1R.DLEDLCEDVR.E2
*Jamie_phos_01_itms_40.16804.16804.23.46790.2806100.0%2058.79222059.283416.43143.8%1R.DNYESEIHDLLLQLSLR.N2
*Jamie_phos_01_itms_12.06405.06405.23.26420.3927100.0%1494.03221493.483916.1573.1%1R.KDTS*AGSNIFSTGQ.-2

UYGL031C3317.4%1551761411.3RPL24A SGDID:S000002999, Chr VII from 437939-437472, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Bp and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate"
UYGR148C3317.4%1551754711.4RPL24B SGDID:S000003380, Chr VII from 787784-787317, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Ap and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_7.04839.04839.22.6330.094998.3%937.09216937.086724.83792.9%1K.SASLFKQR.K2
Jamie_phos_01_itms_28.12282.12282.22.54570.209592.8%1006.832151006.235814.43392.9%1R.IAWTVLFR.K2
Jamie_phos_01_itms_7.04723.04723.23.11890.3345100.0%1135.57211136.296315.93885.0%1K.GAFQKVAATSR.-2

UYLR457C4417.2%3193735410.2NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_23.10468.10468.22.84510.315496.7%2025.53222026.164425.74550.0%1R.ILEDLLDSS*NIHPSYTK.S2
*Jamie_phos_01_itms_16.07969.07969.22.64090.253790.9%1373.23221373.391125.19260.0%1R.TNS*LFTSS*PMK.T2
*Jamie_phos_01_itms_17.08447.08447.34.56060.2901100.0%3158.60423159.4663115.39625.0%1T.YNRDGNIPEMQPLQENISPACPTPPYR.S3
*Jamie_phos_01_itms_19.08973.08973.34.43930.397793.3%3239.30443239.466316.41729.8%1T.YNRDGNIPEMQPLQENISPACPT*PPYR.S3

UYCR031C2216.8%1371453710.7RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins"
UYJL191W2216.7%1381465010.5RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_10.05667.05667.22.87480.2067100.0%1092.95211093.184415.45277.8%1R.DNSQVFGVAR.I2
Jamie_phos_01_itms_7.04565.04565.22.39990.244399.6%1254.45211254.4318285.02554.2%1R.TKTPGPGGQAALR.A2

UYDR356W192715.9%9441117827.1SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04545.04545.23.05890.322696.9%1384.65221384.442925.70968.2%1R.NTTQTQVVS*PTK.V2
*Jamie_phos_01_itms_19.09144.09144.22.38930.365597.1%1202.81211203.16215.65877.8%2R.S*IDDTIDSTR.L2
*Jamie_phos_01_itms_25.11177.11177.23.52120.321594.3%2168.3722168.28115.23158.8%1T.RLFSEASQFDDS*FPEIKA.N2
*Jamie_phos_01_itms_25.11208.11208.23.44050.3749100.0%1861.15221861.014816.59560.0%1R.LFSEASQFDDSFPEIK.A2
*Jamie_phos_01_itms_27.11973.11973.24.2530.177294.0%1943.85221941.014815.28266.7%2R.LFSEASQFDDS*FPEIK.A2
*Jamie_phos_01_itms_20.09579.09579.22.9720.271296.8%1464.15221464.485115.72977.3%1A.SQFDDS*FPEIKA.N2
*Jamie_phos_01_itms_14.07419.07419.34.1610.3387100.0%2670.29442670.7616.16335.7%2K.EKNDTLNNYDTLEEETDDLKNR.L3
*Jamie_phos_01_itms_14.07273.07273.23.3070.252699.6%2671.69212670.7615.04440.5%1K.EKNDTLNNYDTLEEETDDLKNR.L2
*Jamie_phos_01_itms_15.07747.07747.23.31260.2861100.0%2413.3722413.470515.97444.7%1K.NDTLNNYDTLEEETDDLKNR.L2
*Jamie_phos_01_itms_17.08328.08328.25.77120.4119100.0%2161.3922160.386217.57858.3%1K.TVKDQVLELENNSDVQSLK.L2
*Jamie_phos_01_itms_15.07744.07744.25.45010.3912100.0%1833.51221831.974418.00380.0%1K.DQVLELENNSDVQSLK.L2
*Jamie_phos_01_itms_11.06189.06189.23.43130.3483100.0%1262.07211262.399717.19790.0%1K.IAELEEEISTK.N2
*Jamie_phos_01_itms_7.04749.04749.23.4840.3285100.0%1393.35221393.490616.63381.8%1K.TITDNELESKDK.L2
*Jamie_phos_01_itms_14.07084.07084.43.58380.228997.9%2399.41652399.5676354.79832.5%1K.DIEEYKESAKDSEDKIEELK.I4
*Jamie_phos_01_itms_14.07137.07137.24.35330.2663100.0%2399.8722399.567616.76647.4%2K.DIEEYKESAKDSEDKIEELK.I2
*Jamie_phos_01_itms_15.07557.07557.35.01950.3252100.0%2401.13432399.567616.21943.4%5K.DIEEYKESAKDSEDKIEELK.I3
*Jamie_phos_01_itms_7.04594.04594.23.89120.2737100.0%1590.49221589.659215.8183.3%1R.EKEELNENSNNIR.I2
*Jamie_phos_01_itms_7.04607.04607.33.27240.240693.5%1590.89441589.659224.67745.8%1R.EKEELNENSNNIR.I3
*Jamie_phos_01_itms_21.09769.09769.24.62540.4614100.0%1695.95211696.811318.83976.9%1K.NYLSEITSLQEENR.R2

UYBR191W1115.0%1601824210.4RPL21A SGDID:S000000395, Chr II from 606265-606275,606664-607135, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp and has similarity to rat L21 ribosomal protein"
UYPL079W1115.0%1601827410.4RPL21B SGDID:S000006000, Chr XVI from 406633-406643,407065-407536, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Ap and has similarity to rat L21 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_29.12930.12930.23.80920.4525100.0%2648.27222648.972717.26150.0%1R.ESRIVSTEGNVPQTLAPVPYETFI.-2

UYLR185W2214.8%88985011.6RPL37A SGDID:S000004175, Chr XII from 522665-522671,523031-523290, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl37Bp and to rat L37 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_4.02818.02818.22.73590.288199.3%1202.95211202.238534.9875.0%1K.TCSSCGYPAAK.T2
*Jamie_phos_01_itms_4.02945.02945.21.97720.1745100.0%1459.15221459.531115.4954.2%1K.TCSSCGYPAAKTR.S2

UYLR075W2214.5%2212536110.0RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_8.04921.04921.23.06280.342100.0%1365.57211365.482726.01775.0%1R.EAGEVKDDGAFVK.F2
*Jamie_phos_01_itms_26.11598.11598.22.88960.363100.0%2185.6322185.40136.02736.1%1K.KGSLENNIREFPEYFAAQA.-2

UYBL027W3314.3%1892170411.4RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
UYBR084C-A3314.3%1892170411.4RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_14.07113.07113.23.66340.4506100.0%2058.59232059.243217.36955.9%1R.KVWLDPNETSEIAQANSR.N2
Jamie_phos_01_itms_16.08170.08170.24.32780.433100.0%1930.77221931.069117.27565.6%1K.VWLDPNETSEIAQANSR.N2
Jamie_phos_01_itms_17.08230.08230.22.71240.2556100.0%1098.37221098.333515.79787.5%1R.LPSQVVWIR.R2

UYLR441C2214.1%2552874310.0RPS1A SGDID:S000004433, Chr XII from 1018904-1018137, reverse complement, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein"
UYML063W2214.1%2552881210.0RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_18.08611.08611.23.56680.3544100.0%2062.75222062.209716.77847.1%1R.VVEVCLADLQGSEDHSFR.K2
Jamie_phos_01_itms_21.09791.09791.22.63290.236498.9%1847.55211848.037554.95341.2%1K.FDVGALMALHGEGSGEEK.G2

UYLR061W1114.0%121136936.2RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_20.09574.09574.23.64130.2816100.0%2075.57232073.084515.22162.5%1R.LAFYQVTPEEDEEEDEE.-2

UYDR418W2213.9%165178239.4RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins"
UYEL054C2213.9%165178239.4RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_27.12150.12150.32.8580.2957100.0%2565.05442564.811355.3229.5%1R.VDFKNPHDIIEGINAGEIEIPEN.-3
Jamie_phos_01_itms_27.12167.12167.23.38280.292299.6%2566.99222564.811325.17636.4%1R.VDFKNPHDIIEGINAGEIEIPEN.-2

