* | STY | 80.0 |
# | X | 0.0 |
@ | X | 0.0 |
Static | C | 57.0 |
true | Use criteria |
0.0 | Minimum peptide confidence |
0.1 | Peptide false positive rate |
0.0 | Minimum protein confidence |
1.0 | Protein false positive rate |
1 | Minimum charge state |
16 | Maximum charge state |
0.0 | Minimum ion proportion |
1000 | Maximum Sp rank |
-1.0 | Minimum Sp score |
Include | Modified peptide inclusion |
Any | Tryptic status requirement |
false | Multiple, ambiguous IDs allowed |
Ignore | Peptide validation handling |
XCorr | Purge duplicate peptides by protein |
false | Include only loci with unique peptide |
true | Remove subset proteins |
Ignore | Locus validation handling |
con | Exclude protein names matching |
0 | Minimum modified peptides per locus |
1000 | Minimum redundancy for low coverage loci |
1 | Minimum peptides per locus |
Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
Locus | # of identical peptides | # of differing peptides |
U | YIL002W-A | 10 | 12 | 98.6% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
U | YBR109C | 5 | 5 | 60.5% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_48.19545.19545.3 | 5.4592 | 0.4057 | 100.0% | 4110.2344 | 4109.526 | 1 | 7.285 | 27.1% | 1 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
* | Jamie_phos_01_itms_10.05821.05821.2 | 3.121 | 0.2699 | 99.3% | 1761.7122 | 1760.8986 | 1 | 4.972 | 60.7% | 1 | S.RQLKSNDSEQELLEA.F | 2 |
* | Jamie_phos_01_itms_21.10003.10003.2 | 4.0072 | 0.3397 | 100.0% | 1510.4922 | 1510.5975 | 1 | 6.517 | 70.8% | 1 | K.SNDSEQELLEAFK.V | 2 |
* | Jamie_phos_01_itms_38.16155.16155.3 | 3.6318 | 0.2858 | 98.7% | 3371.3044 | 3368.651 | 1 | 5.138 | 28.3% | 1 | T.SIGEKLTDAEVDDMLREVSDGSGEINIQQFA.A | 3 |
* | Jamie_phos_01_itms_45.18507.18507.3 | 5.4176 | 0.4282 | 100.0% | 3366.1443 | 3366.7217 | 1 | 8.075 | 25.0% | 1 | K.LTDAEVDDMLREVSDGSGEINIQQFAALLSK.- | 3 |
U | YKL042W | 34 | 48 | 59.5% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
U | YOR257W | 4 | 5 | 44.1% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_46.18783.18783.4 | 4.993 | 0.3846 | 100.0% | 4780.9766 | 4781.215 | 1 | 5.374 | 17.1% | 1 | R.SSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELK.V | 4 |
* | Jamie_phos_01_itms_28.12340.12340.2 | 4.3826 | 0.4751 | 100.0% | 1667.6322 | 1667.7667 | 1 | 8.51 | 80.8% | 1 | R.EILDLIDEYDSEGR.H | 2 |
* | Jamie_phos_01_itms_15.07489.07489.2 | 3.2426 | 0.1892 | 98.9% | 1776.3722 | 1774.9658 | 1 | 4.917 | 60.0% | 2 | R.VAKELGETLTDEELRA.M | 2 |
* | Jamie_phos_01_itms_13.06840.06840.2 | 3.7449 | 0.3205 | 100.0% | 1406.1522 | 1405.5016 | 1 | 6.249 | 81.8% | 1 | K.ELGETLTDEELR.A | 2 |
U | YPL124W | 12 | 13 | 43.5% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
U | YDL130W | 3 | 3 | 40.6% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_18.08776.08776.2 | 3.2317 | 0.2655 | 100.0% | 1396.0922 | 1394.5266 | 1 | 6.024 | 77.3% | 1 | A.NVDNVWADVYAK.A | 2 |
* | Jamie_phos_01_itms_31.13501.13501.2 | 3.9205 | 0.3658 | 100.0% | 3257.7922 | 3258.1855 | 1 | 5.919 | 31.7% | 1 | A.AAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 2 |
* | Jamie_phos_01_itms_32.13684.13684.2 | 3.3767 | 0.3595 | 100.0% | 3045.9521 | 3044.9492 | 1 | 6.32 | 29.6% | 1 | A.GGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 2 |
U | YIL149C | 58 | 68 | 38.2% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
U | YOL039W | 2 | 2 | 37.7% | 106 | 10746 | 4.0 | RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_10.05902.05902.2 | 2.9174 | 0.2967 | 100.0% | 1333.9922 | 1334.4229 | 1 | 6.769 | 77.3% | 1 | K.SVDELITEGNEK.L | 2 |
* | Jamie_phos_01_itms_32.13673.13673.2 | 4.6558 | 0.4143 | 100.0% | 3075.0723 | 3074.9753 | 1 | 8.096 | 37.0% | 1 | A.SGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 2 |
U | YDL081C | 1 | 1 | 34.9% | 106 | 10908 | 3.9 | RPP1A SGDID:S000002239, Chr IV from 310122-309802, reverse complement, Verified ORF, "Ribosomal protein P1 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_27.11883.11883.3 | 5.254 | 0.4553 | 100.0% | 3812.6943 | 3813.8171 | 1 | 7.347 | 25.7% | 1 | A.GVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- | 3 |
U | YFR031C-A | 7 | 8 | 34.3% | 254 | 27408 | 11.1 | RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" |
U | YIL018W | 7 | 8 | 34.3% | 254 | 27408 | 11.1 | RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_10.05616.05616.2 | 3.1663 | 0.3073 | 100.0% | 1262.8522 | 1262.411 | 1 | 5.329 | 81.8% | 1 | R.KGAGSIFTSHTR.L | 2 | |
Jamie_phos_01_itms_24.10911.10911.3 | 4.8808 | 0.2526 | 98.8% | 3181.6443 | 3177.5823 | 1 | 5.122 | 30.8% | 1 | K.KASLNVGNVLPLGSVPEGTIVSNVEEKPGDR.G | 3 | |
Jamie_phos_01_itms_12.06403.06403.2 | 3.3047 | 0.2494 | 100.0% | 1843.4521 | 1842.0183 | 2 | 5.344 | 46.9% | 1 | R.ASGNYVIIIGHNPDENK.T | 2 | |
Jamie_phos_01_itms_11.06315.06315.3 | 4.1734 | 0.3515 | 100.0% | 2099.1243 | 2099.3108 | 53 | 6.095 | 31.9% | 1 | R.ASGNYVIIIGHNPDENKTR.V | 3 | |
Jamie_phos_01_itms_11.06306.06306.2 | 4.0622 | 0.3905 | 100.0% | 2099.1921 | 2099.3108 | 1 | 7.198 | 55.6% | 2 | R.ASGNYVIIIGHNPDENKTR.V | 2 | |
Jamie_phos_01_itms_3.02733.02733.2 | 2.5355 | 0.115 | 99.6% | 1261.6522 | 1262.4086 | 59 | 5.134 | 54.2% | 1 | K.ASTISRGAVSGQK.A | 2 | |
Jamie_phos_01_itms_6.04461.04461.2 | 2.5716 | 0.1675 | 100.0% | 1304.3322 | 1304.4459 | 20 | 5.211 | 68.2% | 1 | R.TGLLRGSQKTQD.- | 2 |
U | YDR382W | 1 | 1 | 32.7% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_25.11333.11333.3 | 4.4785 | 0.3349 | 97.1% | 3642.4443 | 3642.621 | 1 | 5.803 | 22.1% | 1 | A.AAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- | 3 |
U | YMR142C | 4 | 4 | 30.7% | 199 | 22525 | 11.1 | RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05067.05067.2 | 2.6402 | 0.3964 | 100.0% | 965.03217 | 965.0971 | 2 | 6.808 | 83.3% | 1 | K.AAGLTAAYAR.T | 2 | |
Jamie_phos_01_itms_10.05669.05669.2 | 2.8337 | 0.2888 | 100.0% | 1333.3121 | 1334.4313 | 3 | 5.224 | 75.0% | 1 | R.NQEIFDANVQR.L | 2 | |
* | Jamie_phos_01_itms_27.12034.12034.3 | 4.394 | 0.1827 | 98.7% | 2955.5344 | 2955.2512 | 20 | 5.147 | 24.1% | 1 | R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A | 3 |
Jamie_phos_01_itms_8.04883.04883.2 | 2.7425 | 0.3527 | 100.0% | 1193.8322 | 1194.2462 | 1 | 8.221 | 80.0% | 1 | R.AVQDNGESAFR.T | 2 |
U | YPL131W | 5 | 7 | 29.6% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_32.13857.13857.3 | 5.2928 | 0.3681 | 100.0% | 3500.1843 | 3500.7944 | 1 | 6.692 | 26.7% | 2 | K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V | 3 |
* | Jamie_phos_01_itms_25.11152.11152.2 | 3.4663 | 0.2775 | 100.0% | 2363.3323 | 2361.4749 | 1 | 5.559 | 45.0% | 1 | L.GLDETYKGVEEVEGEYELTEA.V | 2 |
* | Jamie_phos_01_itms_35.14937.14937.2 | 4.0888 | 0.3206 | 100.0% | 2096.152 | 2094.285 | 1 | 5.828 | 59.4% | 1 | R.FPGWDFETEEIDPELLR.S | 2 |
* | Jamie_phos_01_itms_47.19353.19353.3 | 5.0768 | 0.4266 | 100.0% | 3343.9744 | 3343.602 | 1 | 7.096 | 30.6% | 2 | R.SYIFGGHVSQYMEELADDDEERFSELFK.G | 3 |
* | Jamie_phos_01_itms_9.05518.05518.2 | 2.5292 | 0.2397 | 100.0% | 1140.8322 | 1141.3561 | 1 | 5.206 | 81.8% | 1 | R.VAAKIAALAGQQ.- | 2 |
U | YJR053W | 13 | 15 | 28.2% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
U | YBR048W | 3 | 3 | 24.4% | 156 | 17749 | 10.8 | RPS11B SGDID:S000000252, Chr II from 332829-332873,333385-333810, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Ap and has similarity to E. coli S17 and rat S11 ribosomal proteins" |
U | YDR025W | 3 | 3 | 24.4% | 156 | 17749 | 10.8 | RPS11A SGDID:S000002432, Chr IV from 491511-491555,491895-492320, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.04885.04885.2 | 2.2331 | 0.2514 | 100.0% | 1225.2322 | 1225.3843 | 26 | 5.54 | 65.0% | 1 | K.TAIEGSYIDKK.C | 2 | |
Jamie_phos_01_itms_18.08599.08599.2 | 2.2647 | 0.3687 | 100.0% | 1149.2922 | 1150.3293 | 2 | 7.635 | 66.7% | 1 | K.CPFTGLVSIR.G | 2 | |
Jamie_phos_01_itms_12.06700.06700.2 | 3.0651 | 0.3136 | 100.0% | 1859.0721 | 1857.1266 | 1 | 5.76 | 53.1% | 1 | R.VQVGDIVTVGQCRPISK.T | 2 |
U | YJL177W | 4 | 4 | 23.9% | 184 | 20551 | 10.9 | RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins" |
U | YKL180W | 4 | 4 | 23.9% | 184 | 20549 | 10.9 | RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_3.02466.02466.2 | 2.7656 | 0.2819 | 100.0% | 1237.0721 | 1237.3579 | 158 | 6.013 | 59.1% | 1 | M.ARYGATSTNPAK.S | 2 | |
Jamie_phos_01_itms_6.04444.04444.2 | 2.7843 | 0.2108 | 98.1% | 1482.7322 | 1482.5931 | 24 | 4.763 | 42.9% | 1 | R.YGATSTNPAKSASAR.G | 2 | |
Jamie_phos_01_itms_7.04552.04552.2 | 2.9013 | 0.2828 | 100.0% | 1166.1921 | 1166.3195 | 1 | 5.966 | 85.0% | 1 | R.TAQGKEFGVTK.A | 2 | |
Jamie_phos_01_itms_16.08147.08147.2 | 4.9492 | 0.2392 | 100.0% | 1647.5322 | 1645.8558 | 1 | 6.304 | 73.3% | 1 | K.FVQGLLQNAAANAEAK.G | 2 |
U | YHR174W | 6 | 7 | 23.3% | 437 | 46914 | 6.0 | ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_10.05959.05959.2 | 2.5802 | 0.3638 | 100.0% | 1416.3722 | 1417.556 | 1 | 6.636 | 62.5% | 1 | R.GNPTVEVELTTEK.G | 2 | |
Jamie_phos_01_itms_53.21298.21298.2 | 3.3762 | 0.3547 | 100.0% | 3259.5522 | 3259.551 | 1 | 5.697 | 26.6% | 1 | R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A | 2 | |
Jamie_phos_01_itms_53.21303.21303.3 | 4.0835 | 0.2568 | 100.0% | 3260.2744 | 3259.551 | 4 | 6.263 | 21.9% | 1 | R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A | 3 | |
* | Jamie_phos_01_itms_10.05790.05790.2 | 4.63 | 0.3203 | 100.0% | 1773.3722 | 1771.8779 | 1 | 6.039 | 67.9% | 1 | K.DGKYDLDFKNPESDK.S | 2 |
Jamie_phos_01_itms_42.17344.17344.3 | 5.1626 | 0.3003 | 100.0% | 2985.9243 | 2986.269 | 1 | 7.341 | 38.0% | 2 | K.RYPIVSIEDPFAEDDWEAWSHFFK.T | 3 | |
Jamie_phos_01_itms_38.15868.15868.2 | 2.8304 | 0.3412 | 100.0% | 1822.4922 | 1823.0099 | 1 | 6.358 | 50.0% | 1 | R.SGETEDTFIADLVVGLR.T | 2 |
U | YFL010C | 1 | 1 | 23.2% | 211 | 22655 | 4.5 | WWM1 SGDID:S000001884, Chr VI from 115737-115102, reverse complement, Verified ORF, "WW domain containing protein of unknown function; binds to Mca1p, a caspase-related protease that regulates H2O2-induced apoptosis; overexpression causes Gi phase growth arrest and clonal death that is suppressed by overexpression of MCA1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_54.21979.21979.4 | 4.5801 | 0.2543 | 95.1% | 5708.8164 | 5709.1426 | 144 | 4.718 | 14.2% | 1 | A.DQAPPPYSSQSTPQVQAGAQAQQPRYYQPQQPQYPQYPQQQRYYPQQAP.M | 4 |
U | YDR447C | 2 | 2 | 22.8% | 136 | 15803 | 10.5 | RPS17B SGDID:S000002855, Chr IV from 1355543-1355541,1355226-1354819, reverse complement, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Ap and has similarity to rat S17 ribosomal protein" |
U | YML024W | 2 | 2 | 22.8% | 136 | 15788 | 10.5 | RPS17A SGDID:S000004486, Chr XIII from 225889-225891,226290-226697, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Bp and has similarity to rat S17 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_16.08160.08160.2 | 3.5724 | 0.2871 | 100.0% | 1720.0322 | 1720.92 | 1 | 5.643 | 64.3% | 1 | R.KDQYVPEVSALDLSR.S | 2 | |
Jamie_phos_01_itms_13.06731.06731.2 | 3.4098 | 0.3905 | 100.0% | 1702.8922 | 1703.8467 | 1 | 6.727 | 60.0% | 1 | R.SNGVLNVDNQTSDLVK.S | 2 |
