| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YIL002W-A | 9 | 11 | 56.5% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
| U | YIL149C | 73 | 80 | 50.5% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| U | YLR200W | 1 | 1 | 49.1% | 114 | 13284 | 4.7 | YKE2 SGDID:S000004190, Chr XII from 549014-549358, Verified ORF, "Subunit of the heterohexameric Gim/prefoldin protein complex involved in the folding of alpha-tubulin, beta-tubulin, and actin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_64.22269.22269.4 | 3.1855 | 0.2146 | 100.0% | 6822.2163 | 6827.3887 | 6 | 4.155 | 13.0% | 1 | K.IVNEEFDQLEEDTPVY*KLT*GNVLLPVEQSEARTNVDKRLEFIETEITRCEKNIRDK.Q | 4 |
| U | YOR382W | 1 | 1 | 41.8% | 153 | 15302 | 8.4 | FIT2 SGDID:S000005909, Chr XV from 1059527-1059988, Verified ORF, "Mannoprotein that is incorporated into the cell wall via a glycosylphosphatidylinositol (GPI) anchor, involved in the retention of siderophore-iron in the cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_64.22380.22380.4 | 2.8544 | 0.4391 | 100.0% | 6240.124 | 6244.4116 | 198 | 2.897 | 11.9% | 1 | S.EKSTTKTLTLTNGSGSSTNLYT*KTVTQAVESSTSSSS*SSSSSSSSASSSGAAPAAFQGASVGAL.A | 4 |
| U | YLR068W | 1 | 1 | 26.5% | 151 | 18190 | 10.3 | FYV7 SGDID:S000004058, Chr XII from 271009-271464, Verified ORF, "Protein of unknown function, required for survival upon exposure to K1 killer toxin; involved in processing the 35S rRNA primary transcript to generate the 20S and 27SA2 pre-rRNA transcripts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_47.16805.16805.4 | 4.1603 | 0.1303 | 100.0% | 4720.7017 | 4720.338 | 288 | 3.459 | 16.7% | 1 | R.KEYLKALKDEGY*AVPEKEPKTVAKES*VRKIKEARAIEGKK.K | 4 |
| U | contaminant_KERATIN02 | 9 | 10 | 25.4% | 622 | 61987 | 5.2 | no description |
| U | YBL003C | 1 | 1 | 22.0% | 132 | 13989 | 10.7 | HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| U | YDR225W | 1 | 1 | 22.0% | 132 | 13989 | 10.7 | HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_61.21476.21476.2 | 3.1053 | 0.3121 | 100.0% | 2947.4758 | 2947.4014 | 1 | 5.774 | 33.9% | 1 | R.IGSGAPVYLTAVLEYLAAEILELAGNAAR.D | 2 |
| U | YPL037C | 1 | 1 | 19.1% | 157 | 17020 | 6.5 | EGD1 SGDID:S000005958, Chr XVI from 481898-481425, reverse complement, Verified ORF, "Subunit beta1 of the nascent polypeptide-associated complex (NAC) involved in protein targeting, associated with cytoplasmic ribosomes; enhances DNA binding of the Gal4p activator; homolog of human BTF3b" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_58.20164.20164.2 | 2.7501 | 0.2186 | 100.0% | 3227.331 | 3225.7278 | 3 | 5.145 | 27.6% | 1 | K.NLQDLFPGIISQLGPEAIQALSQLAAQMEK.H | 2 |
| U | contaminant_NRL_1IKFL | 2 | 2 | 18.7% | 214 | 23527 | 6.5 | owl|| Immunoglobulin igg1-kappa antibody fragment fab complexed With... |