UYHR089C1113.2%2052148011.5GAR1 SGDID:S000001131, Chr VIII from 283300-282683, reverse complement, Verified ORF, "Protein component of the H/ACA snoRNP pseudouridylase complex, involved in the modification and cleavage of the 18S pre-rRNA"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_30.13221.13221.33.92240.3322100.0%3062.96443062.35615.23729.8%1R.SFQQGPPDTVLEMGAFLHPCEGDIVCR.S3

UYLR321C1112.9%426487775.2SFH1 SGDID:S000004313, Chr XII from 777864-776584, reverse complement, Verified ORF, "Subunit of the RSC chromatin remodeling complex required for kinetochore function in chromosome segregation; essential gene required for cell cycle progression; phosphorylated in the G1 phase of the cell cycle; Snf5p paralog"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_72.28377.28377.43.29360.218897.6%6331.29646325.9453695.59512.7%1N.GPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPY*RLNTDQE.T4

UYDR249C1112.1%373437908.7YDR249C SGDID:S000002657, Chr IV from 959796-958675, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_34.14671.14671.44.96710.26395.5%5538.13675543.3321395.04814.4%1L.PAKKLRHHQKLTLQDLPVEIIQHIFVFTKGEPSMVT*LNRFFYS*CL.K4

UReverse_YKL085W1111.4%334356508.5MDH1 SGDID:S000001568, Chr XI from 278767-279771, Verified ORF, "Mitochondrial malate dehydrogenase, catalyzes interconversion of malate and oxaloacetate; involved in the tricarboxylic acid (TCA) cycle"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_44.18187.18187.44.1670.277791.3%3981.41653975.44614.99220.3%1N.KLVQAVIPVTSNVPNS*IVLIAANPASEATAAALDRVIS*.A4

UReverse_YDL059C1110.5%238266308.6RAD59 SGDID:S000002217, Chr IV from 344953-344237, reverse complement, Verified ORF, "Protein involved in the repair of double-strand breaks in DNA during vegetative growth via recombination and single-strand annealing; anneals complementary single-stranded DNA; homologous to Rad52p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_94.37698.37698.43.23780.207693.9%2842.85642844.8762755.04626.4%1V.QAEAVVT*YKVEST*NTNEGNNVATFP.Q4

UYNL248C1110.4%415466519.5RPA49 SGDID:S000005192, Chr XIV from 182609-181362, reverse complement, Verified ORF, "RNA polymerase I subunit A49"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_42.17457.17457.43.37250.172995.4%5231.61675229.37353695.0514.3%1P.SDTT*FDLY*KKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQY.V4

UYDL229W3310.0%613666025.4SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p"
UYNL209W3310.0%613665955.5SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05082.05082.23.74440.3055100.0%1553.63221552.773916.58267.9%1R.LIGDAAKNQAALNPR.N2
Jamie_phos_01_itms_27.12099.12099.23.63640.2799100.0%2161.23222161.413816.61450.0%1K.VIDVDGNPVIEVQYLEETK.T2
Jamie_phos_01_itms_37.15765.15765.22.41290.218199.6%2964.1322965.151175.01125.0%1R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A2

UYHL034C229.9%294329905.7SBP1 SGDID:S000001026, Chr VIII from 34075-33191, reverse complement, Verified ORF, "Nucleolar single-strand nucleic acid binding protein; associates with small nuclear RNAs"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_20.09478.09478.34.17080.279298.7%3345.98443346.49415.13225.9%1R.ELTVDVAVIRPENDEEEIEQETGSEEKQE.-3
*Jamie_phos_01_itms_9.05529.05529.24.65550.257100.0%2620.23222618.681415.40857.1%1A.VIRPENDEEEIEQETGSEEKQE.-2

UYJL158C119.7%227232424.7CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family"
UYKL164C116.5%341346226.5PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle"
UYKL163W116.8%325330045.7PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway"
UYJL160C117.7%287302159.0YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein"
UYJL159W115.7%387386195.4HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_21.09943.09943.24.49890.4153100.0%2285.03222284.579617.42850.0%1R.IGSIVANRQFQFDGPPPQAGAI.Y2

UYOL127W119.2%1421575810.1RPL25 SGDID:S000005487, Chr XV from 80347-80359,80774-81189, Verified ORF, "Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 26S rRNA via a conserved C-terminal motif"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_16.08040.08040.22.67060.259299.6%1454.03221451.576425.16758.3%1R.LTADYDALDIANR.I2

UYCR020C-A119.1%8897255.4MAK31 SGDID:S000000614, Chr III from 155093-154827, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type; required for replication of dsRNA virus; member of the Sm protein family"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_4.03213.03213.22.19580.087595.2%908.4122909.99274124.54778.6%1E.ERMGSSSR.M2

UYJR093C118.9%327357774.4FIP1 SGDID:S000003853, Chr X from 604120-603137, reverse complement, Verified ORF, "Subunit of cleavage polyadenylation factor (CPF), interacts directly with poly(A) polymerase (Pap1p) to regulate its activity"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_39.16494.16494.22.4070.3064100.0%2960.1322959.241246.14921.4%1E.RLITEGEANQGVTATTVKATESDGNVPKA.M2

UYML074C348.8%411465534.5FPR3 SGDID:S000004539, Chr XIII from 121324-120089, reverse complement, Verified ORF, "Nucleolar peptidyl-prolyl cis-trans isomerase (PPIase); FK506 binding protein; phosphorylated by casein kinase II (Cka1p-Cka2p-Ckb1p-Ckb2p) and dephosphorylated by Ptp1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_26.11646.11646.34.54780.310696.7%4328.96444329.10325.92924.3%2K.RNPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQK.K3
*Jamie_phos_01_itms_30.13104.13104.34.87120.226297.1%4171.7644172.915535.75122.7%1R.NPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQK.K3
*Jamie_phos_01_itms_26.11572.11572.34.38860.227996.4%4300.9744301.0955.23721.3%1R.NPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQKK.K3

UReverse_YDR019C118.8%400444698.8GCV1 SGDID:S000002426, Chr IV from 485361-484159, reverse complement, Verified ORF, "T subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_72.28505.28505.33.49030.258798.6%3594.71443598.986315.21317.6%1D.DNEKTIITDDVVGGQPNLLVSLTGSGVPLANFDTP.T3

UYKL054C228.7%738839735.0DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_18.08919.08919.34.16180.121797.7%3817.40433816.973414.88424.2%1K.EQVKEEEQTAEELEQEQDNVAAPEEEVTVVEEK.V3
*Jamie_phos_01_itms_8.05021.05021.34.4650.286896.8%3694.28443694.65315.92725.8%1K.NNYNYYQTQNGQEQQS*PNQGVAQHSEDSQQK.Q3

UYBR118W228.7%458500339.0TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes"
UYPR080W228.7%458500339.0TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_35.15037.15037.34.04260.152693.6%3322.28443321.8418314.64421.4%1K.TLLEAIDAIEQPSRPTDKPLRLPLQDVYK.I3
Jamie_phos_01_itms_10.05800.05800.21.90510.1274100.0%1025.83221026.224195.40675.0%1K.IGGIGTVPVGR.V2

UYLR069C118.5%761845746.9MEF1 SGDID:S000004059, Chr XII from 273916-271631, reverse complement, Verified ORF, "Mitochondrial elongation factor involved in translational elongation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_51.20845.20845.43.99130.228291.6%6965.61676964.806614.57512.5%1D.YTHKKQSGGAGQYGRVIGTLSPVDDITKGNIFETAIVGGRIPDKYLAACGKGFEEVCEKGPLIGH.R4

UReverse_YER140W118.3%556647949.8YER140W SGDID:S000000942, Chr V from 451560-453230, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_15.07492.07492.43.94530.231896.2%5218.81645221.678355.2815.9%1E.TEIRNEKNYDSHLAIRT*SVDVKGMGGSLLGPVYEEETVVTNFAQDR.F4

UYNL064C118.1%409446716.3YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_70.27623.27623.33.42370.258693.6%3563.45433563.8965134.65719.5%1R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V3

UYNL096C117.9%190216349.9RPS7B SGDID:S000005040, Chr XIV from 444317-444174,443828-443400, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Ap; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_16.07959.07959.23.98660.3663100.0%1627.53221626.890716.88271.4%1K.ILSQAPSELELQVAK.T2

UYMR242C117.9%1782123610.3RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein"
UYOR312C118.0%1742071310.3RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_21.09868.09868.22.34440.224899.6%1541.21221538.758965.00853.8%1R.VAAVETLYQDMAAR.H2