U | YBL072C | 3 | 3 | 22.0% | 200 | 22490 | 10.7 | RPS8A SGDID:S000000168, Chr II from 89123-88521, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Ap and has similarity to rat S8 ribosomal protein" |
U | YER102W | 3 | 3 | 22.0% | 200 | 22490 | 10.7 | RPS8B SGDID:S000000904, Chr V from 363096-363698, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Bp and has similarity to rat S8 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_10.05964.05964.2 | 2.7732 | 0.2849 | 99.6% | 1668.5322 | 1668.8931 | 121 | 5.139 | 42.9% | 1 | R.IAGVVYHPSNNELVR.T | 2 | |
Jamie_phos_01_itms_9.05460.05460.2 | 3.1119 | 0.3949 | 100.0% | 1396.9922 | 1397.4845 | 1 | 7.619 | 79.2% | 1 | K.IESSVESQFSAGR.L | 2 | |
Jamie_phos_01_itms_35.14975.14975.2 | 3.7336 | 0.4739 | 100.0% | 1950.3322 | 1949.1334 | 1 | 8.952 | 60.0% | 1 | R.CDGYILEGEELAFYLR.R | 2 |
U | YNL225C | 9 | 11 | 21.5% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
U | YER131W | 2 | 2 | 20.2% | 119 | 13447 | 10.9 | RPS26B SGDID:S000000933, Chr V from 423948-424307, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Ap and has similarity to rat S26 ribosomal protein" |
U | YGL189C | 2 | 2 | 20.2% | 119 | 13505 | 10.8 | RPS26A SGDID:S000003157, Chr VII from 148594-148235, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Bp and has similarity to rat S26 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05151.05151.2 | 2.7091 | 0.2713 | 100.0% | 943.0122 | 943.091 | 2 | 5.791 | 93.8% | 1 | R.NIVEAAAVR.D | 2 | |
Jamie_phos_01_itms_20.09334.09334.2 | 3.774 | 0.3373 | 100.0% | 1683.1322 | 1682.8676 | 1 | 6.022 | 67.9% | 1 | R.DLSEASVYPEYALPK.T | 2 |
U | YMR230W | 1 | 1 | 20.0% | 105 | 12738 | 9.1 | RPS10B SGDID:S000004843, Chr XIII from 732413-732464,732875-733140, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10" |
U | YOR293W | 1 | 1 | 20.0% | 105 | 12739 | 8.8 | RPS10A SGDID:S000005819, Chr XV from 867095-867146,867584-867849, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Bp and has similarity to rat ribosomal protein S10" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_42.17434.17434.2 | 4.5102 | 0.3771 | 100.0% | 2742.6921 | 2740.9849 | 1 | 7.463 | 45.0% | 1 | K.TQFSWQYYYYTLTEEGVEYLR.E | 2 |
U | YGR192C | 7 | 7 | 19.9% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
U | YJR009C | 7 | 7 | 19.9% | 332 | 35847 | 7.0 | TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_10.05909.05909.2 | 2.4042 | 0.26 | 99.3% | 1089.2522 | 1089.2858 | 4 | 4.976 | 72.2% | 1 | M.VRVAINGFGR.I | 2 | |
Jamie_phos_01_itms_8.05049.05049.2 | 2.6544 | 0.1655 | 90.6% | 1374.8322 | 1375.5217 | 306 | 4.315 | 46.4% | 1 | R.TASGNIIPSSTGAAK.A | 2 | |
Jamie_phos_01_itms_9.05411.05411.2 | 2.5287 | 0.4381 | 100.0% | 1454.8121 | 1455.5217 | 1 | 6.799 | 67.9% | 1 | R.TAS*GNIIPSSTGAAK.A | 2 | |
Jamie_phos_01_itms_7.04595.04595.2 | 2.0658 | 0.3176 | 99.6% | 1127.3722 | 1127.2365 | 111 | 5.031 | 81.2% | 1 | K.ETTYDEIKK.V | 2 | |
Jamie_phos_01_itms_17.08289.08289.3 | 3.0707 | 0.1749 | 96.7% | 2629.9744 | 2633.8767 | 2 | 5.172 | 30.0% | 1 | Q.LS*PKFVKLVSWYDNEYGYSTR.V | 3 | |
Jamie_phos_01_itms_17.08289.08289.2 | 3.6768 | 0.3257 | 100.0% | 1753.6522 | 1753.8651 | 1 | 7.694 | 61.5% | 1 | K.LVSWYDNEYGYSTR.V | 3 | |
Jamie_phos_01_itms_11.06053.06053.2 | 3.7112 | 0.2744 | 100.0% | 1180.3121 | 1180.3898 | 1 | 7.014 | 85.0% | 1 | R.VVDLVEHVAKA.- | 2 |
U | YLR150W | 3 | 3 | 19.8% | 273 | 29995 | 9.7 | STM1 SGDID:S000004140, Chr XII from 440468-441289, Verified ORF, "Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_1.00207.00207.2 | 2.7173 | 0.2674 | 99.6% | 1282.7922 | 1281.4056 | 1 | 5.188 | 68.2% | 1 | R.SKDVTDSATTKK.S | 2 |
* | Jamie_phos_01_itms_21.09835.09835.3 | 4.0375 | 0.2939 | 100.0% | 2867.4243 | 2864.1443 | 1 | 5.335 | 32.3% | 1 | K.TAQLSLQDYLNQQANNQFNKVPEAK.K | 3 |
* | Jamie_phos_01_itms_2.01529.01529.2 | 3.5794 | 0.4051 | 100.0% | 1733.8121 | 1733.8356 | 1 | 8.611 | 62.5% | 1 | R.KGNNTANATNSANTVQK.N | 2 |
U | YBR181C | 5 | 5 | 19.5% | 236 | 26996 | 10.4 | RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein" |
U | YPL090C | 5 | 5 | 19.5% | 236 | 26996 | 10.4 | RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_12.06406.06406.3 | 2.6013 | 0.2357 | 98.7% | 2390.0645 | 2386.6233 | 376 | 5.123 | 25.0% | 1 | R.VFFDKRIGQEVDGEAVGDEFK.G | 3 | |
Jamie_phos_01_itms_12.06406.06406.2 | 4.4075 | 0.4163 | 100.0% | 1593.7122 | 1593.6874 | 1 | 8.215 | 78.6% | 1 | R.IGQEVDGEAVGDEFK.G | 3 | |
Jamie_phos_01_itms_21.09783.09783.3 | 3.5167 | 0.2084 | 91.5% | 2188.1042 | 2188.3984 | 90 | 4.591 | 32.9% | 1 | R.IGQEVDGEAVGDEFKGYVFK.I | 3 | |
Jamie_phos_01_itms_27.12178.12178.2 | 3.2927 | 0.3298 | 100.0% | 2301.612 | 2301.5579 | 1 | 5.536 | 35.0% | 1 | R.IGQEVDGEAVGDEFKGYVFKI.S | 2 | |
Jamie_phos_01_itms_16.08137.08137.3 | 4.6601 | 0.2739 | 100.0% | 2103.3245 | 2103.3457 | 1 | 5.462 | 38.9% | 1 | R.NAQAQREAAAEYAQLLAKR.L | 3 |
U | YBR171W | 1 | 1 | 19.4% | 206 | 24231 | 7.2 | SEC66 SGDID:S000000375, Chr II from 578359-578979, Verified ORF, "Non-essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and Lhs1p forms a channel competent for SRP-dependent and post-translational SRP-independent protein targeting and import into the ER" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_26.11735.11735.4 | 4.6723 | 0.0401 | 95.2% | 4833.3765 | 4830.464 | 338 | 5.061 | 16.2% | 1 | V.YTPLIY*VFILVVSLVMFAS*SYRKKQAKKISEQPSIFDEND.A | 4 |
U | Reverse_YNL046W | 1 | 1 | 18.6% | 172 | 19350 | 10.2 | YNL046W SGDID:S000004991, Chr XIV from 542305-542823, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_52.21131.21131.2 | 2.2495 | 0.164 | 95.7% | 3507.5322 | 3507.9368 | 56 | 5.304 | 21.0% | 1 | F.IFS*LWSSVASFPSLLPGVLGTLLGTYPT*GMFS.A | 2 |
U | YGR120C | 1 | 1 | 18.3% | 262 | 30325 | 4.6 | COG2 SGDID:S000003352, Chr VII from 730826-730038, reverse complement, Verified ORF, "Essential component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_35.14976.14976.4 | 4.2809 | 0.2356 | 91.4% | 5855.0566 | 5858.196 | 164 | 4.99 | 14.9% | 1 | D.DYLTFSNT*Y*TDEENETLINLEKTQSDLQKFMTQLDHLIKDDISNTQEI.I | 4 |
U | YOR373W | 19 | 19 | 17.4% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
U | YPL255W | 5 | 5 | 17.4% | 385 | 45384 | 6.5 | BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_24.10761.10761.2 | 3.4058 | 0.347 | 100.0% | 1462.2122 | 1462.5714 | 2 | 6.412 | 75.0% | 1 | K.DALFGTDIS*PSMK.Y | 2 |
* | Jamie_phos_01_itms_13.07031.07031.2 | 2.4198 | 0.1155 | 91.5% | 1541.1921 | 1540.5461 | 5 | 5.152 | 54.2% | 1 | R.SNS*WSGLDSTLHR.K | 2 |
* | Jamie_phos_01_itms_14.07369.07369.2 | 3.542 | 0.3425 | 100.0% | 1264.3722 | 1264.2977 | 1 | 6.397 | 83.3% | 1 | R.DLEDLCEDVR.E | 2 |
* | Jamie_phos_01_itms_40.16804.16804.2 | 3.4679 | 0.2806 | 100.0% | 2058.7922 | 2059.2834 | 1 | 6.431 | 43.8% | 1 | R.DNYESEIHDLLLQLSLR.N | 2 |
* | Jamie_phos_01_itms_12.06405.06405.2 | 3.2642 | 0.3927 | 100.0% | 1494.0322 | 1493.4839 | 1 | 6.15 | 73.1% | 1 | R.KDTS*AGSNIFSTGQ.- | 2 |
U | YGL031C | 3 | 3 | 17.4% | 155 | 17614 | 11.3 | RPL24A SGDID:S000002999, Chr VII from 437939-437472, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Bp and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
U | YGR148C | 3 | 3 | 17.4% | 155 | 17547 | 11.4 | RPL24B SGDID:S000003380, Chr VII from 787784-787317, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Ap and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_7.04839.04839.2 | 2.633 | 0.0949 | 98.3% | 937.09216 | 937.0867 | 2 | 4.837 | 92.9% | 1 | K.SASLFKQR.K | 2 | |
Jamie_phos_01_itms_28.12282.12282.2 | 2.5457 | 0.2095 | 92.8% | 1006.83215 | 1006.2358 | 1 | 4.433 | 92.9% | 1 | R.IAWTVLFR.K | 2 | |
Jamie_phos_01_itms_7.04723.04723.2 | 3.1189 | 0.3345 | 100.0% | 1135.5721 | 1136.2963 | 1 | 5.938 | 85.0% | 1 | K.GAFQKVAATSR.- | 2 |
U | YLR457C | 4 | 4 | 17.2% | 319 | 37354 | 10.2 | NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_23.10468.10468.2 | 2.8451 | 0.3154 | 96.7% | 2025.5322 | 2026.1644 | 2 | 5.745 | 50.0% | 1 | R.ILEDLLDSS*NIHPSYTK.S | 2 |
* | Jamie_phos_01_itms_16.07969.07969.2 | 2.6409 | 0.2537 | 90.9% | 1373.2322 | 1373.3911 | 2 | 5.192 | 60.0% | 1 | R.TNS*LFTSS*PMK.T | 2 |
* | Jamie_phos_01_itms_17.08447.08447.3 | 4.5606 | 0.2901 | 100.0% | 3158.6042 | 3159.4663 | 11 | 5.396 | 25.0% | 1 | T.YNRDGNIPEMQPLQENISPACPTPPYR.S | 3 |
* | Jamie_phos_01_itms_19.08973.08973.3 | 4.4393 | 0.3977 | 93.3% | 3239.3044 | 3239.4663 | 1 | 6.417 | 29.8% | 1 | T.YNRDGNIPEMQPLQENISPACPT*PPYR.S | 3 |
U | YCR031C | 2 | 2 | 16.8% | 137 | 14537 | 10.7 | RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" |
U | YJL191W | 2 | 2 | 16.7% | 138 | 14650 | 10.5 | RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_10.05667.05667.2 | 2.8748 | 0.2067 | 100.0% | 1092.9521 | 1093.1844 | 1 | 5.452 | 77.8% | 1 | R.DNSQVFGVAR.I | 2 | |
Jamie_phos_01_itms_7.04565.04565.2 | 2.3999 | 0.2443 | 99.6% | 1254.4521 | 1254.4318 | 28 | 5.025 | 54.2% | 1 | R.TKTPGPGGQAALR.A | 2 |
U | YDR356W | 19 | 27 | 15.9% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
U | YBR191W | 1 | 1 | 15.0% | 160 | 18242 | 10.4 | RPL21A SGDID:S000000395, Chr II from 606265-606275,606664-607135, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp and has similarity to rat L21 ribosomal protein" |
U | YPL079W | 1 | 1 | 15.0% | 160 | 18274 | 10.4 | RPL21B SGDID:S000006000, Chr XVI from 406633-406643,407065-407536, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Ap and has similarity to rat L21 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_29.12930.12930.2 | 3.8092 | 0.4525 | 100.0% | 2648.2722 | 2648.9727 | 1 | 7.261 | 50.0% | 1 | R.ESRIVSTEGNVPQTLAPVPYETFI.- | 2 |
U | YLR185W | 2 | 2 | 14.8% | 88 | 9850 | 11.6 | RPL37A SGDID:S000004175, Chr XII from 522665-522671,523031-523290, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl37Bp and to rat L37 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_4.02818.02818.2 | 2.7359 | 0.2881 | 99.3% | 1202.9521 | 1202.2385 | 3 | 4.98 | 75.0% | 1 | K.TCSSCGYPAAK.T | 2 |
* | Jamie_phos_01_itms_4.02945.02945.2 | 1.9772 | 0.1745 | 100.0% | 1459.1522 | 1459.5311 | 1 | 5.49 | 54.2% | 1 | K.TCSSCGYPAAKTR.S | 2 |
U | YLR075W | 2 | 2 | 14.5% | 221 | 25361 | 10.0 | RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_8.04921.04921.2 | 3.0628 | 0.342 | 100.0% | 1365.5721 | 1365.4827 | 2 | 6.017 | 75.0% | 1 | R.EAGEVKDDGAFVK.F | 2 |
* | Jamie_phos_01_itms_26.11598.11598.2 | 2.8896 | 0.363 | 100.0% | 2185.632 | 2185.401 | 3 | 6.027 | 36.1% | 1 | K.KGSLENNIREFPEYFAAQA.- | 2 |
U | YBL027W | 3 | 3 | 14.3% | 189 | 21704 | 11.4 | RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" |
U | YBR084C-A | 3 | 3 | 14.3% | 189 | 21704 | 11.4 | RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_14.07113.07113.2 | 3.6634 | 0.4506 | 100.0% | 2058.5923 | 2059.2432 | 1 | 7.369 | 55.9% | 1 | R.KVWLDPNETSEIAQANSR.N | 2 | |
Jamie_phos_01_itms_16.08170.08170.2 | 4.3278 | 0.433 | 100.0% | 1930.7722 | 1931.0691 | 1 | 7.275 | 65.6% | 1 | K.VWLDPNETSEIAQANSR.N | 2 | |
Jamie_phos_01_itms_17.08230.08230.2 | 2.7124 | 0.2556 | 100.0% | 1098.3722 | 1098.3335 | 1 | 5.797 | 87.5% | 1 | R.LPSQVVWIR.R | 2 |