| U | contaminant_S68241 | 2 | 2 | 18.3% | 218 | 23846 | 6.7 | owl|S68241| immunoglobulin light chain (Mab13-1) - mouse (fragment) |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_32.11717.11717.3 | 3.9115 | 0.1508 | 97.9% | 4301.1846 | 4299.793 | 1 | 4.244 | 18.6% | 1 | L.RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVK.W | 3 | |
| Jamie_alpha_091208_39.13842.13842.2 | 2.5871 | 0.1797 | 98.9% | 3573.7322 | 3573.947 | 2 | 4.048 | 21.2% | 1 | R.ADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPK.D | 2 |
| U | Reverse_YJL122W | 1 | 1 | 16.6% | 175 | 19287 | 10.0 | YJL122W SGDID:S000003658, Chr X from 189636-190163, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_72.24914.24914.4 | 3.1952 | 0.1459 | 90.6% | 3182.2546 | 3183.2842 | 180 | 3.506 | 22.6% | 1 | K.S*LTRTTIS*APSSSANQLTVATSNQSENKK.N | 4 |
| U | Reverse_YBR164C | 1 | 1 | 16.4% | 183 | 20434 | 4.9 | ARL1 SGDID:S000000368, Chr II from 568421-567870, reverse complement, Verified ORF, "Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; G protein of the Ras superfamily, similar to ADP-ribosylation factor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_19.07142.07142.2 | 1.569 | 0.1863 | 94.8% | 3367.2922 | 3364.8591 | 44 | 3.47 | 22.4% | 1 | K.GAGDLGLILIRLEKNSGWLKDFMSS*FINGM.- | 2 |
| U | YDL229W | 6 | 6 | 16.0% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_12.04601.04601.2 | 3.0865 | 0.3335 | 100.0% | 1395.755 | 1395.6011 | 12 | 5.717 | 63.6% | 1 | R.ARFEDLNAALFK.S | 22 | |
| Jamie_alpha_091208_9.03487.03487.3 | 2.7301 | 0.2487 | 100.0% | 1788.9852 | 1789.0391 | 1 | 4.99 | 39.1% | 1 | K.ISKSQIDEVVLVGGSTR.I | 33 | |
| Jamie_alpha_091208_14.05342.05342.2 | 2.3441 | 0.1788 | 99.0% | 1542.0809 | 1540.7563 | 7 | 3.93 | 54.2% | 1 | K.LLSDFFDGKQLEK.S | 22 | |
| * | Jamie_alpha_091208_12.04563.04563.2 | 4.7199 | 0.3261 | 100.0% | 2465.1306 | 2464.6167 | 1 | 6.914 | 50.0% | 1 | R.TFTTCADNQTTVQFPVYQGER.V | 2 |
| Jamie_alpha_091208_13.05112.05112.2 | 3.6645 | 0.1526 | 100.0% | 1782.8943 | 1780.9818 | 1 | 4.041 | 60.7% | 1 | R.VNCKENTLLGEFDLK.N | 22 | |
| Jamie_alpha_091208_11.04470.04470.2 | 2.6148 | 0.2048 | 100.0% | 2133.5122 | 2135.336 | 74 | 4.66 | 31.6% | 1 | K.SSNITISNAVGRLSSEEIEK.M | 22 |
| U | YNL209W | 6 | 6 | 16.0% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_12.04601.04601.2 | 3.0865 | 0.3335 | 100.0% | 1395.755 | 1395.6011 | 12 | 5.717 | 63.6% | 1 | R.ARFEDLNAALFK.S | 22 | |
| Jamie_alpha_091208_9.03487.03487.3 | 2.7301 | 0.2487 | 100.0% | 1788.9852 | 1789.0391 | 1 | 4.99 | 39.1% | 1 | K.ISKSQIDEVVLVGGSTR.I | 33 | |
| Jamie_alpha_091208_14.05342.05342.2 | 2.3441 | 0.1788 | 99.0% | 1542.0809 | 1540.7563 | 7 | 3.93 | 54.2% | 1 | K.LLSDFFDGKQLEK.S | 22 | |
| * | Jamie_alpha_091208_13.04884.04884.2 | 4.3495 | 0.3381 | 100.0% | 2419.15 | 2419.6096 | 1 | 6.479 | 42.5% | 1 | R.TFTTVSDNQTTVQFPVYQGER.V | 2 |