UYPR148C117.8%435492794.8YPR148C SGDID:S000006352, Chr XVI from 828136-826829, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_16.08079.08079.36.85430.4592100.0%3865.97443865.742717.63831.8%1K.TAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIK.V3

UYGR234W117.8%399446466.3YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_66.26275.26275.35.7650.4148100.0%3351.44433349.76217.8232.5%1K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K3

UReverse_YKL187C227.7%750810335.0YKL187C SGDID:S000001670, Chr XI from 91541-89289, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; detectable in highly purified mitochondria"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_85.33907.33907.32.50230.1894.9%3107.75443104.558104.73321.6%1T.LLTQALSSSITTNMLTALATMTATQNTSFA.F3
*Jamie_phos_01_itms_94.37600.37600.21.66020.184491.3%2966.79222968.28782914.36718.5%1S.SLSASVLRSLGDLTETANDSYKLLGNIE.T2

UYBR031W227.7%3623909210.6RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins"
UYDR012W227.7%3623906210.6RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05085.05085.23.00250.3083100.0%1185.09221185.26615.93180.0%1R.SGQGAFGNMCR.G2
Jamie_phos_01_itms_15.07782.07782.23.4240.3067100.0%1848.65221847.078215.64950.0%1K.VGYTLPSHIISTSDVTR.I2

UYKL152C117.7%247276098.8GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_32.13776.13776.23.34620.152991.3%2147.1322144.4294134.36438.9%1K.YVDPNVLPETESLALVIDR.L2

UReverse_YIR036C117.6%263288046.4YIR036C SGDID:S000001475, Chr IX from 422862-422071, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_42.17601.17601.22.1330.219893.1%2237.6322235.63161854.43726.3%1L.VAAPVKPDLLSSTKYLQTFR.E2

UYPL240C467.5%709814064.9HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_16.08007.08007.23.59350.3047100.0%1819.93211819.92215.85464.3%1R.NPSDITQEEYNAFYK.S2
*Jamie_phos_01_itms_28.12334.12334.23.3570.219998.3%2016.01222013.16534.8450.0%1K.LIEAFNEIAEDSEQFEK.F2
Jamie_phos_01_itms_24.10821.10821.34.77250.3532100.0%2512.22442511.69915.90340.0%3K.TLVDITKDFELEETDEEKAER.E3
Jamie_phos_01_itms_10.05632.05632.23.96140.2754100.0%1740.43211740.774816.36180.8%1K.DFELEETDEEKAER.E2

UReverse_YJR001W117.5%602653468.1AVT1 SGDID:S000003761, Chr X from 436717-438525, Verified ORF, "Vacuolar transporter, imports large neutral amino acids into the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_57.23081.23081.43.47390.177292.2%4871.29644865.8811624.61115.2%1A.ARRKIASAAEDIHQVNMLVDLVSVIPRANLPTKAIPIITMLASIL.G4

UYDR450W117.5%1461703810.3RPS18A SGDID:S000002858, Chr IV from 1359913-1359959,1360395-1360788, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins"
UYML026C117.5%1461703810.3RPS18B SGDID:S000004488, Chr XIII from 223828-223782,223380-222987, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05211.05211.23.16110.2864100.0%1275.23221275.35815.98680.0%1R.AGELTQEELER.I2

UYAL038W227.4%500545457.7CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_17.08511.08511.23.20130.218499.6%1760.83221761.929225.12353.6%1K.IENQQGVNNFDEILK.V2
*Jamie_phos_01_itms_32.13894.13894.23.65420.2445100.0%2570.75222570.817436.02733.3%1R.GVFPFVFEKEPVSDWTDDVEAR.I2

UYMR131C127.2%511572614.6RRB1 SGDID:S000004738, Chr XIII from 534697-533162, reverse complement, Verified ORF, "Essential nuclear protein involved in early steps of ribosome biogenesis; physically interacts with the ribosomal protein Rpl3p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_18.08753.08753.34.52470.3359100.0%4288.70464289.344725.96120.8%2K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNR.L3

UYPL266W117.2%318359519.6DIM1 SGDID:S000006187, Chr XVI from 39121-40077, Verified ORF, "Essential 18S rRNA dimethylase, responsible for conserved m6(2)Am6(2)A dimethylation in 3'-terminal loop of 18 S rRNA, part of 90S and 40S pre-particles in nucleolus, involved in pre-ribosomal RNA processing"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_71.28164.28164.22.27610.241591.3%2542.99222541.9565834.3625.0%1G.QHILKNPLVAQGIVDKAQIRPSD.V2

UYLR449W127.1%392439034.7FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_10.05775.05775.36.00440.370295.0%3424.76443421.220216.3633.3%2R.GEYYNQDNNDGLEEDES*ES*EQEADVPKR.S3

UYNL178W117.1%240265039.4RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_9.05433.05433.23.6140.3162100.0%1907.63221905.969626.03962.5%1K.DYRPAEETEAQAEPVEA.-2

UYML028W117.1%196215905.1TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_24.10944.10944.22.67810.138496.8%1565.25221563.747814.70161.5%1R.DYGVLIEEEGVALR.G2

UYLR175W117.0%483547058.9CBF5 SGDID:S000004165, Chr XII from 506136-507587, Verified ORF, "Component of box H/ACA small nucleolar ribonucleoprotein particles (snoRNPs), probable rRNA pseudouridine synthase, binds to snoRNP Nop10p and also interacts with ribosomal biogenesis protein Nop53p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_69.27213.27213.43.90870.181797.9%3593.85643595.09381624.76819.7%1Y.EEGIELYDEIVLITTKGEAIAVAIAQMSTVDLAS.C4

UYMR178W116.9%274311456.1YMR178W SGDID:S000004790, Chr XIII from 618478-619302, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_21.09781.09781.43.09580.217197.7%2071.33642072.3232194.86531.5%1K.SIVNRVVNNLEGEVISSEL.E4

UReverse_YNR030W116.4%551626737.1ALG12 SGDID:S000005313, Chr XIV from 678801-680456, Verified ORF, "Alpha-1,6-mannosyltransferase localized to the ER; responsible for the addition of the alpha-1,6 mannose to dolichol-linked Man7GlcNAc2, acts in the dolichol pathway for N-glycosylation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_56.22588.22588.33.01440.203596.9%3755.27443759.516844.75517.6%1L.ASVELRFVIAVLASLFIAANYRGLLVWGLAVNTLP.L3

UYKL060C226.4%359396215.8FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04626.04626.22.93690.2731100.0%1218.41221218.309115.77772.7%1K.GISNEGQNASIK.G2
*Jamie_phos_01_itms_13.06795.06795.23.06360.224899.0%1283.51221283.42414.88980.0%1K.SLETFRTTNTL.-2

UYLR390W-A116.3%238232685.9CCW14 SGDID:S000006429, Chr XII from 903724-904440, Verified ORF, "Covalently linked cell wall glycoprotein, present in the inner layer of the cell wall"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_21.09982.09982.22.64080.2977100.0%1587.75221585.816415.62953.6%1A.TPPACLLACVAQVGK.S2

UYNL142W116.2%499534016.7MEP2 SGDID:S000005086, Chr XIV from 357455-358954, Verified ORF, "Ammonium permease involved in regulation of pseudohyphal growth; belongs to a ubiquitous family of cytoplasmic membrane proteins that transport only ammonium (NH4+); expression is under the nitrogen catabolite repression regulation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_58.23187.23187.21.73530.203995.4%3474.6323476.109374.57820.0%1A.WTVTVTSILLLTMNAIPFLKLRLSADEEELG.T2

UYOL063C116.1%9571097155.7YOL063C SGDID:S000005424, Chr XV from 210264-207391, reverse complement, Uncharacterized ORF, "Protein required for normal hydroxyurea resistance; not related to the HUS1 checkpoint protein identified in human and fission yeast"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_54.21868.21868.42.78020.154196.8%7108.49667102.64525.16512.3%1S.FQRRYRDTEQRAHLKS*ESQKSWGFHNYVRNVKRLLESAVPGSEDS*PLGYQLSEMHDEF.F4

UReverse_YJR065C116.0%449495425.8ARP3 SGDID:S000003826, Chr X from 559072-557723, reverse complement, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_42.17320.17320.33.05390.193393.4%2953.94432953.50153584.67922.1%1E.GRERLLSQIFLTIDRGAIPINKIASGI.V3