U | YLR441C | 2 | 2 | 14.1% | 255 | 28743 | 10.0 | RPS1A SGDID:S000004433, Chr XII from 1018904-1018137, reverse complement, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein" |
U | YML063W | 2 | 2 | 14.1% | 255 | 28812 | 10.0 | RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_18.08611.08611.2 | 3.5668 | 0.3544 | 100.0% | 2062.7522 | 2062.2097 | 1 | 6.778 | 47.1% | 1 | R.VVEVCLADLQGSEDHSFR.K | 2 | |
Jamie_phos_01_itms_21.09791.09791.2 | 2.6329 | 0.2364 | 98.9% | 1847.5521 | 1848.0375 | 5 | 4.953 | 41.2% | 1 | K.FDVGALMALHGEGSGEEK.G | 2 |
U | YLR061W | 1 | 1 | 14.0% | 121 | 13693 | 6.2 | RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_20.09574.09574.2 | 3.6413 | 0.2816 | 100.0% | 2075.5723 | 2073.0845 | 1 | 5.221 | 62.5% | 1 | R.LAFYQVTPEEDEEEDEE.- | 2 |
U | YDR418W | 2 | 2 | 13.9% | 165 | 17823 | 9.4 | RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
U | YEL054C | 2 | 2 | 13.9% | 165 | 17823 | 9.4 | RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_27.12150.12150.3 | 2.858 | 0.2957 | 100.0% | 2565.0544 | 2564.8113 | 5 | 5.32 | 29.5% | 1 | R.VDFKNPHDIIEGINAGEIEIPEN.- | 3 | |
Jamie_phos_01_itms_27.12167.12167.2 | 3.3828 | 0.2922 | 99.6% | 2566.9922 | 2564.8113 | 2 | 5.176 | 36.4% | 1 | R.VDFKNPHDIIEGINAGEIEIPEN.- | 2 |
U | YHR089C | 1 | 1 | 13.2% | 205 | 21480 | 11.5 | GAR1 SGDID:S000001131, Chr VIII from 283300-282683, reverse complement, Verified ORF, "Protein component of the H/ACA snoRNP pseudouridylase complex, involved in the modification and cleavage of the 18S pre-rRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_30.13221.13221.3 | 3.9224 | 0.3322 | 100.0% | 3062.9644 | 3062.356 | 1 | 5.237 | 29.8% | 1 | R.SFQQGPPDTVLEMGAFLHPCEGDIVCR.S | 3 |
U | YLR321C | 1 | 1 | 12.9% | 426 | 48777 | 5.2 | SFH1 SGDID:S000004313, Chr XII from 777864-776584, reverse complement, Verified ORF, "Subunit of the RSC chromatin remodeling complex required for kinetochore function in chromosome segregation; essential gene required for cell cycle progression; phosphorylated in the G1 phase of the cell cycle; Snf5p paralog" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_72.28377.28377.4 | 3.2936 | 0.2188 | 97.6% | 6331.2964 | 6325.9453 | 69 | 5.595 | 12.7% | 1 | N.GPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPY*RLNTDQE.T | 4 |
U | YDR249C | 1 | 1 | 12.1% | 373 | 43790 | 8.7 | YDR249C SGDID:S000002657, Chr IV from 959796-958675, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_34.14671.14671.4 | 4.9671 | 0.263 | 95.5% | 5538.1367 | 5543.332 | 139 | 5.048 | 14.4% | 1 | L.PAKKLRHHQKLTLQDLPVEIIQHIFVFTKGEPSMVT*LNRFFYS*CL.K | 4 |
U | Reverse_YKL085W | 1 | 1 | 11.4% | 334 | 35650 | 8.5 | MDH1 SGDID:S000001568, Chr XI from 278767-279771, Verified ORF, "Mitochondrial malate dehydrogenase, catalyzes interconversion of malate and oxaloacetate; involved in the tricarboxylic acid (TCA) cycle" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_44.18187.18187.4 | 4.167 | 0.2777 | 91.3% | 3981.4165 | 3975.446 | 1 | 4.992 | 20.3% | 1 | N.KLVQAVIPVTSNVPNS*IVLIAANPASEATAAALDRVIS*.A | 4 |
U | Reverse_YDL059C | 1 | 1 | 10.5% | 238 | 26630 | 8.6 | RAD59 SGDID:S000002217, Chr IV from 344953-344237, reverse complement, Verified ORF, "Protein involved in the repair of double-strand breaks in DNA during vegetative growth via recombination and single-strand annealing; anneals complementary single-stranded DNA; homologous to Rad52p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_94.37698.37698.4 | 3.2378 | 0.2076 | 93.9% | 2842.8564 | 2844.8762 | 75 | 5.046 | 26.4% | 1 | V.QAEAVVT*YKVEST*NTNEGNNVATFP.Q | 4 |
U | YNL248C | 1 | 1 | 10.4% | 415 | 46651 | 9.5 | RPA49 SGDID:S000005192, Chr XIV from 182609-181362, reverse complement, Verified ORF, "RNA polymerase I subunit A49" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_42.17457.17457.4 | 3.3725 | 0.1729 | 95.4% | 5231.6167 | 5229.3735 | 369 | 5.05 | 14.3% | 1 | P.SDTT*FDLY*KKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQY.V | 4 |
U | YDL229W | 3 | 3 | 10.0% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
U | YNL209W | 3 | 3 | 10.0% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05082.05082.2 | 3.7444 | 0.3055 | 100.0% | 1553.6322 | 1552.7739 | 1 | 6.582 | 67.9% | 1 | R.LIGDAAKNQAALNPR.N | 2 | |
Jamie_phos_01_itms_27.12099.12099.2 | 3.6364 | 0.2799 | 100.0% | 2161.2322 | 2161.4138 | 1 | 6.614 | 50.0% | 1 | K.VIDVDGNPVIEVQYLEETK.T | 2 | |
Jamie_phos_01_itms_37.15765.15765.2 | 2.4129 | 0.2181 | 99.6% | 2964.132 | 2965.1511 | 7 | 5.011 | 25.0% | 1 | R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A | 2 |
U | YHL034C | 2 | 2 | 9.9% | 294 | 32990 | 5.7 | SBP1 SGDID:S000001026, Chr VIII from 34075-33191, reverse complement, Verified ORF, "Nucleolar single-strand nucleic acid binding protein; associates with small nuclear RNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_20.09478.09478.3 | 4.1708 | 0.2792 | 98.7% | 3345.9844 | 3346.494 | 1 | 5.132 | 25.9% | 1 | R.ELTVDVAVIRPENDEEEIEQETGSEEKQE.- | 3 |
* | Jamie_phos_01_itms_9.05529.05529.2 | 4.6555 | 0.257 | 100.0% | 2620.2322 | 2618.6814 | 1 | 5.408 | 57.1% | 1 | A.VIRPENDEEEIEQETGSEEKQE.- | 2 |
U | YJL158C | 1 | 1 | 9.7% | 227 | 23242 | 4.7 | CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family" |
U | YKL164C | 1 | 1 | 6.5% | 341 | 34622 | 6.5 | PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" |
U | YKL163W | 1 | 1 | 6.8% | 325 | 33004 | 5.7 | PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway" |
U | YJL160C | 1 | 1 | 7.7% | 287 | 30215 | 9.0 | YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
U | YJL159W | 1 | 1 | 5.7% | 387 | 38619 | 5.4 | HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_21.09943.09943.2 | 4.4989 | 0.4153 | 100.0% | 2285.0322 | 2284.5796 | 1 | 7.428 | 50.0% | 1 | R.IGSIVANRQFQFDGPPPQAGAI.Y | 2 |
U | YOL127W | 1 | 1 | 9.2% | 142 | 15758 | 10.1 | RPL25 SGDID:S000005487, Chr XV from 80347-80359,80774-81189, Verified ORF, "Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 26S rRNA via a conserved C-terminal motif" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_16.08040.08040.2 | 2.6706 | 0.2592 | 99.6% | 1454.0322 | 1451.576 | 42 | 5.167 | 58.3% | 1 | R.LTADYDALDIANR.I | 2 |
U | YCR020C-A | 1 | 1 | 9.1% | 88 | 9725 | 5.4 | MAK31 SGDID:S000000614, Chr III from 155093-154827, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type; required for replication of dsRNA virus; member of the Sm protein family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_4.03213.03213.2 | 2.1958 | 0.0875 | 95.2% | 908.4122 | 909.99274 | 12 | 4.547 | 78.6% | 1 | E.ERMGSSSR.M | 2 |
U | YJR093C | 1 | 1 | 8.9% | 327 | 35777 | 4.4 | FIP1 SGDID:S000003853, Chr X from 604120-603137, reverse complement, Verified ORF, "Subunit of cleavage polyadenylation factor (CPF), interacts directly with poly(A) polymerase (Pap1p) to regulate its activity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_39.16494.16494.2 | 2.407 | 0.3064 | 100.0% | 2960.132 | 2959.24 | 124 | 6.149 | 21.4% | 1 | E.RLITEGEANQGVTATTVKATESDGNVPKA.M | 2 |
U | YML074C | 3 | 4 | 8.8% | 411 | 46553 | 4.5 | FPR3 SGDID:S000004539, Chr XIII from 121324-120089, reverse complement, Verified ORF, "Nucleolar peptidyl-prolyl cis-trans isomerase (PPIase); FK506 binding protein; phosphorylated by casein kinase II (Cka1p-Cka2p-Ckb1p-Ckb2p) and dephosphorylated by Ptp1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_26.11646.11646.3 | 4.5478 | 0.3106 | 96.7% | 4328.9644 | 4329.103 | 2 | 5.929 | 24.3% | 2 | K.RNPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQK.K | 3 |
* | Jamie_phos_01_itms_30.13104.13104.3 | 4.8712 | 0.2262 | 97.1% | 4171.764 | 4172.9155 | 3 | 5.751 | 22.7% | 1 | R.NPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQK.K | 3 |
* | Jamie_phos_01_itms_26.11572.11572.3 | 4.3886 | 0.2279 | 96.4% | 4300.974 | 4301.09 | 5 | 5.237 | 21.3% | 1 | R.NPDFEDDDFLGGDFDEDEIDEES*S*EEEEEEKTQKK.K | 3 |
U | Reverse_YDR019C | 1 | 1 | 8.8% | 400 | 44469 | 8.8 | GCV1 SGDID:S000002426, Chr IV from 485361-484159, reverse complement, Verified ORF, "T subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_72.28505.28505.3 | 3.4903 | 0.2587 | 98.6% | 3594.7144 | 3598.986 | 31 | 5.213 | 17.6% | 1 | D.DNEKTIITDDVVGGQPNLLVSLTGSGVPLANFDTP.T | 3 |
U | YKL054C | 2 | 2 | 8.7% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_18.08919.08919.3 | 4.1618 | 0.1217 | 97.7% | 3817.4043 | 3816.9734 | 1 | 4.884 | 24.2% | 1 | K.EQVKEEEQTAEELEQEQDNVAAPEEEVTVVEEK.V | 3 |
* | Jamie_phos_01_itms_8.05021.05021.3 | 4.465 | 0.2868 | 96.8% | 3694.2844 | 3694.653 | 1 | 5.927 | 25.8% | 1 | K.NNYNYYQTQNGQEQQS*PNQGVAQHSEDSQQK.Q | 3 |
U | YBR118W | 2 | 2 | 8.7% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
U | YPR080W | 2 | 2 | 8.7% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_35.15037.15037.3 | 4.0426 | 0.1526 | 93.6% | 3322.2844 | 3321.8418 | 31 | 4.644 | 21.4% | 1 | K.TLLEAIDAIEQPSRPTDKPLRLPLQDVYK.I | 3 | |
Jamie_phos_01_itms_10.05800.05800.2 | 1.9051 | 0.1274 | 100.0% | 1025.8322 | 1026.2241 | 9 | 5.406 | 75.0% | 1 | K.IGGIGTVPVGR.V | 2 |
U | YLR069C | 1 | 1 | 8.5% | 761 | 84574 | 6.9 | MEF1 SGDID:S000004059, Chr XII from 273916-271631, reverse complement, Verified ORF, "Mitochondrial elongation factor involved in translational elongation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_51.20845.20845.4 | 3.9913 | 0.2282 | 91.6% | 6965.6167 | 6964.8066 | 1 | 4.575 | 12.5% | 1 | D.YTHKKQSGGAGQYGRVIGTLSPVDDITKGNIFETAIVGGRIPDKYLAACGKGFEEVCEKGPLIGH.R | 4 |
U | Reverse_YER140W | 1 | 1 | 8.3% | 556 | 64794 | 9.8 | YER140W SGDID:S000000942, Chr V from 451560-453230, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_15.07492.07492.4 | 3.9453 | 0.2318 | 96.2% | 5218.8164 | 5221.678 | 35 | 5.28 | 15.9% | 1 | E.TEIRNEKNYDSHLAIRT*SVDVKGMGGSLLGPVYEEETVVTNFAQDR.F | 4 |
U | YNL064C | 1 | 1 | 8.1% | 409 | 44671 | 6.3 | YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_70.27623.27623.3 | 3.4237 | 0.2586 | 93.6% | 3563.4543 | 3563.8965 | 13 | 4.657 | 19.5% | 1 | R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
U | YNL096C | 1 | 1 | 7.9% | 190 | 21634 | 9.9 | RPS7B SGDID:S000005040, Chr XIV from 444317-444174,443828-443400, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Ap; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_16.07959.07959.2 | 3.9866 | 0.3663 | 100.0% | 1627.5322 | 1626.8907 | 1 | 6.882 | 71.4% | 1 | K.ILSQAPSELELQVAK.T | 2 |
U | YMR242C | 1 | 1 | 7.9% | 178 | 21236 | 10.3 | RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein" |
U | YOR312C | 1 | 1 | 8.0% | 174 | 20713 | 10.3 | RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_21.09868.09868.2 | 2.3444 | 0.2248 | 99.6% | 1541.2122 | 1538.7589 | 6 | 5.008 | 53.8% | 1 | R.VAAVETLYQDMAAR.H | 2 |
U | YPR148C | 1 | 1 | 7.8% | 435 | 49279 | 4.8 | YPR148C SGDID:S000006352, Chr XVI from 828136-826829, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_16.08079.08079.3 | 6.8543 | 0.4592 | 100.0% | 3865.9744 | 3865.7427 | 1 | 7.638 | 31.8% | 1 | K.TAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIK.V | 3 |