| Jamie_alpha_091208_13.05112.05112.2 | 3.6645 | 0.1526 | 100.0% | 1782.8943 | 1780.9818 | 1 | 4.041 | 60.7% | 1 | R.VNCKENTLLGEFDLK.N | 22 | |
| Jamie_alpha_091208_11.04470.04470.2 | 2.6148 | 0.2048 | 100.0% | 2133.5122 | 2135.336 | 74 | 4.66 | 31.6% | 1 | K.SSNITISNAVGRLSSEEIEK.M | 22 |
| U | contaminant_INT-STD1 | 8 | 10 | 15.5% | 607 | 69271 | 6.1 | BSA |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_1.00047.00047.2 | 1.9054 | 0.1686 | 96.6% | 1193.6044 | 1194.2925 | 10 | 3.842 | 66.7% | 1 | R.DTHKSEIAHR.F | 2 |
| * | Jamie_alpha_091208_9.03709.03709.3 | 4.092 | 0.3481 | 100.0% | 2867.434 | 2866.009 | 1 | 6.115 | 29.2% | 1 | K.TCVADESHAGCEKSLHTLFGDELCK.V | 3 |
| * | Jamie_alpha_091208_10.04111.04111.2 | 3.5607 | 0.3841 | 100.0% | 1422.7028 | 1420.5713 | 1 | 6.55 | 77.3% | 1 | K.SLHTLFGDELCK.V | 2 |
| * | Jamie_alpha_091208_22.08373.08373.2 | 3.9326 | 0.4022 | 100.0% | 1691.8646 | 1693.9781 | 1 | 6.564 | 71.4% | 2 | K.AEFVEVTKLVTDLTK.V | 2 |
| * | Jamie_alpha_091208_9.03753.03753.3 | 4.0125 | 0.0951 | 100.0% | 1439.8107 | 1440.6884 | 1 | 4.92 | 70.5% | 2 | R.RHPEYAVSVLLR.L | 3 |
| * | Jamie_alpha_091208_6.02627.02627.2 | 1.8142 | 0.1856 | 97.5% | 1305.0007 | 1306.5046 | 4 | 5.06 | 65.0% | 1 | K.HLVDEPQNLIK.Q | 2 |
| * | Jamie_alpha_091208_24.08950.08950.3 | 5.6254 | 0.4119 | 100.0% | 3818.9194 | 3818.2468 | 1 | 6.766 | 26.6% | 1 | K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y | 3 |
| * | Jamie_alpha_091208_15.05615.05615.2 | 3.201 | 0.2167 | 100.0% | 1479.7987 | 1480.7068 | 2 | 5.003 | 62.5% | 1 | K.LGEYGFQNALIVR.Y | 2 |
| U | YPL131W | 2 | 2 | 15.2% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_18.07050.07050.2 | 3.9702 | 0.3166 | 100.0% | 2581.216 | 2580.7644 | 1 | 6.019 | 38.6% | 1 | K.GVEEVEGEYELTEAVEDGPRPFK.V | 2 |
| * | Jamie_alpha_091208_20.07608.07608.2 | 3.2126 | 0.2815 | 100.0% | 2592.9321 | 2591.7217 | 6 | 4.721 | 33.3% | 1 | R.SYIFGGHVSQYMEELADDDEER.F | 2 |
| U | YDL130W | 1 | 1 | 15.1% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.05011.05011.2 | 4.2554 | 0.4284 | 100.0% | 1664.8102 | 1664.815 | 1 | 7.445 | 63.3% | 1 | K.AAGANVDNVWADVYAK.A | 2 |
| U | YAL038W | 6 | 6 | 15.0% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_11.04484.04484.2 | 3.2792 | 0.1609 | 100.0% | 2186.1777 | 2186.4705 | 2 | 4.657 | 44.7% | 1 | R.TANDVLTIREVLGEQGKDVK.I | 2 |
| * | Jamie_alpha_091208_15.05851.05851.2 | 2.7297 | 0.1216 | 98.2% | 1878.0922 | 1878.2194 | 12 | 3.808 | 41.2% | 1 | R.GDLGIEIPAPEVLAVQKK.L | 2 |
| * | Jamie_alpha_091208_25.09235.09235.3 | 4.2154 | 0.2795 | 100.0% | 2571.8044 | 2570.8174 | 1 | 5.219 | 38.1% | 1 | R.GVFPFVFEKEPVSDWTDDVEAR.I | 3 |
| * | Jamie_alpha_091208_25.09396.09396.2 | 4.9956 | 0.3773 | 100.0% | 2572.2214 | 2570.8174 | 1 | 6.592 | 54.8% | 1 | R.GVFPFVFEKEPVSDWTDDVEAR.I | 2 |