UReverse_YJL104W116.0%149162169.4PAM16 SGDID:S000003640, Chr X from 227244-227693, Verified ORF, "Constituent of the mitochondrial import motor associated with the presequence translocase, along with Ssc1p, Tim44p, Mge1p, and Pam18p; has similarity to J-domain containing proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.09031.09031.21.66810.228696.0%962.03217959.13074284.64475.0%1F.VQTGTIIVQ.I2

UYNL240C115.9%491541517.6NAR1 SGDID:S000005184, Chr XIV from 199978-198503, reverse complement, Verified ORF, "Nuclear architecture related protein; component of the cytosolic iron-sulfur (FeS) protein assembly machinery, required for maturation of cytosolic and nuclear FeS proteins; homologous to human Narf"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_49.19891.19891.21.79630.159390.3%3257.85233256.704374.30523.2%1P.GSQMIVLEGRNSDIVEYRLLHDDRIIAAA.S2

UYLR167W115.9%152172169.9RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04665.04665.22.5160.297100.0%1077.91221078.1791145.36575.0%1K.CHSVYKVNA.-2

UYNL188W225.8%433506539.3KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.09249.09249.33.8880.264197.8%2845.43432846.1715.55230.2%1R.KQLGKPLPLPYLNS*PNSDSTPTLQR.K3
*Jamie_phos_01_itms_23.10527.10527.33.7860.404695.8%2717.72442717.995856.22829.3%1K.QLGKPLPLPYLNS*PNSDSTPTLQR.K3

UYOR006C115.8%313356865.8YOR006C SGDID:S000005532, Chr XV from 338621-337680, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.09199.09199.22.5240.3013100.0%1972.27221969.88715.52844.1%1N.RRGNGSQSDTSESEENSE.Q2

UYKR071C115.7%348385435.3DRE2 SGDID:S000001779, Chr XI from 575622-574576, reverse complement, Verified ORF, "Protein of unknown function; mutation displays synthetic lethal interaction with the pol3-13 allele of CDC2"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_17.08295.08295.23.24170.24697.8%2285.1522284.173145.33734.2%1R.VVDDLIEDS*DDDDFSSDSSK.A2

UReverse_YMR018W115.6%514590658.4YMR018W SGDID:S000004620, Chr XIII from 310207-311751, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_85.33925.33925.32.71870.225890.8%3220.07453224.5198154.57321.4%1T.RADRAASDNTQFDSFKGLNNWKLGLGNNI.K3

UReverse_YBR050C115.6%338387478.1REG2 SGDID:S000000254, Chr II from 338197-337181, reverse complement, Verified ORF, "Regulatory subunit of the Glc7p type-1 protein phosphatase; involved with Reg1p, Glc7p, and Snf1p in regulation of glucose-repressible genes, also involved in glucose-induced proteolysis of maltose permease"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04822.04822.22.39940.151394.1%2208.73222206.3403614.47630.6%1D.LESKSCPRQEDTSNLRTSP.L2

UYJR064W125.3%562619145.5CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_69.27318.27318.34.38780.224198.8%3103.16433100.447315.00927.6%2K.SQDDEIGDGTTGVVVLASALLDQALELIQK.G3

UYDR432W115.3%414454075.5NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_44.18181.18181.23.36110.3284100.0%2439.23222438.650136.21435.7%1R.DFDGTGALEFPSEEILVEALER.L2

UYGL076C115.3%2442763810.1RPL7A SGDID:S000003044, Chr VII from 365999-365989,365529-365436,364967-364338, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)"
UYPL198W115.3%2442769610.1RPL7B SGDID:S000006119, Chr XVI from 173151-173161,173571-173664,174072-174701, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Ap and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_7.04716.04716.23.26050.2608100.0%1573.19211573.659215.81162.5%1R.NAAYQKEYETAER.N2

UYLR044C115.2%563614956.2PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_45.18403.18403.33.48990.243798.7%3272.75443269.7435.13322.3%1K.QVNVNTVFGLPGDFNLSLLDKIYEVEGMR.W3

UYMR014W115.2%519600548.8BUD22 SGDID:S000004616, Chr XIII from 298867-300426, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_8.04890.04890.33.57810.306696.5%3033.02443032.97563845.20623.1%1K.TANANQTHSNIDYDT*DDGNEKNAIDSK.S3

UYHR064C115.2%538582385.1SSZ1 SGDID:S000001106, Chr VIII from 227143-225527, reverse complement, Verified ORF, "Hsp70 protein that interacts with Zuo1p (a DnaJ homolog) to form a ribosome-associated complex that is bound to the ribosome via the Zuo1p subunit; also involved in pleiotropic drug resistance via sequential activation of PDR1 and PDR5"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.09100.09100.34.360.335397.7%3452.24443448.369915.56931.5%1K.TLEPIPKEENAEEDDES*EWS*DDEPEVVR.E3

UReverse_YIL083C115.2%365418938.3YIL083C SGDID:S000001345, Chr IX from 204650-203553, reverse complement, Uncharacterized ORF, "Homolog to human PPCS"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_98.39805.39805.21.61850.070991.8%2359.6722360.730274.39736.1%1K.EMYKDYLKKNKLVNEAFEP.K2

UYBR117C115.0%681750296.1TKL2 SGDID:S000000321, Chr II from 476431-474386, reverse complement, Verified ORF, "Transketolase, similar to Tkl1p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_56.22552.22552.21.64920.221696.0%3541.85233543.84281964.63118.2%1G.QGISNAVGMAIAQANFAATYNEDGFPISDSYTFA.I2

UYGL140C114.8%12191374768.1YGL140C SGDID:S000003108, Chr VII from 245017-241358, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_30.12989.12989.43.05360.128195.1%6492.77646497.8761134.72710.9%1E.AVTGFDNFINGKSNPMNTRRNRTPFDGTSIISEGNESLQSTNSNESQISPDSTRSYEPE.C4

UYJL034W224.8%682744684.9KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_19.08985.08985.36.84290.4714100.0%3589.43433588.46718.63931.2%1I.TSKLYGGADGSGAADYDDEDEDDDGDYFEHDEL.-3
Jamie_phos_01_itms_22.10241.10241.24.51250.5394100.0%3271.49223272.109619.98636.2%1K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.-2

UYOR140W114.7%766833178.7SFL1 SGDID:S000005666, Chr XV from 586981-589281, Verified ORF, "Transcription repressor involved in regulation of flocculation-related genes, inhibits transcription by recruiting general corepressor Cyc8p-Tup1p to different promoters; negatively regulated by cAMP-dependent protein kinase A subunit Tpk2p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_27.11898.11898.33.86620.435896.4%3170.84423169.1765.24620.7%1E.ETVSAPAPAS*T*PAPAGTDVGSGGAAAGIANAGAEGG.D3

UYJL036W114.7%423490026.5SNX4 SGDID:S000003573, Chr X from 378741-380012, Verified ORF, "Sorting nexin, involved in the retrieval of late-Golgi SNAREs from the post-Golgi endosome to the trans-Golgi network and in cytoplasm to vacuole transport; contains a PX domain; forms complex with Snx41p and Atg20p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_59.23812.23812.22.47190.162799.6%2305.8722305.731425.07136.8%1R.FPTCIIPPLPDKKVFQYIAG.D2

UYJL137C114.7%380445466.0GLG2 SGDID:S000003673, Chr X from 156045-154903, reverse complement, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_64.25531.25531.21.88750.068290.4%2203.4122205.40451634.32929.4%1P.CLQDLLNHGKRENQKHVD.L2

UReverse_YPL066W114.6%479548949.4YPL066W SGDID:S000005987, Chr XVI from 426230-427669, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_104.44137.44137.22.29720.063591.1%2704.81232705.13864.3628.6%1S.TNKIRGFNKYFKKAFKATQREQ.L2

UReverse_YJL121C114.6%238259676.3RPE1 SGDID:S000003657, Chr X from 191010-190294, reverse complement, Verified ORF, "D-ribulose-5-phosphate 3-epimerase, catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway; mutants are sensitive to oxidative stress"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_5.03595.03595.21.82330.23193.8%1171.67211172.2401274.47560.0%1K.KETNSADGPRP.V2

UReverse_YIL128W114.5%10321178825.9MET18 SGDID:S000001390, Chr IX from 113806-116904, Verified ORF, "DNA repair and TFIIH regulator, required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription; possible role in assembly of a multiprotein complex(es) required for NER and RNAP II transcription"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_52.21145.21145.33.71410.295692.8%5276.39455271.9952115.01313.3%1S.NYKHPLSLSLLLPVITSVHETILTHHKDTT*DKLTELASVRVEPDPM.D3