U | YGR234W | 1 | 1 | 7.8% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_66.26275.26275.3 | 5.765 | 0.4148 | 100.0% | 3351.4443 | 3349.762 | 1 | 7.82 | 32.5% | 1 | K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 3 |
U | Reverse_YKL187C | 2 | 2 | 7.7% | 750 | 81033 | 5.0 | YKL187C SGDID:S000001670, Chr XI from 91541-89289, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; detectable in highly purified mitochondria" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_85.33907.33907.3 | 2.5023 | 0.18 | 94.9% | 3107.7544 | 3104.558 | 10 | 4.733 | 21.6% | 1 | T.LLTQALSSSITTNMLTALATMTATQNTSFA.F | 3 |
* | Jamie_phos_01_itms_94.37600.37600.2 | 1.6602 | 0.1844 | 91.3% | 2966.7922 | 2968.2878 | 291 | 4.367 | 18.5% | 1 | S.SLSASVLRSLGDLTETANDSYKLLGNIE.T | 2 |
U | YBR031W | 2 | 2 | 7.7% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
U | YDR012W | 2 | 2 | 7.7% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05085.05085.2 | 3.0025 | 0.3083 | 100.0% | 1185.0922 | 1185.266 | 1 | 5.931 | 80.0% | 1 | R.SGQGAFGNMCR.G | 2 | |
Jamie_phos_01_itms_15.07782.07782.2 | 3.424 | 0.3067 | 100.0% | 1848.6522 | 1847.0782 | 1 | 5.649 | 50.0% | 1 | K.VGYTLPSHIISTSDVTR.I | 2 |
U | YKL152C | 1 | 1 | 7.7% | 247 | 27609 | 8.8 | GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_32.13776.13776.2 | 3.3462 | 0.1529 | 91.3% | 2147.132 | 2144.4294 | 13 | 4.364 | 38.9% | 1 | K.YVDPNVLPETESLALVIDR.L | 2 |
U | Reverse_YIR036C | 1 | 1 | 7.6% | 263 | 28804 | 6.4 | YIR036C SGDID:S000001475, Chr IX from 422862-422071, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_42.17601.17601.2 | 2.133 | 0.2198 | 93.1% | 2237.632 | 2235.6316 | 185 | 4.437 | 26.3% | 1 | L.VAAPVKPDLLSSTKYLQTFR.E | 2 |
U | YPL240C | 4 | 6 | 7.5% | 709 | 81406 | 4.9 | HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_16.08007.08007.2 | 3.5935 | 0.3047 | 100.0% | 1819.9321 | 1819.922 | 1 | 5.854 | 64.3% | 1 | R.NPSDITQEEYNAFYK.S | 2 | |
* | Jamie_phos_01_itms_28.12334.12334.2 | 3.357 | 0.2199 | 98.3% | 2016.0122 | 2013.165 | 3 | 4.84 | 50.0% | 1 | K.LIEAFNEIAEDSEQFEK.F | 2 |
Jamie_phos_01_itms_24.10821.10821.3 | 4.7725 | 0.3532 | 100.0% | 2512.2244 | 2511.699 | 1 | 5.903 | 40.0% | 3 | K.TLVDITKDFELEETDEEKAER.E | 3 | |
Jamie_phos_01_itms_10.05632.05632.2 | 3.9614 | 0.2754 | 100.0% | 1740.4321 | 1740.7748 | 1 | 6.361 | 80.8% | 1 | K.DFELEETDEEKAER.E | 2 |
U | Reverse_YJR001W | 1 | 1 | 7.5% | 602 | 65346 | 8.1 | AVT1 SGDID:S000003761, Chr X from 436717-438525, Verified ORF, "Vacuolar transporter, imports large neutral amino acids into the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_57.23081.23081.4 | 3.4739 | 0.1772 | 92.2% | 4871.2964 | 4865.881 | 162 | 4.611 | 15.2% | 1 | A.ARRKIASAAEDIHQVNMLVDLVSVIPRANLPTKAIPIITMLASIL.G | 4 |
U | YDR450W | 1 | 1 | 7.5% | 146 | 17038 | 10.3 | RPS18A SGDID:S000002858, Chr IV from 1359913-1359959,1360395-1360788, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins" |
U | YML026C | 1 | 1 | 7.5% | 146 | 17038 | 10.3 | RPS18B SGDID:S000004488, Chr XIII from 223828-223782,223380-222987, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05211.05211.2 | 3.1611 | 0.2864 | 100.0% | 1275.2322 | 1275.358 | 1 | 5.986 | 80.0% | 1 | R.AGELTQEELER.I | 2 |
U | YAL038W | 2 | 2 | 7.4% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_17.08511.08511.2 | 3.2013 | 0.2184 | 99.6% | 1760.8322 | 1761.9292 | 2 | 5.123 | 53.6% | 1 | K.IENQQGVNNFDEILK.V | 2 |
* | Jamie_phos_01_itms_32.13894.13894.2 | 3.6542 | 0.2445 | 100.0% | 2570.7522 | 2570.8174 | 3 | 6.027 | 33.3% | 1 | R.GVFPFVFEKEPVSDWTDDVEAR.I | 2 |
U | YMR131C | 1 | 2 | 7.2% | 511 | 57261 | 4.6 | RRB1 SGDID:S000004738, Chr XIII from 534697-533162, reverse complement, Verified ORF, "Essential nuclear protein involved in early steps of ribosome biogenesis; physically interacts with the ribosomal protein Rpl3p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_18.08753.08753.3 | 4.5247 | 0.3359 | 100.0% | 4288.7046 | 4289.3447 | 2 | 5.961 | 20.8% | 2 | K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNR.L | 3 |
U | YPL266W | 1 | 1 | 7.2% | 318 | 35951 | 9.6 | DIM1 SGDID:S000006187, Chr XVI from 39121-40077, Verified ORF, "Essential 18S rRNA dimethylase, responsible for conserved m6(2)Am6(2)A dimethylation in 3'-terminal loop of 18 S rRNA, part of 90S and 40S pre-particles in nucleolus, involved in pre-ribosomal RNA processing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_71.28164.28164.2 | 2.2761 | 0.2415 | 91.3% | 2542.9922 | 2541.9565 | 83 | 4.36 | 25.0% | 1 | G.QHILKNPLVAQGIVDKAQIRPSD.V | 2 |
U | YLR449W | 1 | 2 | 7.1% | 392 | 43903 | 4.7 | FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_10.05775.05775.3 | 6.0044 | 0.3702 | 95.0% | 3424.7644 | 3421.2202 | 1 | 6.36 | 33.3% | 2 | R.GEYYNQDNNDGLEEDES*ES*EQEADVPKR.S | 3 |
U | YNL178W | 1 | 1 | 7.1% | 240 | 26503 | 9.4 | RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_9.05433.05433.2 | 3.614 | 0.3162 | 100.0% | 1907.6322 | 1905.9696 | 2 | 6.039 | 62.5% | 1 | K.DYRPAEETEAQAEPVEA.- | 2 |
U | YML028W | 1 | 1 | 7.1% | 196 | 21590 | 5.1 | TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_24.10944.10944.2 | 2.6781 | 0.1384 | 96.8% | 1565.2522 | 1563.7478 | 1 | 4.701 | 61.5% | 1 | R.DYGVLIEEEGVALR.G | 2 |
U | YLR175W | 1 | 1 | 7.0% | 483 | 54705 | 8.9 | CBF5 SGDID:S000004165, Chr XII from 506136-507587, Verified ORF, "Component of box H/ACA small nucleolar ribonucleoprotein particles (snoRNPs), probable rRNA pseudouridine synthase, binds to snoRNP Nop10p and also interacts with ribosomal biogenesis protein Nop53p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_69.27213.27213.4 | 3.9087 | 0.1817 | 97.9% | 3593.8564 | 3595.0938 | 162 | 4.768 | 19.7% | 1 | Y.EEGIELYDEIVLITTKGEAIAVAIAQMSTVDLAS.C | 4 |
U | YMR178W | 1 | 1 | 6.9% | 274 | 31145 | 6.1 | YMR178W SGDID:S000004790, Chr XIII from 618478-619302, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_21.09781.09781.4 | 3.0958 | 0.2171 | 97.7% | 2071.3364 | 2072.3232 | 19 | 4.865 | 31.5% | 1 | K.SIVNRVVNNLEGEVISSEL.E | 4 |
U | Reverse_YNR030W | 1 | 1 | 6.4% | 551 | 62673 | 7.1 | ALG12 SGDID:S000005313, Chr XIV from 678801-680456, Verified ORF, "Alpha-1,6-mannosyltransferase localized to the ER; responsible for the addition of the alpha-1,6 mannose to dolichol-linked Man7GlcNAc2, acts in the dolichol pathway for N-glycosylation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_56.22588.22588.3 | 3.0144 | 0.2035 | 96.9% | 3755.2744 | 3759.516 | 84 | 4.755 | 17.6% | 1 | L.ASVELRFVIAVLASLFIAANYRGLLVWGLAVNTLP.L | 3 |
U | YKL060C | 2 | 2 | 6.4% | 359 | 39621 | 5.8 | FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04626.04626.2 | 2.9369 | 0.2731 | 100.0% | 1218.4122 | 1218.3091 | 1 | 5.777 | 72.7% | 1 | K.GISNEGQNASIK.G | 2 |
* | Jamie_phos_01_itms_13.06795.06795.2 | 3.0636 | 0.2248 | 99.0% | 1283.5122 | 1283.424 | 1 | 4.889 | 80.0% | 1 | K.SLETFRTTNTL.- | 2 |
U | YLR390W-A | 1 | 1 | 6.3% | 238 | 23268 | 5.9 | CCW14 SGDID:S000006429, Chr XII from 903724-904440, Verified ORF, "Covalently linked cell wall glycoprotein, present in the inner layer of the cell wall" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_21.09982.09982.2 | 2.6408 | 0.2977 | 100.0% | 1587.7522 | 1585.8164 | 1 | 5.629 | 53.6% | 1 | A.TPPACLLACVAQVGK.S | 2 |
U | YNL142W | 1 | 1 | 6.2% | 499 | 53401 | 6.7 | MEP2 SGDID:S000005086, Chr XIV from 357455-358954, Verified ORF, "Ammonium permease involved in regulation of pseudohyphal growth; belongs to a ubiquitous family of cytoplasmic membrane proteins that transport only ammonium (NH4+); expression is under the nitrogen catabolite repression regulation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_58.23187.23187.2 | 1.7353 | 0.2039 | 95.4% | 3474.632 | 3476.109 | 37 | 4.578 | 20.0% | 1 | A.WTVTVTSILLLTMNAIPFLKLRLSADEEELG.T | 2 |
U | YOL063C | 1 | 1 | 6.1% | 957 | 109715 | 5.7 | YOL063C SGDID:S000005424, Chr XV from 210264-207391, reverse complement, Uncharacterized ORF, "Protein required for normal hydroxyurea resistance; not related to the HUS1 checkpoint protein identified in human and fission yeast" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_54.21868.21868.4 | 2.7802 | 0.1541 | 96.8% | 7108.4966 | 7102.64 | 52 | 5.165 | 12.3% | 1 | S.FQRRYRDTEQRAHLKS*ESQKSWGFHNYVRNVKRLLESAVPGSEDS*PLGYQLSEMHDEF.F | 4 |
U | Reverse_YJR065C | 1 | 1 | 6.0% | 449 | 49542 | 5.8 | ARP3 SGDID:S000003826, Chr X from 559072-557723, reverse complement, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_42.17320.17320.3 | 3.0539 | 0.1933 | 93.4% | 2953.9443 | 2953.5015 | 358 | 4.679 | 22.1% | 1 | E.GRERLLSQIFLTIDRGAIPINKIASGI.V | 3 |
U | Reverse_YJL104W | 1 | 1 | 6.0% | 149 | 16216 | 9.4 | PAM16 SGDID:S000003640, Chr X from 227244-227693, Verified ORF, "Constituent of the mitochondrial import motor associated with the presequence translocase, along with Ssc1p, Tim44p, Mge1p, and Pam18p; has similarity to J-domain containing proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_19.09031.09031.2 | 1.6681 | 0.2286 | 96.0% | 962.03217 | 959.13074 | 28 | 4.644 | 75.0% | 1 | F.VQTGTIIVQ.I | 2 |
U | YNL240C | 1 | 1 | 5.9% | 491 | 54151 | 7.6 | NAR1 SGDID:S000005184, Chr XIV from 199978-198503, reverse complement, Verified ORF, "Nuclear architecture related protein; component of the cytosolic iron-sulfur (FeS) protein assembly machinery, required for maturation of cytosolic and nuclear FeS proteins; homologous to human Narf" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_49.19891.19891.2 | 1.7963 | 0.1593 | 90.3% | 3257.8523 | 3256.7043 | 7 | 4.305 | 23.2% | 1 | P.GSQMIVLEGRNSDIVEYRLLHDDRIIAAA.S | 2 |
U | YLR167W | 1 | 1 | 5.9% | 152 | 17216 | 9.9 | RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04665.04665.2 | 2.516 | 0.297 | 100.0% | 1077.9122 | 1078.1791 | 14 | 5.365 | 75.0% | 1 | K.CHSVYKVNA.- | 2 |
U | YNL188W | 2 | 2 | 5.8% | 433 | 50653 | 9.3 | KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_19.09249.09249.3 | 3.888 | 0.2641 | 97.8% | 2845.4343 | 2846.17 | 1 | 5.552 | 30.2% | 1 | R.KQLGKPLPLPYLNS*PNSDSTPTLQR.K | 3 |
* | Jamie_phos_01_itms_23.10527.10527.3 | 3.786 | 0.4046 | 95.8% | 2717.7244 | 2717.9958 | 5 | 6.228 | 29.3% | 1 | K.QLGKPLPLPYLNS*PNSDSTPTLQR.K | 3 |
U | YOR006C | 1 | 1 | 5.8% | 313 | 35686 | 5.8 | YOR006C SGDID:S000005532, Chr XV from 338621-337680, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_19.09199.09199.2 | 2.524 | 0.3013 | 100.0% | 1972.2722 | 1969.887 | 1 | 5.528 | 44.1% | 1 | N.RRGNGSQSDTSESEENSE.Q | 2 |
U | YKR071C | 1 | 1 | 5.7% | 348 | 38543 | 5.3 | DRE2 SGDID:S000001779, Chr XI from 575622-574576, reverse complement, Verified ORF, "Protein of unknown function; mutation displays synthetic lethal interaction with the pol3-13 allele of CDC2" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_17.08295.08295.2 | 3.2417 | 0.246 | 97.8% | 2285.152 | 2284.173 | 14 | 5.337 | 34.2% | 1 | R.VVDDLIEDS*DDDDFSSDSSK.A | 2 |
U | Reverse_YMR018W | 1 | 1 | 5.6% | 514 | 59065 | 8.4 | YMR018W SGDID:S000004620, Chr XIII from 310207-311751, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_85.33925.33925.3 | 2.7187 | 0.2258 | 90.8% | 3220.0745 | 3224.5198 | 15 | 4.573 | 21.4% | 1 | T.RADRAASDNTQFDSFKGLNNWKLGLGNNI.K | 3 |