UYGL008C334.5%918996195.1PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_23.10612.10612.24.9640.4146100.0%2482.85232481.715617.47445.2%1R.PVPEEYLQTDPSYGLTSDEVLK.R2
Jamie_phos_01_itms_8.05028.05028.22.59290.229798.9%2293.81232295.3806944.95233.3%1K.TVEEDHPIPEDVHENYENK.V2
Jamie_phos_01_itms_8.05062.05062.34.09050.241597.7%2296.07452295.380614.89944.4%1K.TVEEDHPIPEDVHENYENK.V3

UYJR124C114.5%448496647.6YJR124C SGDID:S000003885, Chr X from 654153-652807, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_106.45015.45015.21.67130.179690.5%2234.3722236.6846174.32731.6%1I.TADLILACMFLGVDAKIKKQ.M2

UReverse_YPL203W114.5%380442197.2TPK2 SGDID:S000006124, Chr XVI from 166255-167397, Verified ORF, "Subunit of cytoplasmic cAMP-dependent protein kinase, which contains redundant catalytic subunits Tpk1p, Tpk2p, and Tpk3p and regulatory subunit Bcy1p; promotes vegetative growth in response to nutrients; activates filamentous growth"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_102.42997.42997.21.57120.219295.7%1990.17211989.32141244.62525.0%1K.SLLDVVDPHFYPPYVVK.G2

UYJL045W114.4%634693837.4YJL045W SGDID:S000003581, Chr X from 355940-357844, Uncharacterized ORF, "Similar to SDH1"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_13.07039.07039.33.23650.286596.6%3116.27443112.1973315.19823.1%1F.SCTSAHTCTGDGNAMVS*RAGFPLEDLEF.V3

UReverse_YMR155W114.4%547600448.1YMR155W SGDID:S000004764, Chr XIII from 568550-570193, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_75.29811.29811.22.12060.146494.9%2646.49222644.9507314.51926.1%1F.IASCVSINKFSKSARLSPDEISSF.D2

UYLR197W114.4%504568648.9SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_27.12108.12108.22.69480.155798.3%2219.4122218.37943374.83131.0%1K.GAAEALENANDISEGLVSESLK.A2

UYER165W114.3%577643446.0PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_24.11055.11055.23.7290.3939100.0%2787.79222787.947816.73735.4%1K.NLDDSVDDEKLEEEFAPYGTITSAK.V2

UReverse_YJR070C114.3%325361654.9LIA1 SGDID:S000003831, Chr X from 570512-569535, reverse complement, Verified ORF, "Protein with a possible role in microtubule function; complements S. pombe mmd1 mutation affecting mitochondrial distribution although not required for this process in S. cerevisiae; binds to Hyp2p (eIF5A); contains HEAT-like repeats"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_9.05543.05543.31.78230.111297.6%1384.55431380.53774435.00334.6%1S.SEASFGTALALIAE.D3

UReverse_YDR014W114.2%647747225.9RAD61 SGDID:S000002421, Chr IV from 474043-475986, Verified ORF, "Protein of unknown function; mutation confers radiation sensitivity"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_60.23992.23992.21.75460.260393.5%2993.55222993.30614.47526.9%1D.DDSFEVDSSSPLGKNSRFPTRLVPGRK.G2

UReverse_YOR042W114.1%411468704.8CUE5 SGDID:S000005568, Chr XV from 408424-409659, Uncharacterized ORF, "Protein containing a CUE domain that binds ubiquitin, which may facilitate intramolecular monoubiquitination; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04579.04579.22.97560.198995.4%1987.33221987.3186224.59540.6%1Q.RRRAPAEPNKRVPQTPL.E2

UYOR063W114.1%3874375810.3RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04769.04769.24.01190.3448100.0%1639.25221639.675716.5866.7%1R.VGKGDDEANGATSFDR.T2

UYBR283C113.9%490533128.1SSH1 SGDID:S000000487, Chr II from 770411-768939, reverse complement, Verified ORF, "Subunit of the Ssh1 translocon complex; Sec61p homolog involved in co-translational pathway of protein translocation; not essential"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_31.13524.13524.22.44610.155195.7%1989.51221992.3813304.62436.1%1A.MIINTVVIATNLVADTFGV.S2

UYGL075C113.9%387445858.3MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_12.06609.06609.23.40570.290897.7%1595.63221595.660425.36660.7%1R.TSDPGS*PLVTGIDQK.A2

UYDR502C113.9%384422565.4SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)"
UYLR180W113.9%382418185.2SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_13.07059.07059.23.48030.3387100.0%1447.35221445.618216.03371.4%1R.FVIGGPQGDAGLTGR.K2

UYER006W113.8%520577098.9NUG1 SGDID:S000000808, Chr V from 162722-164284, Verified ORF, "GTPase that associates with nuclear 60S pre-ribosomes, required for export of 60S ribosomal subunits from the nucleus"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_23.10648.10648.23.48940.3228100.0%2340.27222339.384516.59139.5%1I.DYNIDFYGEDVEGESELEKS.R2

UReverse_YOR311C113.8%290328408.8HSD1 SGDID:S000005838, Chr XV from 899923-899051, reverse complement, Verified ORF, "Endoplasmic reticulum (ER)-resident membrane protein, overproduction induces enlargement of ER-like membrane structures and suppresses a temperature-sensitive sly1 mutation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_64.25660.25660.21.59350.204899.3%1241.75221244.4795124.98255.0%1S.KLHIETVPVHA.D2

UReverse_YJL093C113.6%691774087.1TOK1 SGDID:S000003629, Chr X from 256728-254653, reverse complement, Verified ORF, "Outward-rectifier potassium channel of the plasma membrane with two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_53.21345.21345.22.28250.229697.1%2564.83232562.0393124.71427.1%1S.TSIDFLLDGVTSLIAGMLPVAGLAW.I2

UYEL046C113.6%387428156.3GLY1 SGDID:S000000772, Chr V from 68792-67629, reverse complement, Verified ORF, "Threonine aldolase, catalyzes the cleavage of L-allo-threonine and L-threonine to glycine; involved in glycine biosynthesis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_10.05759.05759.24.18970.4192100.0%1572.29221572.539416.39880.8%1R.SES*TEVDVDGNAIR.E2

UReverse_YMR172W113.5%719794168.0HOT1 SGDID:S000004783, Chr XIII from 605980-608139, Verified ORF, "Transcription factor required for the transient induction of glycerol biosynthetic genes GPD1 and GPP2 in response to high osmolarity; targets Hog1p to osmostress responsive promoters; has similarity to Msn1p and Gcr1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_105.44779.44779.33.05460.234495.2%2797.13432792.73441615.07925.0%1D.HFS*NS*ASTVGSHISSNTYNMSTTSN.H3

UReverse_YLR188W113.5%695759509.8MDL1 SGDID:S000004178, Chr XII from 528302-530389, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane, mediates export of peptides generated upon proteolysis of mitochondrial proteins, plays a role in the regulation of cellular resistance to oxidative stress"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_92.36629.36629.22.23180.204998.3%2525.03222525.012224.87232.6%1I.IRSANAVAGIIFVAGLATFFQKKT.F2

UYNL251C113.5%575638599.2NRD1 SGDID:S000005195, Chr XIV from 174316-172589, reverse complement, Verified ORF, "RNA-binding protein that interacts with the C-terminal domain of the RNA polymerase II large subunit (Rpo21p), required for transcription termination and 3' end maturation of nonpolyadenylated RNAs"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_89.35383.35383.21.99940.230197.9%2440.25222437.449225.33334.2%1Q.DDDFQNFVATLES*FKDLKS*G.I2

UYAL022C113.5%517583175.1FUN26 SGDID:S000000020, Chr I from 110431-108878, reverse complement, Verified ORF, "Nucleoside transporter with broad nucleoside selectivity; localized to intracellular membranes"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_31.13377.13377.22.29050.102494.9%1971.67211968.991794.51435.3%1S.SSSGDEEHNGSVIVDLCY.M2

UYDL182W113.5%428470997.3LYS20 SGDID:S000002341, Chr IV from 133438-134724, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys21p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_11.06235.06235.22.78280.312593.9%1708.15221708.8253385.28346.4%1K.NFHAEVST*PQVLSAK.K2

UReverse_YGL245W113.4%708808437.5GUS1 SGDID:S000003214, Chr VII from 39023-41149, Verified ORF, "Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_52.21189.21189.21.93990.166692.8%2704.6522705.95021494.43523.9%1I.IVNGWDMLTVEEDVNIVDADDKDV.V2

UReverse_YNL101W113.4%713800269.3AVT4 SGDID:S000005045, Chr XIV from 435001-437142, Verified ORF, "Vacuolar transporter, exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_78.30936.30936.33.20380.254990.0%2990.30442986.3767394.98725.0%1V.LIY*YCWYSYIGFFALMSVSFFLGG.N3

UReverse_YHR207C113.4%526605476.5SET5 SGDID:S000001250, Chr VIII from 516485-514905, reverse complement, Verified ORF, "Zinc-finger protein of unknown function, contains one canonical and two unusual fingers in unusual arrangements; deletion enhances replication of positive-strand RNA virus"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_42.17653.17653.21.77180.178293.6%1953.63221952.89991525.28632.4%1G.NET*GNHVASQDSDNLTGI.K2

UYCR012W113.4%416447387.6PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_19.08986.08986.23.59030.316100.0%1580.51221580.731916.02969.2%1K.VLENTEIGDSIFDK.A2

UReverse_YHL050C113.3%697790266.6YHL050C SGDID:S000001042, Chr VIII from 3310-2670,1897-445, reverse complement, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_83.32751.32751.22.18890.199998.6%2294.03222294.524224.88131.8%1A.TTTASTRVNTSATTTANTGLPVK.S2

UYPL105C113.2%849943567.8YPL105C SGDID:S000006026, Chr XVI from 355409-352860, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_96.38838.38838.21.21020.339691.2%3070.1523067.1663575.16917.3%1S.SENTATSIT*TNLAPWANKKPEGAVY*NQ.I2

UYFR006W113.2%535617546.2YFR006W SGDID:S000001902, Chr VI from 156139-157746, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_64.25311.25311.21.79290.041791.1%2223.6122225.53271114.35531.2%1P.NYDDPDPMFRYLRIRRP.L2

UYPL217C113.0%11831355716.8BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_15.07649.07649.35.32260.371696.2%4089.92434090.094516.21225.7%1R.IYGKPVQEEDADIDNLPS*DEEPYTNDDDVQDSEPR.M3

UYPL189W113.0%609712899.5GUP2 SGDID:S000006110, Chr XVI from 189153-190982, Verified ORF, "Probable membrane protein with a possible role in proton symport of glycerol; member of the MBOAT family of putative membrane-bound O-acyltransferases; Gup1p homolog"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_69.27505.27505.22.1110.223992.3%2094.8922095.566274.43132.4%1D.TPLQQAMIALFNLNIMYL.K2

UReverse_YDR291W112.9%10771235496.7YDR291W SGDID:S000002699, Chr IV from 1039722-1042955, Uncharacterized ORF, "Putative DNA helicase"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_74.29326.29326.31.77810.179991.4%3636.05443636.8906104.60315.8%1F.QDEEGGRLSVCKSPWPLFRNSAHYGDQNHHL.R3

UReverse_YPL231W112.8%18872069455.4FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_97.39348.39348.42.64270.213893.0%5694.93655700.42432074.61513.1%1E.SRGLHKMMENITASENKDNAKTSTGHFSAVGLDDITLGYTALAGRLPAIRPDR.K4

UReverse_YEL070W112.8%502564706.2YEL070W SGDID:S000000796, Chr V from 19589-21097, Uncharacterized ORF, "Deletion suppressor of mpt5 mutation"
UReverse_YNR073C112.8%502564706.2YNR073C SGDID:S000005356, Chr XIV from 776300-774792, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_96.38652.38652.21.87410.112990.1%1659.81211656.8319104.29742.3%1G.NQPMNDCSMITFPT.L2

UYBR287W112.8%427475064.9YBR287W SGDID:S000000491, Chr II from 776567-777850, Uncharacterized ORF, "Protein of unknown function; mutation results in a zinc sensitive phenotype"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_70.27772.27772.32.60570.246894.2%1774.64441770.822315.02347.7%1I.WQKS*CT*VFERIR.A3

UReverse_YNL130C112.8%393448296.6CPT1 SGDID:S000005074, Chr XIV from 380833-380784,380691-379560, reverse complement, Verified ORF, "Cholinephosphotransferase, required for phosphatidylcholine biosynthesis and for inositol-dependent regulation of EPT1 transcription"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_22.10216.10216.31.32040.275195.9%1328.75441332.3694604.74940.0%1H.NSLFSRDDSQY.K3

UReverse_YHR195W112.8%321364215.2NVJ1 SGDID:S000001238, Chr VIII from 490747-491712, Verified ORF, "Nuclear envelope protein that interacts with the vacuolar membrane protein Vac8p to promote formation of nucleus-vacuole junctions during piecemeal microautophagy of the nucleus (PMN)"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_11.06067.06067.21.84480.11890.8%950.97217950.12582814.34656.2%1V.SLGLSFIGR.V2

UReverse_YKL105C112.7%11321255935.8YKL105C SGDID:S000001588, Chr XI from 242227-238829, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_71.27963.27963.21.99860.167798.9%3117.25223119.320324.95323.3%1T.KTNSATKGTSSDINPSTEISYISSSTSSPVA.S2

UYMR309C112.7%812932045.0NIP1 SGDID:S000004926, Chr XIII from 895425-892987, reverse complement, Verified ORF, "Subunit of the eukaryotic translation initiation factor 3 (eIF3), involved in the assembly of preinitiation complex and start codon selection"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_55.22015.22015.23.65230.2744100.0%2399.07232396.6104445.7731.0%1K.DQLDSADYVDNLIDGLSTILSK.Q2

UReverse_YJL090C112.6%764872419.0DPB11 SGDID:S000003626, Chr X from 264967-262673, reverse complement, Verified ORF, "Essential BRCT repeat protein, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_24.11074.11074.22.37150.350692.5%2393.3722393.3123235.2331.6%1Q.GQDDDDNHSSTDKIVFNQY*N.Y2

UReverse_YDR219C112.6%465531688.7YDR219C SGDID:S000002627, Chr IV from 906846-905449, reverse complement, Uncharacterized ORF, "Mitochondria-associated F-box protein involved in maintenance of normal mitochondrial morphology"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_16.08045.08045.22.21850.101192.6%1312.95211312.561324.43368.2%1Y.GRSVSRRGVKPL.I2

UYGL094C112.5%11151270396.7PAN2 SGDID:S000003062, Chr VII from 334468-331121, reverse complement, Verified ORF, "Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, which acts to control poly(A) tail length and regulate the stoichiometry and activity of postreplication repair complexes"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_89.35563.35563.21.7710.2386100.0%3019.47223016.4822795.66124.1%1L.HPLLPTVMIVASSSGSFDFIDLSNPTLR.T2

UYPL019C112.5%835965537.4VTC3 SGDID:S000005940, Chr XVI from 517016-514509, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_13.06741.06741.23.15680.353497.6%2451.95212453.405815.38845.0%1R.HVIADLEDHES*S*DEEGTALPK.K2

UYDL164C112.5%755848287.5CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_89.35393.35393.22.13090.271690.0%2062.6722061.145185.11638.9%1K.LKQTAVTHTVAAPS*SMGS*N.F2

UYAL005C112.5%642697685.1SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall"
UYLL024C112.5%639694705.1SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall"
UYBL075C112.5%649705475.2SSA3 SGDID:S000000171, Chr II from 86446-84497, reverse complement, Verified ORF, "ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_8.05045.05045.23.52240.3776100.0%1676.27221676.696416.8363.3%1K.ATAGDTHLGGEDFDNR.L2

UYDR098C-B222.4%17551985948.4YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYGR038C-B222.4%17551985208.2YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYER138C222.4%17551985618.1YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYDR365W-B222.4%17551986588.0YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYDR316W-B222.4%17551985268.2YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYDR261C-D222.6%16041816607.5YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
UYDR210C-D222.4%17551988388.4YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_7.04539.04539.23.38970.276991.1%1708.45211706.725715.17670.0%1A.SSAVPENPHHAS*PQPA.S2
Jamie_phos_01_itms_7.04845.04845.33.53130.251994.1%2872.40432871.818125.0326.0%1R.HSDS*YSENETNHTNVPISSTGGTNNK.T3

UYIL048W112.4%11511302186.5NEO1 SGDID:S000001310, Chr IX from 261436-264891, Verified ORF, "Protein involved in the retrograde transport from the Golgi complex to the ER and the endosomal membrane traffic; putative aminophospholipid translocase; member of the highly conserved Drs2 family of P-type ATPases"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_28.12544.12544.33.3880.301498.8%3041.72443043.367255.10823.1%1R.VACPLTQNLSENDLINRISITASAPEKS.I3