U | Reverse_YBR050C | 1 | 1 | 5.6% | 338 | 38747 | 8.1 | REG2 SGDID:S000000254, Chr II from 338197-337181, reverse complement, Verified ORF, "Regulatory subunit of the Glc7p type-1 protein phosphatase; involved with Reg1p, Glc7p, and Snf1p in regulation of glucose-repressible genes, also involved in glucose-induced proteolysis of maltose permease" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04822.04822.2 | 2.3994 | 0.1513 | 94.1% | 2208.7322 | 2206.3403 | 61 | 4.476 | 30.6% | 1 | D.LESKSCPRQEDTSNLRTSP.L | 2 |
U | YJR064W | 1 | 2 | 5.3% | 562 | 61914 | 5.5 | CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_69.27318.27318.3 | 4.3878 | 0.2241 | 98.8% | 3103.1643 | 3100.4473 | 1 | 5.009 | 27.6% | 2 | K.SQDDEIGDGTTGVVVLASALLDQALELIQK.G | 3 |
U | YDR432W | 1 | 1 | 5.3% | 414 | 45407 | 5.5 | NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_44.18181.18181.2 | 3.3611 | 0.3284 | 100.0% | 2439.2322 | 2438.6501 | 3 | 6.214 | 35.7% | 1 | R.DFDGTGALEFPSEEILVEALER.L | 2 |
U | YGL076C | 1 | 1 | 5.3% | 244 | 27638 | 10.1 | RPL7A SGDID:S000003044, Chr VII from 365999-365989,365529-365436,364967-364338, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" |
U | YPL198W | 1 | 1 | 5.3% | 244 | 27696 | 10.1 | RPL7B SGDID:S000006119, Chr XVI from 173151-173161,173571-173664,174072-174701, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Ap and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_7.04716.04716.2 | 3.2605 | 0.2608 | 100.0% | 1573.1921 | 1573.6592 | 1 | 5.811 | 62.5% | 1 | R.NAAYQKEYETAER.N | 2 |
U | YLR044C | 1 | 1 | 5.2% | 563 | 61495 | 6.2 | PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_45.18403.18403.3 | 3.4899 | 0.2437 | 98.7% | 3272.7544 | 3269.74 | 3 | 5.133 | 22.3% | 1 | K.QVNVNTVFGLPGDFNLSLLDKIYEVEGMR.W | 3 |
U | YMR014W | 1 | 1 | 5.2% | 519 | 60054 | 8.8 | BUD22 SGDID:S000004616, Chr XIII from 298867-300426, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_8.04890.04890.3 | 3.5781 | 0.3066 | 96.5% | 3033.0244 | 3032.9756 | 384 | 5.206 | 23.1% | 1 | K.TANANQTHSNIDYDT*DDGNEKNAIDSK.S | 3 |
U | YHR064C | 1 | 1 | 5.2% | 538 | 58238 | 5.1 | SSZ1 SGDID:S000001106, Chr VIII from 227143-225527, reverse complement, Verified ORF, "Hsp70 protein that interacts with Zuo1p (a DnaJ homolog) to form a ribosome-associated complex that is bound to the ribosome via the Zuo1p subunit; also involved in pleiotropic drug resistance via sequential activation of PDR1 and PDR5" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_19.09100.09100.3 | 4.36 | 0.3353 | 97.7% | 3452.2444 | 3448.3699 | 1 | 5.569 | 31.5% | 1 | K.TLEPIPKEENAEEDDES*EWS*DDEPEVVR.E | 3 |
U | Reverse_YIL083C | 1 | 1 | 5.2% | 365 | 41893 | 8.3 | YIL083C SGDID:S000001345, Chr IX from 204650-203553, reverse complement, Uncharacterized ORF, "Homolog to human PPCS" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_98.39805.39805.2 | 1.6185 | 0.0709 | 91.8% | 2359.672 | 2360.7302 | 7 | 4.397 | 36.1% | 1 | K.EMYKDYLKKNKLVNEAFEP.K | 2 |
U | YBR117C | 1 | 1 | 5.0% | 681 | 75029 | 6.1 | TKL2 SGDID:S000000321, Chr II from 476431-474386, reverse complement, Verified ORF, "Transketolase, similar to Tkl1p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_56.22552.22552.2 | 1.6492 | 0.2216 | 96.0% | 3541.8523 | 3543.8428 | 196 | 4.631 | 18.2% | 1 | G.QGISNAVGMAIAQANFAATYNEDGFPISDSYTFA.I | 2 |
U | YGL140C | 1 | 1 | 4.8% | 1219 | 137476 | 8.1 | YGL140C SGDID:S000003108, Chr VII from 245017-241358, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_30.12989.12989.4 | 3.0536 | 0.1281 | 95.1% | 6492.7764 | 6497.876 | 113 | 4.727 | 10.9% | 1 | E.AVTGFDNFINGKSNPMNTRRNRTPFDGTSIISEGNESLQSTNSNESQISPDSTRSYEPE.C | 4 |
U | YJL034W | 2 | 2 | 4.8% | 682 | 74468 | 4.9 | KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_19.08985.08985.3 | 6.8429 | 0.4714 | 100.0% | 3589.4343 | 3588.467 | 1 | 8.639 | 31.2% | 1 | I.TSKLYGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 3 | |
Jamie_phos_01_itms_22.10241.10241.2 | 4.5125 | 0.5394 | 100.0% | 3271.4922 | 3272.1096 | 1 | 9.986 | 36.2% | 1 | K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 2 |
U | YOR140W | 1 | 1 | 4.7% | 766 | 83317 | 8.7 | SFL1 SGDID:S000005666, Chr XV from 586981-589281, Verified ORF, "Transcription repressor involved in regulation of flocculation-related genes, inhibits transcription by recruiting general corepressor Cyc8p-Tup1p to different promoters; negatively regulated by cAMP-dependent protein kinase A subunit Tpk2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_27.11898.11898.3 | 3.8662 | 0.4358 | 96.4% | 3170.8442 | 3169.17 | 6 | 5.246 | 20.7% | 1 | E.ETVSAPAPAS*T*PAPAGTDVGSGGAAAGIANAGAEGG.D | 3 |
U | YJL036W | 1 | 1 | 4.7% | 423 | 49002 | 6.5 | SNX4 SGDID:S000003573, Chr X from 378741-380012, Verified ORF, "Sorting nexin, involved in the retrieval of late-Golgi SNAREs from the post-Golgi endosome to the trans-Golgi network and in cytoplasm to vacuole transport; contains a PX domain; forms complex with Snx41p and Atg20p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_59.23812.23812.2 | 2.4719 | 0.1627 | 99.6% | 2305.872 | 2305.7314 | 2 | 5.071 | 36.8% | 1 | R.FPTCIIPPLPDKKVFQYIAG.D | 2 |
U | YJL137C | 1 | 1 | 4.7% | 380 | 44546 | 6.0 | GLG2 SGDID:S000003673, Chr X from 156045-154903, reverse complement, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_64.25531.25531.2 | 1.8875 | 0.0682 | 90.4% | 2203.412 | 2205.4045 | 163 | 4.329 | 29.4% | 1 | P.CLQDLLNHGKRENQKHVD.L | 2 |
U | Reverse_YPL066W | 1 | 1 | 4.6% | 479 | 54894 | 9.4 | YPL066W SGDID:S000005987, Chr XVI from 426230-427669, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_104.44137.44137.2 | 2.2972 | 0.0635 | 91.1% | 2704.8123 | 2705.138 | 6 | 4.36 | 28.6% | 1 | S.TNKIRGFNKYFKKAFKATQREQ.L | 2 |
U | Reverse_YJL121C | 1 | 1 | 4.6% | 238 | 25967 | 6.3 | RPE1 SGDID:S000003657, Chr X from 191010-190294, reverse complement, Verified ORF, "D-ribulose-5-phosphate 3-epimerase, catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway; mutants are sensitive to oxidative stress" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_5.03595.03595.2 | 1.8233 | 0.231 | 93.8% | 1171.6721 | 1172.2401 | 27 | 4.475 | 60.0% | 1 | K.KETNSADGPRP.V | 2 |
U | Reverse_YIL128W | 1 | 1 | 4.5% | 1032 | 117882 | 5.9 | MET18 SGDID:S000001390, Chr IX from 113806-116904, Verified ORF, "DNA repair and TFIIH regulator, required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription; possible role in assembly of a multiprotein complex(es) required for NER and RNAP II transcription" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_52.21145.21145.3 | 3.7141 | 0.2956 | 92.8% | 5276.3945 | 5271.995 | 211 | 5.013 | 13.3% | 1 | S.NYKHPLSLSLLLPVITSVHETILTHHKDTT*DKLTELASVRVEPDPM.D | 3 |
U | YGL008C | 3 | 3 | 4.5% | 918 | 99619 | 5.1 | PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_23.10612.10612.2 | 4.964 | 0.4146 | 100.0% | 2482.8523 | 2481.7156 | 1 | 7.474 | 45.2% | 1 | R.PVPEEYLQTDPSYGLTSDEVLK.R | 2 |
Jamie_phos_01_itms_8.05028.05028.2 | 2.5929 | 0.2297 | 98.9% | 2293.8123 | 2295.3806 | 94 | 4.952 | 33.3% | 1 | K.TVEEDHPIPEDVHENYENK.V | 2 | |
Jamie_phos_01_itms_8.05062.05062.3 | 4.0905 | 0.2415 | 97.7% | 2296.0745 | 2295.3806 | 1 | 4.899 | 44.4% | 1 | K.TVEEDHPIPEDVHENYENK.V | 3 |
U | YJR124C | 1 | 1 | 4.5% | 448 | 49664 | 7.6 | YJR124C SGDID:S000003885, Chr X from 654153-652807, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_106.45015.45015.2 | 1.6713 | 0.1796 | 90.5% | 2234.372 | 2236.6846 | 17 | 4.327 | 31.6% | 1 | I.TADLILACMFLGVDAKIKKQ.M | 2 |
U | Reverse_YPL203W | 1 | 1 | 4.5% | 380 | 44219 | 7.2 | TPK2 SGDID:S000006124, Chr XVI from 166255-167397, Verified ORF, "Subunit of cytoplasmic cAMP-dependent protein kinase, which contains redundant catalytic subunits Tpk1p, Tpk2p, and Tpk3p and regulatory subunit Bcy1p; promotes vegetative growth in response to nutrients; activates filamentous growth" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_102.42997.42997.2 | 1.5712 | 0.2192 | 95.7% | 1990.1721 | 1989.3214 | 124 | 4.625 | 25.0% | 1 | K.SLLDVVDPHFYPPYVVK.G | 2 |
U | YJL045W | 1 | 1 | 4.4% | 634 | 69383 | 7.4 | YJL045W SGDID:S000003581, Chr X from 355940-357844, Uncharacterized ORF, "Similar to SDH1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_13.07039.07039.3 | 3.2365 | 0.2865 | 96.6% | 3116.2744 | 3112.1973 | 31 | 5.198 | 23.1% | 1 | F.SCTSAHTCTGDGNAMVS*RAGFPLEDLEF.V | 3 |
U | Reverse_YMR155W | 1 | 1 | 4.4% | 547 | 60044 | 8.1 | YMR155W SGDID:S000004764, Chr XIII from 568550-570193, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_75.29811.29811.2 | 2.1206 | 0.1464 | 94.9% | 2646.4922 | 2644.9507 | 31 | 4.519 | 26.1% | 1 | F.IASCVSINKFSKSARLSPDEISSF.D | 2 |
U | YLR197W | 1 | 1 | 4.4% | 504 | 56864 | 8.9 | SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_27.12108.12108.2 | 2.6948 | 0.1557 | 98.3% | 2219.412 | 2218.3794 | 337 | 4.831 | 31.0% | 1 | K.GAAEALENANDISEGLVSESLK.A | 2 |
U | YER165W | 1 | 1 | 4.3% | 577 | 64344 | 6.0 | PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_24.11055.11055.2 | 3.729 | 0.3939 | 100.0% | 2787.7922 | 2787.9478 | 1 | 6.737 | 35.4% | 1 | K.NLDDSVDDEKLEEEFAPYGTITSAK.V | 2 |
U | Reverse_YJR070C | 1 | 1 | 4.3% | 325 | 36165 | 4.9 | LIA1 SGDID:S000003831, Chr X from 570512-569535, reverse complement, Verified ORF, "Protein with a possible role in microtubule function; complements S. pombe mmd1 mutation affecting mitochondrial distribution although not required for this process in S. cerevisiae; binds to Hyp2p (eIF5A); contains HEAT-like repeats" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_9.05543.05543.3 | 1.7823 | 0.1112 | 97.6% | 1384.5543 | 1380.5377 | 443 | 5.003 | 34.6% | 1 | S.SEASFGTALALIAE.D | 3 |
U | Reverse_YDR014W | 1 | 1 | 4.2% | 647 | 74722 | 5.9 | RAD61 SGDID:S000002421, Chr IV from 474043-475986, Verified ORF, "Protein of unknown function; mutation confers radiation sensitivity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_60.23992.23992.2 | 1.7546 | 0.2603 | 93.5% | 2993.5522 | 2993.306 | 1 | 4.475 | 26.9% | 1 | D.DDSFEVDSSSPLGKNSRFPTRLVPGRK.G | 2 |
U | Reverse_YOR042W | 1 | 1 | 4.1% | 411 | 46870 | 4.8 | CUE5 SGDID:S000005568, Chr XV from 408424-409659, Uncharacterized ORF, "Protein containing a CUE domain that binds ubiquitin, which may facilitate intramolecular monoubiquitination; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04579.04579.2 | 2.9756 | 0.1989 | 95.4% | 1987.3322 | 1987.3186 | 22 | 4.595 | 40.6% | 1 | Q.RRRAPAEPNKRVPQTPL.E | 2 |
U | YOR063W | 1 | 1 | 4.1% | 387 | 43758 | 10.3 | RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04769.04769.2 | 4.0119 | 0.3448 | 100.0% | 1639.2522 | 1639.6757 | 1 | 6.58 | 66.7% | 1 | R.VGKGDDEANGATSFDR.T | 2 |
U | YBR283C | 1 | 1 | 3.9% | 490 | 53312 | 8.1 | SSH1 SGDID:S000000487, Chr II from 770411-768939, reverse complement, Verified ORF, "Subunit of the Ssh1 translocon complex; Sec61p homolog involved in co-translational pathway of protein translocation; not essential" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_31.13524.13524.2 | 2.4461 | 0.1551 | 95.7% | 1989.5122 | 1992.3813 | 30 | 4.624 | 36.1% | 1 | A.MIINTVVIATNLVADTFGV.S | 2 |