UYOR018W112.4%837923498.8ROD1 SGDID:S000005544, Chr XV from 364368-366881, Verified ORF, "Membrane protein; overexpression confers resistance to the GST substrate o-dinitrobenzene as well as to zinc and calcium; contains 2 PY motifs, which are required for Rod1p interaction with Rsp5p, a hect-type ubiquitin ligase"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_53.21293.21293.21.90030.124698.9%2071.77222074.381314.94834.2%1E.FPFSAIIPGSLVESVEGLPN.A2

UReverse_YKR027W112.4%765880445.7YKR027W SGDID:S000001735, Chr XI from 491007-493304, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_44.18173.18173.22.10590.229390.6%1950.19211949.225714.33241.2%1F.AIPMSVSSADIGTIYFFE.G2

UYML123C112.4%587643826.4PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_8.04899.04899.22.80670.34796.6%1546.63221546.590715.74869.2%1R.ASTAVES*LDNHPPK.A2

UYKL222C112.3%705822488.1YKL222C SGDID:S000001705, Chr XI from 5621-3504, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; similar to transcriptional regulators from the zinc cluster (binuclear cluster) protein family; null mutant is sensitive to caffeine"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_80.31570.31570.21.78850.165391.8%1749.83221747.08814.37246.7%1L.FTDVKISLSTGIPVRI.N2

UYDR338C112.3%695778465.3YDR338C SGDID:S000002746, Chr IV from 1149458-1147371, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_58.23242.23242.21.68740.0690.5%1805.89221804.90841294.32333.3%1H.DEEDGELSRTISLPSR.V2

UReverse_YDL113C112.3%640725467.0ATG20 SGDID:S000002271, Chr IV from 258555-256633, reverse complement, Verified ORF, "Protein required for transport of aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole targeting pathway; binds phosphatidylinositol-3-phosphate, involved in localization of membranes to the preautophagosome, potential Cdc28p substrate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_94.37740.37740.22.17690.200897.7%1466.83221466.5174.74446.4%1K.GGYSKGGSGTNNNPR.E2

UReverse_YIL129C112.2%23762698566.3TAO3 SGDID:S000001391, Chr IX from 113237-106107, reverse complement, Verified ORF, "Protein involved in cell morphogenesis and proliferation, associated with protein kinase Cbk1p; mutants activate OCH1 transcription"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_15.07738.07738.44.28230.15394.3%5582.85645577.0813064.69513.4%1L.QSNAISPSSTASNNSSSAKILPVKNNFSSSVHRKMGPLNNTNNNHKYKSTTN.S4

UYJL080C112.2%12221348095.8SCP160 SGDID:S000003616, Chr X from 289142-285474, reverse complement, Verified ORF, "Essential RNA-binding G protein effector of mating response pathway, predominantly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_43.17757.17757.22.0170.122598.3%3108.55223108.5625554.86323.1%1P.REKAKATKTSIQDYLKKLASNLDEEKV.K2

UYPL084W112.1%844972765.4BRO1 SGDID:S000006005, Chr XVI from 394035-396569, Verified ORF, "Cytoplasmic class E vacuolar protein sorting (VPS) factor that coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_20.09498.09498.22.34280.20591.8%2101.9122103.432114.38341.2%1L.AFEKSCTLFNIAVIFTQI.A2

UReverse_YLL054C112.1%769891637.8YLL054C SGDID:S000003977, Chr XII from 35203-32894, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_10.05832.05832.22.76370.214792.3%1962.67211962.292734.43246.7%1L.SIELLPYVPYITKYFD.V2

UReverse_YLR032W112.0%11691340026.4RAD5 SGDID:S000004022, Chr XII from 204992-208501, Verified ORF, "Single-stranded DNA-dependent ATPase, involved in postreplication repair; contains RING finger domain"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_92.37013.37013.21.91180.241694.6%2727.51222728.144824.50631.8%1I.ERDYQIDFIRVLSAMSAKKRGRS.D2

UYLL003W112.0%9461129789.8SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_25.11128.11128.23.49210.334293.8%2274.9122275.431415.28550.0%1R.DKFVPETS*PTNIPT*DVLIK.Q2

UYMR155W112.0%547600448.1YMR155W SGDID:S000004764, Chr XIII from 568550-570193, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_2.01768.01768.21.3770.190390.1%1168.71221168.2487154.29450.0%1N.DYIGSPVRSSS.P2

UYJR127C111.9%13801550628.0RSF2 SGDID:S000003888, Chr X from 662974-658832, reverse complement, Verified ORF, "Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_64.25588.25588.21.93010.230494.4%2877.81232875.4771044.48524.0%1S.NFAKPAGQGILPIPKKSRIIKTDKPR.P2

UYDR421W111.9%9501082056.3ARO80 SGDID:S000002829, Chr IV from 1312030-1314882, Verified ORF, "Zinc finger transcriptional activator of the Zn2Cys6 family; activates transcription of aromatic amino acid catabolic genes in the presence of aromatic amino acids"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_25.11273.11273.22.21630.203699.0%1956.87221954.2666304.88535.3%1W.MLTGSAVRLAQDMGFIEN.S2

UReverse_YAL017W111.8%13561523305.7PSK1 SGDID:S000000015, Chr I from 120226-124296, Verified ORF, "One of two (see also PSK2) PAS domain containing S/T protein kinases; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_26.11789.11789.22.36230.250697.4%2823.95212825.16631954.74325.0%1Y.KLKNTRHALDEYTSLNSMDKLTGTS.I2

UReverse_YBL101C111.7%11171236096.9ECM21 SGDID:S000000197, Chr II from 28299-24946, reverse complement, Verified ORF, "Non-essential protein of unknown function; promoter contains several Gcn4p binding elements"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_34.14712.14712.22.37780.298990.6%2379.69212382.30742085.22627.8%1I.DEEGS*EENKLQHSS*MHLHN.K2

UReverse_YEL063C111.7%590657868.4CAN1 SGDID:S000000789, Chr V from 33466-31694, reverse complement, Verified ORF, "Plasma membrane arginine permease, requires phosphatidyl ethanolamine (PE) for localization, exclusively associated with lipid rafts; mutation confers canavanine resistance"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_106.45109.45109.21.09390.089792.0%902.1722904.99817984.42533.3%1Y.GNAAGFAPSL.F2

UReverse_YOR291W111.6%14721667496.1YOR291W SGDID:S000005817, Chr XV from 861172-865590, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_8.05099.05099.22.65230.192493.3%2611.6122609.812714.44834.8%1G.NPESIQVGLVDLGDETLTGTKDFC.M2

UYJL041W111.6%823865166.3NSP1 SGDID:S000003577, Chr X from 365700-365700,365819-368289, Verified ORF, "Essential component of the nuclear pore complex, which mediates nuclear import and export"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_100.41878.41878.21.85240.181392.1%1286.95211284.3251904.40441.7%1A.NPAGASQPEPTTN.E2

UYMR229C111.5%17291931336.2RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_14.07103.07103.33.69920.349997.8%3199.85423201.11944445.50224.0%1K.VEDAEY*ESS*DDEDEKLDKSNELPNLR.R3

UYML059C111.5%16791871328.1NTE1 SGDID:S000004524, Chr XIII from 158258-153219, reverse complement, Verified ORF, "Serine esterase that deacylates exogenous lysophospholipids, homolog of human neuropathy target esterase (NTE); mammalian NTE1 deacylates phosphatidylcholine to glycerophosphocholine"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_105.44610.44610.32.54370.246595.2%2815.88432819.057434.71224.0%1L.KGRVSPRPNLLPTTSFSAAQEETEDS.A3

UYBL047C111.5%13811507834.7EDE1 SGDID:S000000143, Chr II from 132043-127898, reverse complement, Verified ORF, "Key endocytic protein involved in a network of interactions with other endocytic proteins, binds membranes in a ubiquitin-dependent manner, may also bind ubiquitinated membrane-associated proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_13.06780.06780.23.60330.18991.6%2260.8722259.542594.36835.0%1S.LQDMPHQVSAPAVNTQPTVPQ.V2

UYIL147C111.5%12201344357.5SLN1 SGDID:S000001409, Chr IX from 73453-69791, reverse complement, Verified ORF, "Histidine kinase osmosensor that regulates a MAP kinase cascade; transmembrane protein with an intracellular kinase domain that signals to Ypd1p and Ssk1p, thereby forming a phosphorelay system similar to bacterial two-component regulators"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_13.06749.06749.21.85270.220295.2%1896.55211897.99083454.54332.4%1D.REKASNDDVSSIVSTTTS.S2