U | YGL075C | 1 | 1 | 3.9% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_12.06609.06609.2 | 3.4057 | 0.2908 | 97.7% | 1595.6322 | 1595.6604 | 2 | 5.366 | 60.7% | 1 | R.TSDPGS*PLVTGIDQK.A | 2 |
U | YDR502C | 1 | 1 | 3.9% | 384 | 42256 | 5.4 | SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
U | YLR180W | 1 | 1 | 3.9% | 382 | 41818 | 5.2 | SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_13.07059.07059.2 | 3.4803 | 0.3387 | 100.0% | 1447.3522 | 1445.6182 | 1 | 6.033 | 71.4% | 1 | R.FVIGGPQGDAGLTGR.K | 2 |
U | YER006W | 1 | 1 | 3.8% | 520 | 57709 | 8.9 | NUG1 SGDID:S000000808, Chr V from 162722-164284, Verified ORF, "GTPase that associates with nuclear 60S pre-ribosomes, required for export of 60S ribosomal subunits from the nucleus" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_23.10648.10648.2 | 3.4894 | 0.3228 | 100.0% | 2340.2722 | 2339.3845 | 1 | 6.591 | 39.5% | 1 | I.DYNIDFYGEDVEGESELEKS.R | 2 |
U | Reverse_YOR311C | 1 | 1 | 3.8% | 290 | 32840 | 8.8 | HSD1 SGDID:S000005838, Chr XV from 899923-899051, reverse complement, Verified ORF, "Endoplasmic reticulum (ER)-resident membrane protein, overproduction induces enlargement of ER-like membrane structures and suppresses a temperature-sensitive sly1 mutation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_64.25660.25660.2 | 1.5935 | 0.2048 | 99.3% | 1241.7522 | 1244.4795 | 12 | 4.982 | 55.0% | 1 | S.KLHIETVPVHA.D | 2 |
U | Reverse_YJL093C | 1 | 1 | 3.6% | 691 | 77408 | 7.1 | TOK1 SGDID:S000003629, Chr X from 256728-254653, reverse complement, Verified ORF, "Outward-rectifier potassium channel of the plasma membrane with two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_53.21345.21345.2 | 2.2825 | 0.2296 | 97.1% | 2564.8323 | 2562.0393 | 12 | 4.714 | 27.1% | 1 | S.TSIDFLLDGVTSLIAGMLPVAGLAW.I | 2 |
U | YEL046C | 1 | 1 | 3.6% | 387 | 42815 | 6.3 | GLY1 SGDID:S000000772, Chr V from 68792-67629, reverse complement, Verified ORF, "Threonine aldolase, catalyzes the cleavage of L-allo-threonine and L-threonine to glycine; involved in glycine biosynthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_10.05759.05759.2 | 4.1897 | 0.4192 | 100.0% | 1572.2922 | 1572.5394 | 1 | 6.398 | 80.8% | 1 | R.SES*TEVDVDGNAIR.E | 2 |
U | Reverse_YMR172W | 1 | 1 | 3.5% | 719 | 79416 | 8.0 | HOT1 SGDID:S000004783, Chr XIII from 605980-608139, Verified ORF, "Transcription factor required for the transient induction of glycerol biosynthetic genes GPD1 and GPP2 in response to high osmolarity; targets Hog1p to osmostress responsive promoters; has similarity to Msn1p and Gcr1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_105.44779.44779.3 | 3.0546 | 0.2344 | 95.2% | 2797.1343 | 2792.7344 | 161 | 5.079 | 25.0% | 1 | D.HFS*NS*ASTVGSHISSNTYNMSTTSN.H | 3 |
U | Reverse_YLR188W | 1 | 1 | 3.5% | 695 | 75950 | 9.8 | MDL1 SGDID:S000004178, Chr XII from 528302-530389, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane, mediates export of peptides generated upon proteolysis of mitochondrial proteins, plays a role in the regulation of cellular resistance to oxidative stress" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_92.36629.36629.2 | 2.2318 | 0.2049 | 98.3% | 2525.0322 | 2525.0122 | 2 | 4.872 | 32.6% | 1 | I.IRSANAVAGIIFVAGLATFFQKKT.F | 2 |
U | YNL251C | 1 | 1 | 3.5% | 575 | 63859 | 9.2 | NRD1 SGDID:S000005195, Chr XIV from 174316-172589, reverse complement, Verified ORF, "RNA-binding protein that interacts with the C-terminal domain of the RNA polymerase II large subunit (Rpo21p), required for transcription termination and 3' end maturation of nonpolyadenylated RNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_89.35383.35383.2 | 1.9994 | 0.2301 | 97.9% | 2440.2522 | 2437.4492 | 2 | 5.333 | 34.2% | 1 | Q.DDDFQNFVATLES*FKDLKS*G.I | 2 |
U | YAL022C | 1 | 1 | 3.5% | 517 | 58317 | 5.1 | FUN26 SGDID:S000000020, Chr I from 110431-108878, reverse complement, Verified ORF, "Nucleoside transporter with broad nucleoside selectivity; localized to intracellular membranes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_31.13377.13377.2 | 2.2905 | 0.1024 | 94.9% | 1971.6721 | 1968.9917 | 9 | 4.514 | 35.3% | 1 | S.SSSGDEEHNGSVIVDLCY.M | 2 |
U | YDL182W | 1 | 1 | 3.5% | 428 | 47099 | 7.3 | LYS20 SGDID:S000002341, Chr IV from 133438-134724, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys21p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_11.06235.06235.2 | 2.7828 | 0.3125 | 93.9% | 1708.1522 | 1708.8253 | 38 | 5.283 | 46.4% | 1 | K.NFHAEVST*PQVLSAK.K | 2 |
U | Reverse_YGL245W | 1 | 1 | 3.4% | 708 | 80843 | 7.5 | GUS1 SGDID:S000003214, Chr VII from 39023-41149, Verified ORF, "Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_52.21189.21189.2 | 1.9399 | 0.1666 | 92.8% | 2704.652 | 2705.9502 | 149 | 4.435 | 23.9% | 1 | I.IVNGWDMLTVEEDVNIVDADDKDV.V | 2 |
U | Reverse_YNL101W | 1 | 1 | 3.4% | 713 | 80026 | 9.3 | AVT4 SGDID:S000005045, Chr XIV from 435001-437142, Verified ORF, "Vacuolar transporter, exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_78.30936.30936.3 | 3.2038 | 0.2549 | 90.0% | 2990.3044 | 2986.3767 | 39 | 4.987 | 25.0% | 1 | V.LIY*YCWYSYIGFFALMSVSFFLGG.N | 3 |
U | Reverse_YHR207C | 1 | 1 | 3.4% | 526 | 60547 | 6.5 | SET5 SGDID:S000001250, Chr VIII from 516485-514905, reverse complement, Verified ORF, "Zinc-finger protein of unknown function, contains one canonical and two unusual fingers in unusual arrangements; deletion enhances replication of positive-strand RNA virus" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_42.17653.17653.2 | 1.7718 | 0.1782 | 93.6% | 1953.6322 | 1952.8999 | 152 | 5.286 | 32.4% | 1 | G.NET*GNHVASQDSDNLTGI.K | 2 |
U | YCR012W | 1 | 1 | 3.4% | 416 | 44738 | 7.6 | PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_19.08986.08986.2 | 3.5903 | 0.316 | 100.0% | 1580.5122 | 1580.7319 | 1 | 6.029 | 69.2% | 1 | K.VLENTEIGDSIFDK.A | 2 |
U | Reverse_YHL050C | 1 | 1 | 3.3% | 697 | 79026 | 6.6 | YHL050C SGDID:S000001042, Chr VIII from 3310-2670,1897-445, reverse complement, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_83.32751.32751.2 | 2.1889 | 0.1999 | 98.6% | 2294.0322 | 2294.5242 | 2 | 4.881 | 31.8% | 1 | A.TTTASTRVNTSATTTANTGLPVK.S | 2 |
U | YPL105C | 1 | 1 | 3.2% | 849 | 94356 | 7.8 | YPL105C SGDID:S000006026, Chr XVI from 355409-352860, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_96.38838.38838.2 | 1.2102 | 0.3396 | 91.2% | 3070.152 | 3067.1663 | 57 | 5.169 | 17.3% | 1 | S.SENTATSIT*TNLAPWANKKPEGAVY*NQ.I | 2 |
U | YFR006W | 1 | 1 | 3.2% | 535 | 61754 | 6.2 | YFR006W SGDID:S000001902, Chr VI from 156139-157746, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_64.25311.25311.2 | 1.7929 | 0.0417 | 91.1% | 2223.612 | 2225.5327 | 111 | 4.355 | 31.2% | 1 | P.NYDDPDPMFRYLRIRRP.L | 2 |
U | YPL217C | 1 | 1 | 3.0% | 1183 | 135571 | 6.8 | BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_15.07649.07649.3 | 5.3226 | 0.3716 | 96.2% | 4089.9243 | 4090.0945 | 1 | 6.212 | 25.7% | 1 | R.IYGKPVQEEDADIDNLPS*DEEPYTNDDDVQDSEPR.M | 3 |
U | YPL189W | 1 | 1 | 3.0% | 609 | 71289 | 9.5 | GUP2 SGDID:S000006110, Chr XVI from 189153-190982, Verified ORF, "Probable membrane protein with a possible role in proton symport of glycerol; member of the MBOAT family of putative membrane-bound O-acyltransferases; Gup1p homolog" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_69.27505.27505.2 | 2.111 | 0.2239 | 92.3% | 2094.892 | 2095.566 | 27 | 4.431 | 32.4% | 1 | D.TPLQQAMIALFNLNIMYL.K | 2 |
U | Reverse_YDR291W | 1 | 1 | 2.9% | 1077 | 123549 | 6.7 | YDR291W SGDID:S000002699, Chr IV from 1039722-1042955, Uncharacterized ORF, "Putative DNA helicase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_74.29326.29326.3 | 1.7781 | 0.1799 | 91.4% | 3636.0544 | 3636.8906 | 10 | 4.603 | 15.8% | 1 | F.QDEEGGRLSVCKSPWPLFRNSAHYGDQNHHL.R | 3 |
U | Reverse_YPL231W | 1 | 1 | 2.8% | 1887 | 206945 | 5.4 | FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_97.39348.39348.4 | 2.6427 | 0.2138 | 93.0% | 5694.9365 | 5700.4243 | 207 | 4.615 | 13.1% | 1 | E.SRGLHKMMENITASENKDNAKTSTGHFSAVGLDDITLGYTALAGRLPAIRPDR.K | 4 |
U | Reverse_YEL070W | 1 | 1 | 2.8% | 502 | 56470 | 6.2 | YEL070W SGDID:S000000796, Chr V from 19589-21097, Uncharacterized ORF, "Deletion suppressor of mpt5 mutation" |
U | Reverse_YNR073C | 1 | 1 | 2.8% | 502 | 56470 | 6.2 | YNR073C SGDID:S000005356, Chr XIV from 776300-774792, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_96.38652.38652.2 | 1.8741 | 0.1129 | 90.1% | 1659.8121 | 1656.8319 | 10 | 4.297 | 42.3% | 1 | G.NQPMNDCSMITFPT.L | 2 |
U | YBR287W | 1 | 1 | 2.8% | 427 | 47506 | 4.9 | YBR287W SGDID:S000000491, Chr II from 776567-777850, Uncharacterized ORF, "Protein of unknown function; mutation results in a zinc sensitive phenotype" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_70.27772.27772.3 | 2.6057 | 0.2468 | 94.2% | 1774.6444 | 1770.8223 | 1 | 5.023 | 47.7% | 1 | I.WQKS*CT*VFERIR.A | 3 |
U | Reverse_YNL130C | 1 | 1 | 2.8% | 393 | 44829 | 6.6 | CPT1 SGDID:S000005074, Chr XIV from 380833-380784,380691-379560, reverse complement, Verified ORF, "Cholinephosphotransferase, required for phosphatidylcholine biosynthesis and for inositol-dependent regulation of EPT1 transcription" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_22.10216.10216.3 | 1.3204 | 0.2751 | 95.9% | 1328.7544 | 1332.369 | 460 | 4.749 | 40.0% | 1 | H.NSLFSRDDSQY.K | 3 |
U | Reverse_YHR195W | 1 | 1 | 2.8% | 321 | 36421 | 5.2 | NVJ1 SGDID:S000001238, Chr VIII from 490747-491712, Verified ORF, "Nuclear envelope protein that interacts with the vacuolar membrane protein Vac8p to promote formation of nucleus-vacuole junctions during piecemeal microautophagy of the nucleus (PMN)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_11.06067.06067.2 | 1.8448 | 0.118 | 90.8% | 950.97217 | 950.1258 | 281 | 4.346 | 56.2% | 1 | V.SLGLSFIGR.V | 2 |
U | Reverse_YKL105C | 1 | 1 | 2.7% | 1132 | 125593 | 5.8 | YKL105C SGDID:S000001588, Chr XI from 242227-238829, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_71.27963.27963.2 | 1.9986 | 0.1677 | 98.9% | 3117.2522 | 3119.3203 | 2 | 4.953 | 23.3% | 1 | T.KTNSATKGTSSDINPSTEISYISSSTSSPVA.S | 2 |
U | YMR309C | 1 | 1 | 2.7% | 812 | 93204 | 5.0 | NIP1 SGDID:S000004926, Chr XIII from 895425-892987, reverse complement, Verified ORF, "Subunit of the eukaryotic translation initiation factor 3 (eIF3), involved in the assembly of preinitiation complex and start codon selection" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_55.22015.22015.2 | 3.6523 | 0.2744 | 100.0% | 2399.0723 | 2396.6104 | 44 | 5.77 | 31.0% | 1 | K.DQLDSADYVDNLIDGLSTILSK.Q | 2 |
U | Reverse_YJL090C | 1 | 1 | 2.6% | 764 | 87241 | 9.0 | DPB11 SGDID:S000003626, Chr X from 264967-262673, reverse complement, Verified ORF, "Essential BRCT repeat protein, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_24.11074.11074.2 | 2.3715 | 0.3506 | 92.5% | 2393.372 | 2393.3123 | 23 | 5.23 | 31.6% | 1 | Q.GQDDDDNHSSTDKIVFNQY*N.Y | 2 |
U | Reverse_YDR219C | 1 | 1 | 2.6% | 465 | 53168 | 8.7 | YDR219C SGDID:S000002627, Chr IV from 906846-905449, reverse complement, Uncharacterized ORF, "Mitochondria-associated F-box protein involved in maintenance of normal mitochondrial morphology" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_16.08045.08045.2 | 2.2185 | 0.1011 | 92.6% | 1312.9521 | 1312.5613 | 2 | 4.433 | 68.2% | 1 | Y.GRSVSRRGVKPL.I | 2 |
U | YGL094C | 1 | 1 | 2.5% | 1115 | 127039 | 6.7 | PAN2 SGDID:S000003062, Chr VII from 334468-331121, reverse complement, Verified ORF, "Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, which acts to control poly(A) tail length and regulate the stoichiometry and activity of postreplication repair complexes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_89.35563.35563.2 | 1.771 | 0.2386 | 100.0% | 3019.4722 | 3016.4822 | 79 | 5.661 | 24.1% | 1 | L.HPLLPTVMIVASSSGSFDFIDLSNPTLR.T | 2 |
U | YPL019C | 1 | 1 | 2.5% | 835 | 96553 | 7.4 | VTC3 SGDID:S000005940, Chr XVI from 517016-514509, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_13.06741.06741.2 | 3.1568 | 0.3534 | 97.6% | 2451.9521 | 2453.4058 | 1 | 5.388 | 45.0% | 1 | R.HVIADLEDHES*S*DEEGTALPK.K | 2 |
U | YDL164C | 1 | 1 | 2.5% | 755 | 84828 | 7.5 | CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_89.35393.35393.2 | 2.1309 | 0.2716 | 90.0% | 2062.672 | 2061.145 | 18 | 5.116 | 38.9% | 1 | K.LKQTAVTHTVAAPS*SMGS*N.F | 2 |
U | YAL005C | 1 | 1 | 2.5% | 642 | 69768 | 5.1 | SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" |
U | YLL024C | 1 | 1 | 2.5% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
U | YBL075C | 1 | 1 | 2.5% | 649 | 70547 | 5.2 | SSA3 SGDID:S000000171, Chr II from 86446-84497, reverse complement, Verified ORF, "ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_8.05045.05045.2 | 3.5224 | 0.3776 | 100.0% | 1676.2722 | 1676.6964 | 1 | 6.83 | 63.3% | 1 | K.ATAGDTHLGGEDFDNR.L | 2 |
U | YDR098C-B | 2 | 2 | 2.4% | 1755 | 198594 | 8.4 | YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YGR038C-B | 2 | 2 | 2.4% | 1755 | 198520 | 8.2 | YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YER138C | 2 | 2 | 2.4% | 1755 | 198561 | 8.1 | YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YDR365W-B | 2 | 2 | 2.4% | 1755 | 198658 | 8.0 | YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YDR316W-B | 2 | 2 | 2.4% | 1755 | 198526 | 8.2 | YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YDR261C-D | 2 | 2 | 2.6% | 1604 | 181660 | 7.5 | YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
U | YDR210C-D | 2 | 2 | 2.4% | 1755 | 198838 | 8.4 | YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_7.04539.04539.2 | 3.3897 | 0.2769 | 91.1% | 1708.4521 | 1706.7257 | 1 | 5.176 | 70.0% | 1 | A.SSAVPENPHHAS*PQPA.S | 2 | |
Jamie_phos_01_itms_7.04845.04845.3 | 3.5313 | 0.2519 | 94.1% | 2872.4043 | 2871.818 | 12 | 5.03 | 26.0% | 1 | R.HSDS*YSENETNHTNVPISSTGGTNNK.T | 3 |
U | YIL048W | 1 | 1 | 2.4% | 1151 | 130218 | 6.5 | NEO1 SGDID:S000001310, Chr IX from 261436-264891, Verified ORF, "Protein involved in the retrograde transport from the Golgi complex to the ER and the endosomal membrane traffic; putative aminophospholipid translocase; member of the highly conserved Drs2 family of P-type ATPases" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_28.12544.12544.3 | 3.388 | 0.3014 | 98.8% | 3041.7244 | 3043.3672 | 5 | 5.108 | 23.1% | 1 | R.VACPLTQNLSENDLINRISITASAPEKS.I | 3 |
U | YOR018W | 1 | 1 | 2.4% | 837 | 92349 | 8.8 | ROD1 SGDID:S000005544, Chr XV from 364368-366881, Verified ORF, "Membrane protein; overexpression confers resistance to the GST substrate o-dinitrobenzene as well as to zinc and calcium; contains 2 PY motifs, which are required for Rod1p interaction with Rsp5p, a hect-type ubiquitin ligase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_53.21293.21293.2 | 1.9003 | 0.1246 | 98.9% | 2071.7722 | 2074.3813 | 1 | 4.948 | 34.2% | 1 | E.FPFSAIIPGSLVESVEGLPN.A | 2 |
U | Reverse_YKR027W | 1 | 1 | 2.4% | 765 | 88044 | 5.7 | YKR027W SGDID:S000001735, Chr XI from 491007-493304, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_44.18173.18173.2 | 2.1059 | 0.2293 | 90.6% | 1950.1921 | 1949.2257 | 1 | 4.332 | 41.2% | 1 | F.AIPMSVSSADIGTIYFFE.G | 2 |
U | YML123C | 1 | 1 | 2.4% | 587 | 64382 | 6.4 | PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_8.04899.04899.2 | 2.8067 | 0.347 | 96.6% | 1546.6322 | 1546.5907 | 1 | 5.748 | 69.2% | 1 | R.ASTAVES*LDNHPPK.A | 2 |
U | YKL222C | 1 | 1 | 2.3% | 705 | 82248 | 8.1 | YKL222C SGDID:S000001705, Chr XI from 5621-3504, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; similar to transcriptional regulators from the zinc cluster (binuclear cluster) protein family; null mutant is sensitive to caffeine" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_80.31570.31570.2 | 1.7885 | 0.1653 | 91.8% | 1749.8322 | 1747.088 | 1 | 4.372 | 46.7% | 1 | L.FTDVKISLSTGIPVRI.N | 2 |
U | YDR338C | 1 | 1 | 2.3% | 695 | 77846 | 5.3 | YDR338C SGDID:S000002746, Chr IV from 1149458-1147371, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_58.23242.23242.2 | 1.6874 | 0.06 | 90.5% | 1805.8922 | 1804.9084 | 129 | 4.323 | 33.3% | 1 | H.DEEDGELSRTISLPSR.V | 2 |
U | Reverse_YDL113C | 1 | 1 | 2.3% | 640 | 72546 | 7.0 | ATG20 SGDID:S000002271, Chr IV from 258555-256633, reverse complement, Verified ORF, "Protein required for transport of aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole targeting pathway; binds phosphatidylinositol-3-phosphate, involved in localization of membranes to the preautophagosome, potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_94.37740.37740.2 | 2.1769 | 0.2008 | 97.7% | 1466.8322 | 1466.51 | 7 | 4.744 | 46.4% | 1 | K.GGYSKGGSGTNNNPR.E | 2 |
U | Reverse_YIL129C | 1 | 1 | 2.2% | 2376 | 269856 | 6.3 | TAO3 SGDID:S000001391, Chr IX from 113237-106107, reverse complement, Verified ORF, "Protein involved in cell morphogenesis and proliferation, associated with protein kinase Cbk1p; mutants activate OCH1 transcription" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_15.07738.07738.4 | 4.2823 | 0.153 | 94.3% | 5582.8564 | 5577.081 | 306 | 4.695 | 13.4% | 1 | L.QSNAISPSSTASNNSSSAKILPVKNNFSSSVHRKMGPLNNTNNNHKYKSTTN.S | 4 |
U | YJL080C | 1 | 1 | 2.2% | 1222 | 134809 | 5.8 | SCP160 SGDID:S000003616, Chr X from 289142-285474, reverse complement, Verified ORF, "Essential RNA-binding G protein effector of mating response pathway, predominantly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_43.17757.17757.2 | 2.017 | 0.1225 | 98.3% | 3108.5522 | 3108.5625 | 55 | 4.863 | 23.1% | 1 | P.REKAKATKTSIQDYLKKLASNLDEEKV.K | 2 |
U | YPL084W | 1 | 1 | 2.1% | 844 | 97276 | 5.4 | BRO1 SGDID:S000006005, Chr XVI from 394035-396569, Verified ORF, "Cytoplasmic class E vacuolar protein sorting (VPS) factor that coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_20.09498.09498.2 | 2.3428 | 0.205 | 91.8% | 2101.912 | 2103.4321 | 1 | 4.383 | 41.2% | 1 | L.AFEKSCTLFNIAVIFTQI.A | 2 |
U | Reverse_YLL054C | 1 | 1 | 2.1% | 769 | 89163 | 7.8 | YLL054C SGDID:S000003977, Chr XII from 35203-32894, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_10.05832.05832.2 | 2.7637 | 0.2147 | 92.3% | 1962.6721 | 1962.2927 | 3 | 4.432 | 46.7% | 1 | L.SIELLPYVPYITKYFD.V | 2 |
U | Reverse_YLR032W | 1 | 1 | 2.0% | 1169 | 134002 | 6.4 | RAD5 SGDID:S000004022, Chr XII from 204992-208501, Verified ORF, "Single-stranded DNA-dependent ATPase, involved in postreplication repair; contains RING finger domain" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_92.37013.37013.2 | 1.9118 | 0.2416 | 94.6% | 2727.5122 | 2728.1448 | 2 | 4.506 | 31.8% | 1 | I.ERDYQIDFIRVLSAMSAKKRGRS.D | 2 |
U | YLL003W | 1 | 1 | 2.0% | 946 | 112978 | 9.8 | SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_25.11128.11128.2 | 3.4921 | 0.3342 | 93.8% | 2274.912 | 2275.4314 | 1 | 5.285 | 50.0% | 1 | R.DKFVPETS*PTNIPT*DVLIK.Q | 2 |
U | YMR155W | 1 | 1 | 2.0% | 547 | 60044 | 8.1 | YMR155W SGDID:S000004764, Chr XIII from 568550-570193, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_2.01768.01768.2 | 1.377 | 0.1903 | 90.1% | 1168.7122 | 1168.2487 | 15 | 4.294 | 50.0% | 1 | N.DYIGSPVRSSS.P | 2 |
U | YJR127C | 1 | 1 | 1.9% | 1380 | 155062 | 8.0 | RSF2 SGDID:S000003888, Chr X from 662974-658832, reverse complement, Verified ORF, "Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_64.25588.25588.2 | 1.9301 | 0.2304 | 94.4% | 2877.8123 | 2875.477 | 104 | 4.485 | 24.0% | 1 | S.NFAKPAGQGILPIPKKSRIIKTDKPR.P | 2 |
U | YDR421W | 1 | 1 | 1.9% | 950 | 108205 | 6.3 | ARO80 SGDID:S000002829, Chr IV from 1312030-1314882, Verified ORF, "Zinc finger transcriptional activator of the Zn2Cys6 family; activates transcription of aromatic amino acid catabolic genes in the presence of aromatic amino acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_25.11273.11273.2 | 2.2163 | 0.2036 | 99.0% | 1956.8722 | 1954.2666 | 30 | 4.885 | 35.3% | 1 | W.MLTGSAVRLAQDMGFIEN.S | 2 |
U | Reverse_YAL017W | 1 | 1 | 1.8% | 1356 | 152330 | 5.7 | PSK1 SGDID:S000000015, Chr I from 120226-124296, Verified ORF, "One of two (see also PSK2) PAS domain containing S/T protein kinases; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_26.11789.11789.2 | 2.3623 | 0.2506 | 97.4% | 2823.9521 | 2825.1663 | 195 | 4.743 | 25.0% | 1 | Y.KLKNTRHALDEYTSLNSMDKLTGTS.I | 2 |
U | Reverse_YBL101C | 1 | 1 | 1.7% | 1117 | 123609 | 6.9 | ECM21 SGDID:S000000197, Chr II from 28299-24946, reverse complement, Verified ORF, "Non-essential protein of unknown function; promoter contains several Gcn4p binding elements" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_34.14712.14712.2 | 2.3778 | 0.2989 | 90.6% | 2379.6921 | 2382.3074 | 208 | 5.226 | 27.8% | 1 | I.DEEGS*EENKLQHSS*MHLHN.K | 2 |
U | Reverse_YEL063C | 1 | 1 | 1.7% | 590 | 65786 | 8.4 | CAN1 SGDID:S000000789, Chr V from 33466-31694, reverse complement, Verified ORF, "Plasma membrane arginine permease, requires phosphatidyl ethanolamine (PE) for localization, exclusively associated with lipid rafts; mutation confers canavanine resistance" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_106.45109.45109.2 | 1.0939 | 0.0897 | 92.0% | 902.1722 | 904.99817 | 98 | 4.425 | 33.3% | 1 | Y.GNAAGFAPSL.F | 2 |
U | Reverse_YOR291W | 1 | 1 | 1.6% | 1472 | 166749 | 6.1 | YOR291W SGDID:S000005817, Chr XV from 861172-865590, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_8.05099.05099.2 | 2.6523 | 0.1924 | 93.3% | 2611.612 | 2609.8127 | 1 | 4.448 | 34.8% | 1 | G.NPESIQVGLVDLGDETLTGTKDFC.M | 2 |
U | YJL041W | 1 | 1 | 1.6% | 823 | 86516 | 6.3 | NSP1 SGDID:S000003577, Chr X from 365700-365700,365819-368289, Verified ORF, "Essential component of the nuclear pore complex, which mediates nuclear import and export" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_100.41878.41878.2 | 1.8524 | 0.1813 | 92.1% | 1286.9521 | 1284.3251 | 90 | 4.404 | 41.7% | 1 | A.NPAGASQPEPTTN.E | 2 |