UReverse_YLR383W111.5%11141280087.5SMC6 SGDID:S000004375, Chr XII from 885288-888632, Verified ORF, "Protein involved in structural maintenance of chromosomes; required for interchromosomal and sister chromatid recombination; homologous to S. pombe rad18"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_84.33177.33177.22.08320.111595.1%1991.73221991.162224.5640.6%1T.SDYQEKIPQAEQAIQEI.K2

UReverse_YCR030C111.5%870961378.6SYP1 SGDID:S000000626, Chr III from 176433-173821, reverse complement, Verified ORF, "Protein with a potential role in actin cytoskeletal organization; overexpression suppresses a pfy1 (profilin) null mutation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_6.04241.04241.21.78370.131794.3%1341.33221339.59272134.49941.7%1N.IGIPLPSNMVSNP.L2

UReverse_YNL138W111.5%526575225.6SRV2 SGDID:S000005082, Chr XIV from 366743-368323, Verified ORF, "CAP (cyclase-associated protein) subunit of adenylyl cyclase complex; N-terminus binds adenylyl cyclase and facilitates activation by RAS; C-terminus binds ADP-actin monomers, facilitating regulation of actin dynamics and cell morphogenesis"
UYNL071W111.7%482518187.8LAT1 SGDID:S000005015, Chr XIV from 491524-492972, Verified ORF, "Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex, which catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
Jamie_phos_01_itms_98.40030.40030.11.47360.2703100.0%718.78717.75385425.79450.0%1S.APSPSSTA.G1

UReverse_YHR164C111.4%15221716946.5DNA2 SGDID:S000001207, Chr VIII from 429180-424612, reverse complement, Verified ORF, "Essential tripartite DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, and helicase activities; required for Okazaki fragment processing; involved in DNA repair pathways; potential Cdc28p substrate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_27.11965.11965.22.53440.21596.8%2386.99222389.5623424.71230.0%1L.MGEVCQLTLEAEGHNTINDKE.S2

UYPL226W111.4%11961343315.9NEW1 SGDID:S000006147, Chr XVI from 121767-125357, Verified ORF, "ATP binding cassette family member; Asn/Gln-rich rich region supports [NU+] prion formation, susceptibility to [PSI+] prion induction and aggregation of a fragment of the human Machado-Joseph Disease protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04570.04570.22.38350.346100.0%1897.27221897.8578336.01443.8%1L.SSPKGTPKPVDT*DDEED.-2

UReverse_YIL075C111.4%9451042326.2RPN2 SGDID:S000001337, Chr IX from 220697-217860, reverse complement, Verified ORF, "Subunit of the 26S proteasome, substrate of the N-acetyltransferase Nat1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_101.42487.42487.21.6460.245198.0%1310.41221309.50523374.81341.7%1G.IGLSAGHLLVDVD.E2

UYBR098W111.4%691787647.5MMS4 SGDID:S000000302, Chr II from 441509-443584, Verified ORF, "Subunit of the structure-specific Mms4p-Mus81p endonuclease that cleaves branched DNA; involved in recombination and DNA repair"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_1.00561.00561.21.84780.307197.4%1130.27221132.147345.45772.2%1H.GEDGTS*MAKR.V2

UYBR275C111.3%19162179596.6RIF1 SGDID:S000000479, Chr II from 757101-751351, reverse complement, Verified ORF, "Protein that binds to the Rap1p C-terminus and acts synergistically with Rif2p to help control telomere length and establish telomeric silencing; deletion results in telomere elongation"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_70.27711.27711.22.0030.11994.6%2627.05222628.9481054.50526.1%1I.NAQNGLDTVPKTIGGKEKHHEIQL.G2

UReverse_YBL017C111.3%15791777774.9PEP1 SGDID:S000000113, Chr II from 191586-186847, reverse complement, Verified ORF, "Type I transmembrane sorting receptor for multiple vacuolar hydrolases; cycles between the late-Golgi and prevacuolar endosome-like compartments"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_82.32565.32565.22.32980.143690.3%2157.31232156.374884.31534.2%1F.TRQDGWDFVSGDGVIGTTML.I2

UYGR014W111.3%13061331144.2MSB2 SGDID:S000003246, Chr VII from 516947-520867, Verified ORF, "Mucin family member at the head of the Cdc42p- and MAP kinase-dependent filamentous growth signaling pathway; also functions as an osmosensor in parallel to the Sho1p-mediated pathway; potential Cdc28p substrate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_94.37780.37780.21.44230.06690.9%1680.55211680.633314.33937.5%1T.SSFASSSTTEGSETSSQ.G2

UReverse_YGR162W111.3%9521071016.0TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_76.30017.30017.22.39630.238496.6%1393.71221393.450364.65654.5%1R.RTKEAESINEES.S2

UYLR045C111.2%8881009188.6STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_30.13282.13282.21.57840.220598.3%1098.05211095.1539434.83955.0%1N.FSIASGSTHST.I2

UYBR115C111.1%13921553455.9LYS2 SGDID:S000000319, Chr II from 473920-469742, reverse complement, Verified ORF, "Alpha aminoadipate reductase, catalyzes the reduction of alpha-aminoadipate to alpha-aminoadipate 6-semialdehyde, which is the fifth step in biosynthesis of lysine; activation requires posttranslational phosphopantetheinylation by Lys5p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_73.28629.28629.22.01160.191490.7%1574.43211572.75272844.33139.3%1K.LVSEGKPGILESDDL.M2

UReverse_YLR371W111.0%13561525969.2ROM2 SGDID:S000004363, Chr XII from 862713-866783, Verified ORF, "GDP/GTP exchange protein (GEP) for Rho1p and Rho2p; mutations are synthetically lethal with mutations in rom1, which also encodes a GEP"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_28.12312.12312.22.3880.046296.3%1727.51221728.9481144.64750.0%1D.FRAFYPNVSRQTEI.L2

UYPL160W111.0%10901241415.8CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_7.04648.04648.22.22770.163692.0%1201.87221202.5443844.42165.0%1Q.MNKLKAAGKIK.F2

UYMR205C111.0%9591046186.7PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_9.05445.05445.22.46430.225997.8%1305.21221305.346425.35572.2%1K.VHS*YTDLAYR.M2

UYNR016C110.9%22332503516.3ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_22.10085.10085.25.37240.5211100.0%2061.43212061.1718.79763.9%1R.AVS*VSDLSYVANSQSSPLR.E2

UReverse_YMR229C110.8%17291931336.2RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_76.30049.30049.22.02140.190291.5%1417.65221416.703734.37157.7%1I.SAVKVQLASGLPFV.S2

UReverse_YPL217C110.8%11831355716.8BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_6.04420.04420.21.70820.249199.6%936.71216934.039735.19472.2%1T.GPASPLPTGH.L2

UReverse_YDR170C110.6%20092268854.8SEC7 SGDID:S000002577, Chr IV from 802217-796188, reverse complement, Verified ORF, "Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_92.37018.37018.21.7870.183190.4%1323.57211322.3374694.32950.0%1K.TEATSGANEPGKC.K2

UYCR089W110.6%16091660364.9FIG2 SGDID:S000000685, Chr III from 267430-272259, Verified ORF, "Cell wall adhesin, expressed specifically during mating; may be involved in maintenance of cell wall integrity during mating"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_107.45438.45438.21.3290.086990.9%1001.092161000.09357424.33656.2%1S.ETYKSSATI.S2

UYBL088C110.5%27873215686.9TEL1 SGDID:S000000184, Chr II from 59379-51016, reverse complement, Verified ORF, "Protein kinase, primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_75.29451.29451.21.50630.262690.5%1557.15221556.7557814.32337.5%1Q.DFTKSFAEQLKEL.L2

UYLR106C110.4%49105593165.0MDN1 SGDID:S000004096, Chr XII from 363739-349007, reverse complement, Verified ORF, "Huge dynein-related AAA-type ATPase (midasin), forms extended pre-60S particle with the Rix1 complex (Rix1p-Ipi1p-Ipi3p), may mediate ATP-dependent remodeling of 60S subunits and subsequent export from nucleoplasm to cytoplasm"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_phos_01_itms_40.16642.16642.22.07620.254997.5%2289.55222288.583564.71534.2%1L.LAQFMGRELITLNAHQNTET.G2
ProteinsPeptide IDsSpectra
Unfiltered1107192316101590
Filtered205455505
Forward matches147396446
Decoy matches585959
Forward FP rate39.46%14.9%13.23%

/data/1/catclw/Projects/Jamie