U | YMR229C | 1 | 1 | 1.5% | 1729 | 193133 | 6.2 | RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_14.07103.07103.3 | 3.6992 | 0.3499 | 97.8% | 3199.8542 | 3201.1194 | 444 | 5.502 | 24.0% | 1 | K.VEDAEY*ESS*DDEDEKLDKSNELPNLR.R | 3 |
U | YML059C | 1 | 1 | 1.5% | 1679 | 187132 | 8.1 | NTE1 SGDID:S000004524, Chr XIII from 158258-153219, reverse complement, Verified ORF, "Serine esterase that deacylates exogenous lysophospholipids, homolog of human neuropathy target esterase (NTE); mammalian NTE1 deacylates phosphatidylcholine to glycerophosphocholine" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_105.44610.44610.3 | 2.5437 | 0.2465 | 95.2% | 2815.8843 | 2819.0574 | 3 | 4.712 | 24.0% | 1 | L.KGRVSPRPNLLPTTSFSAAQEETEDS.A | 3 |
U | YBL047C | 1 | 1 | 1.5% | 1381 | 150783 | 4.7 | EDE1 SGDID:S000000143, Chr II from 132043-127898, reverse complement, Verified ORF, "Key endocytic protein involved in a network of interactions with other endocytic proteins, binds membranes in a ubiquitin-dependent manner, may also bind ubiquitinated membrane-associated proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_13.06780.06780.2 | 3.6033 | 0.189 | 91.6% | 2260.872 | 2259.542 | 59 | 4.368 | 35.0% | 1 | S.LQDMPHQVSAPAVNTQPTVPQ.V | 2 |
U | YIL147C | 1 | 1 | 1.5% | 1220 | 134435 | 7.5 | SLN1 SGDID:S000001409, Chr IX from 73453-69791, reverse complement, Verified ORF, "Histidine kinase osmosensor that regulates a MAP kinase cascade; transmembrane protein with an intracellular kinase domain that signals to Ypd1p and Ssk1p, thereby forming a phosphorelay system similar to bacterial two-component regulators" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_13.06749.06749.2 | 1.8527 | 0.2202 | 95.2% | 1896.5521 | 1897.9908 | 345 | 4.543 | 32.4% | 1 | D.REKASNDDVSSIVSTTTS.S | 2 |
U | Reverse_YLR383W | 1 | 1 | 1.5% | 1114 | 128008 | 7.5 | SMC6 SGDID:S000004375, Chr XII from 885288-888632, Verified ORF, "Protein involved in structural maintenance of chromosomes; required for interchromosomal and sister chromatid recombination; homologous to S. pombe rad18" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_84.33177.33177.2 | 2.0832 | 0.1115 | 95.1% | 1991.7322 | 1991.162 | 22 | 4.56 | 40.6% | 1 | T.SDYQEKIPQAEQAIQEI.K | 2 |
U | Reverse_YCR030C | 1 | 1 | 1.5% | 870 | 96137 | 8.6 | SYP1 SGDID:S000000626, Chr III from 176433-173821, reverse complement, Verified ORF, "Protein with a potential role in actin cytoskeletal organization; overexpression suppresses a pfy1 (profilin) null mutation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_6.04241.04241.2 | 1.7837 | 0.1317 | 94.3% | 1341.3322 | 1339.5927 | 213 | 4.499 | 41.7% | 1 | N.IGIPLPSNMVSNP.L | 2 |
U | Reverse_YNL138W | 1 | 1 | 1.5% | 526 | 57522 | 5.6 | SRV2 SGDID:S000005082, Chr XIV from 366743-368323, Verified ORF, "CAP (cyclase-associated protein) subunit of adenylyl cyclase complex; N-terminus binds adenylyl cyclase and facilitates activation by RAS; C-terminus binds ADP-actin monomers, facilitating regulation of actin dynamics and cell morphogenesis" |
U | YNL071W | 1 | 1 | 1.7% | 482 | 51818 | 7.8 | LAT1 SGDID:S000005015, Chr XIV from 491524-492972, Verified ORF, "Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex, which catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Jamie_phos_01_itms_98.40030.40030.1 | 1.4736 | 0.2703 | 100.0% | 718.78 | 717.75385 | 42 | 5.794 | 50.0% | 1 | S.APSPSSTA.G | 1 |
U | Reverse_YHR164C | 1 | 1 | 1.4% | 1522 | 171694 | 6.5 | DNA2 SGDID:S000001207, Chr VIII from 429180-424612, reverse complement, Verified ORF, "Essential tripartite DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, and helicase activities; required for Okazaki fragment processing; involved in DNA repair pathways; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_27.11965.11965.2 | 2.5344 | 0.215 | 96.8% | 2386.9922 | 2389.5623 | 42 | 4.712 | 30.0% | 1 | L.MGEVCQLTLEAEGHNTINDKE.S | 2 |
U | YPL226W | 1 | 1 | 1.4% | 1196 | 134331 | 5.9 | NEW1 SGDID:S000006147, Chr XVI from 121767-125357, Verified ORF, "ATP binding cassette family member; Asn/Gln-rich rich region supports [NU+] prion formation, susceptibility to [PSI+] prion induction and aggregation of a fragment of the human Machado-Joseph Disease protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04570.04570.2 | 2.3835 | 0.346 | 100.0% | 1897.2722 | 1897.8578 | 33 | 6.014 | 43.8% | 1 | L.SSPKGTPKPVDT*DDEED.- | 2 |
U | Reverse_YIL075C | 1 | 1 | 1.4% | 945 | 104232 | 6.2 | RPN2 SGDID:S000001337, Chr IX from 220697-217860, reverse complement, Verified ORF, "Subunit of the 26S proteasome, substrate of the N-acetyltransferase Nat1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_101.42487.42487.2 | 1.646 | 0.2451 | 98.0% | 1310.4122 | 1309.5052 | 337 | 4.813 | 41.7% | 1 | G.IGLSAGHLLVDVD.E | 2 |
U | YBR098W | 1 | 1 | 1.4% | 691 | 78764 | 7.5 | MMS4 SGDID:S000000302, Chr II from 441509-443584, Verified ORF, "Subunit of the structure-specific Mms4p-Mus81p endonuclease that cleaves branched DNA; involved in recombination and DNA repair" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_1.00561.00561.2 | 1.8478 | 0.3071 | 97.4% | 1130.2722 | 1132.1473 | 4 | 5.457 | 72.2% | 1 | H.GEDGTS*MAKR.V | 2 |
U | YBR275C | 1 | 1 | 1.3% | 1916 | 217959 | 6.6 | RIF1 SGDID:S000000479, Chr II from 757101-751351, reverse complement, Verified ORF, "Protein that binds to the Rap1p C-terminus and acts synergistically with Rif2p to help control telomere length and establish telomeric silencing; deletion results in telomere elongation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_70.27711.27711.2 | 2.003 | 0.119 | 94.6% | 2627.0522 | 2628.948 | 105 | 4.505 | 26.1% | 1 | I.NAQNGLDTVPKTIGGKEKHHEIQL.G | 2 |
U | Reverse_YBL017C | 1 | 1 | 1.3% | 1579 | 177777 | 4.9 | PEP1 SGDID:S000000113, Chr II from 191586-186847, reverse complement, Verified ORF, "Type I transmembrane sorting receptor for multiple vacuolar hydrolases; cycles between the late-Golgi and prevacuolar endosome-like compartments" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_82.32565.32565.2 | 2.3298 | 0.1436 | 90.3% | 2157.3123 | 2156.3748 | 8 | 4.315 | 34.2% | 1 | F.TRQDGWDFVSGDGVIGTTML.I | 2 |
U | YGR014W | 1 | 1 | 1.3% | 1306 | 133114 | 4.2 | MSB2 SGDID:S000003246, Chr VII from 516947-520867, Verified ORF, "Mucin family member at the head of the Cdc42p- and MAP kinase-dependent filamentous growth signaling pathway; also functions as an osmosensor in parallel to the Sho1p-mediated pathway; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_94.37780.37780.2 | 1.4423 | 0.066 | 90.9% | 1680.5521 | 1680.633 | 31 | 4.339 | 37.5% | 1 | T.SSFASSSTTEGSETSSQ.G | 2 |
U | Reverse_YGR162W | 1 | 1 | 1.3% | 952 | 107101 | 6.0 | TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_76.30017.30017.2 | 2.3963 | 0.2384 | 96.6% | 1393.7122 | 1393.4503 | 6 | 4.656 | 54.5% | 1 | R.RTKEAESINEES.S | 2 |
U | YLR045C | 1 | 1 | 1.2% | 888 | 100918 | 8.6 | STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_30.13282.13282.2 | 1.5784 | 0.2205 | 98.3% | 1098.0521 | 1095.1539 | 43 | 4.839 | 55.0% | 1 | N.FSIASGSTHST.I | 2 |
U | YBR115C | 1 | 1 | 1.1% | 1392 | 155345 | 5.9 | LYS2 SGDID:S000000319, Chr II from 473920-469742, reverse complement, Verified ORF, "Alpha aminoadipate reductase, catalyzes the reduction of alpha-aminoadipate to alpha-aminoadipate 6-semialdehyde, which is the fifth step in biosynthesis of lysine; activation requires posttranslational phosphopantetheinylation by Lys5p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_73.28629.28629.2 | 2.0116 | 0.1914 | 90.7% | 1574.4321 | 1572.7527 | 284 | 4.331 | 39.3% | 1 | K.LVSEGKPGILESDDL.M | 2 |
U | Reverse_YLR371W | 1 | 1 | 1.0% | 1356 | 152596 | 9.2 | ROM2 SGDID:S000004363, Chr XII from 862713-866783, Verified ORF, "GDP/GTP exchange protein (GEP) for Rho1p and Rho2p; mutations are synthetically lethal with mutations in rom1, which also encodes a GEP" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_28.12312.12312.2 | 2.388 | 0.0462 | 96.3% | 1727.5122 | 1728.9481 | 14 | 4.647 | 50.0% | 1 | D.FRAFYPNVSRQTEI.L | 2 |
U | YPL160W | 1 | 1 | 1.0% | 1090 | 124141 | 5.8 | CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_7.04648.04648.2 | 2.2277 | 0.1636 | 92.0% | 1201.8722 | 1202.5443 | 84 | 4.421 | 65.0% | 1 | Q.MNKLKAAGKIK.F | 2 |
U | YMR205C | 1 | 1 | 1.0% | 959 | 104618 | 6.7 | PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_9.05445.05445.2 | 2.4643 | 0.2259 | 97.8% | 1305.2122 | 1305.3464 | 2 | 5.355 | 72.2% | 1 | K.VHS*YTDLAYR.M | 2 |
U | YNR016C | 1 | 1 | 0.9% | 2233 | 250351 | 6.3 | ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_22.10085.10085.2 | 5.3724 | 0.5211 | 100.0% | 2061.4321 | 2061.17 | 1 | 8.797 | 63.9% | 1 | R.AVS*VSDLSYVANSQSSPLR.E | 2 |
U | Reverse_YMR229C | 1 | 1 | 0.8% | 1729 | 193133 | 6.2 | RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_76.30049.30049.2 | 2.0214 | 0.1902 | 91.5% | 1417.6522 | 1416.7037 | 3 | 4.371 | 57.7% | 1 | I.SAVKVQLASGLPFV.S | 2 |
U | Reverse_YPL217C | 1 | 1 | 0.8% | 1183 | 135571 | 6.8 | BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_6.04420.04420.2 | 1.7082 | 0.2491 | 99.6% | 936.71216 | 934.0397 | 3 | 5.194 | 72.2% | 1 | T.GPASPLPTGH.L | 2 |
U | Reverse_YDR170C | 1 | 1 | 0.6% | 2009 | 226885 | 4.8 | SEC7 SGDID:S000002577, Chr IV from 802217-796188, reverse complement, Verified ORF, "Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_92.37018.37018.2 | 1.787 | 0.1831 | 90.4% | 1323.5721 | 1322.3374 | 69 | 4.329 | 50.0% | 1 | K.TEATSGANEPGKC.K | 2 |
U | YCR089W | 1 | 1 | 0.6% | 1609 | 166036 | 4.9 | FIG2 SGDID:S000000685, Chr III from 267430-272259, Verified ORF, "Cell wall adhesin, expressed specifically during mating; may be involved in maintenance of cell wall integrity during mating" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_107.45438.45438.2 | 1.329 | 0.0869 | 90.9% | 1001.09216 | 1000.09357 | 42 | 4.336 | 56.2% | 1 | S.ETYKSSATI.S | 2 |
U | YBL088C | 1 | 1 | 0.5% | 2787 | 321568 | 6.9 | TEL1 SGDID:S000000184, Chr II from 59379-51016, reverse complement, Verified ORF, "Protein kinase, primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_75.29451.29451.2 | 1.5063 | 0.2626 | 90.5% | 1557.1522 | 1556.7557 | 81 | 4.323 | 37.5% | 1 | Q.DFTKSFAEQLKEL.L | 2 |
U | YLR106C | 1 | 1 | 0.4% | 4910 | 559316 | 5.0 | MDN1 SGDID:S000004096, Chr XII from 363739-349007, reverse complement, Verified ORF, "Huge dynein-related AAA-type ATPase (midasin), forms extended pre-60S particle with the Rix1 complex (Rix1p-Ipi1p-Ipi3p), may mediate ATP-dependent remodeling of 60S subunits and subsequent export from nucleoplasm to cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | Jamie_phos_01_itms_40.16642.16642.2 | 2.0762 | 0.2549 | 97.5% | 2289.5522 | 2288.5835 | 6 | 4.715 | 34.2% | 1 | L.LAQFMGRELITLNAHQNTET.G | 2 |
Proteins | Peptide IDs | Spectra | |
Unfiltered | 11071 | 92316 | 101590 |
Filtered | 205 | 455 | 505 |
Forward matches | 147 | 396 | 446 |
Decoy matches | 58 | 59 | 59 |
Forward FP rate | 39.46% | 14.9% | 13.23% |