| * | Jamie_alpha_091208_8.03336.03336.2 | 2.4446 | 0.3528 | 100.0% | 1520.6727 | 1519.5646 | 22 | 5.703 | 50.0% | 1 | K.EPVSDWTDDVEAR.I | 2 |
| * | Jamie_alpha_091208_13.05145.05145.2 | 2.4461 | 0.1076 | 95.3% | 1709.2122 | 1708.0538 | 1 | 3.291 | 57.1% | 1 | R.INFGIEKAKEFGILK.K | 2 |
| U | YGR282C | 4 | 4 | 15.0% | 313 | 34119 | 4.5 | BGL2 SGDID:S000003514, Chr VII from 1058730-1057789, reverse complement, Verified ORF, "Endo-beta-1,3-glucanase, major protein of the cell wall, involved in cell wall maintenance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05667.05667.2 | 2.7825 | 0.2624 | 100.0% | 1162.9722 | 1161.3867 | 1 | 5.017 | 75.0% | 1 | A.IGELAFNLGVK.N | 2 |
| * | Jamie_alpha_091208_10.03915.03915.2 | 4.3971 | 0.5178 | 100.0% | 1951.977 | 1951.1528 | 1 | 8.81 | 55.9% | 1 | A.IGELAFNLGVKNNDGTCK.S | 2 |
| * | Jamie_alpha_091208_8.03330.03330.2 | 4.0265 | 0.3542 | 100.0% | 2275.0112 | 2275.354 | 1 | 6.045 | 52.6% | 1 | K.NNDGTCKSTSDYETELQALK.S | 2 |
| * | Jamie_alpha_091208_7.03009.03009.3 | 3.8491 | 0.33 | 100.0% | 1788.912 | 1789.9402 | 6 | 5.735 | 35.0% | 1 | R.NDLTASQLSDKINDVR.S | 3 |
| U | contaminant_KERATIN13 | 6 | 6 | 14.5% | 643 | 65494 | 6.6 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05888.05888.4 | 3.9513 | 0.2895 | 100.0% | 2423.2874 | 2423.7341 | 1 | 5.647 | 35.1% | 1 | R.EREQIKSLNNQFASFIDKVR.F | 4 |
| * | Jamie_alpha_091208_16.06223.06223.3 | 2.1013 | 0.2019 | 92.3% | 1638.8582 | 1639.8516 | 69 | 4.885 | 42.3% | 1 | K.SLNNQFASFIDKVR.F | 3 |
| * | Jamie_alpha_091208_19.07294.07294.3 | 5.9232 | 0.4135 | 100.0% | 2935.5054 | 2934.2786 | 1 | 7.393 | 34.8% | 1 | R.FLEQQNQVLQTKWELLQQVDTSTR.T | 3 |
| * | Jamie_alpha_091208_25.09273.09273.2 | 3.4827 | 0.3061 | 100.0% | 1996.0149 | 1995.2017 | 2 | 5.873 | 50.0% | 1 | R.THNLEPYFESFINNLR.R | 2 |
| * | Jamie_alpha_091208_7.02854.02854.2 | 2.2484 | 0.1719 | 98.1% | 1267.6635 | 1266.3934 | 11 | 3.939 | 65.0% | 1 | R.TNAENEFVTIK.K | 2 |
| * | Jamie_alpha_091208_9.03499.03499.2 | 4.833 | 0.3341 | 100.0% | 2502.2546 | 2502.7405 | 1 | 6.931 | 52.4% | 1 | K.SKAEAESLYQSKYEELQITAGR.H | 2 |
| U | YER011W | 1 | 1 | 14.2% | 254 | 24906 | 4.8 | TIR1 SGDID:S000000813, Chr V from 175247-176011, Verified ORF, "Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins; expression is downregulated at acidic pH and induced by cold shock and anaerobiosis; abundance is increased in cells cultured without shaking" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_69.23891.23891.3 | 3.1912 | 0.1586 | 94.6% | 3450.718 | 3449.3586 | 38 | 3.713 | 17.9% | 1 | K.SSSAAPSSSEAKSSSAAPSS*SEAKS*SSAAPSSSEAK.S | 3 |
| U | YDR432W | 3 | 3 | 12.6% | 414 | 45407 | 5.5 | NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.05109.05109.2 | 2.7074 | 0.0837 | 95.3% | 1901.915 | 1903.068 | 11 | 4.349 | 46.7% | 1 | K.NLPEGCSWQDLKDLAR.E | 2 |
| * | Jamie_alpha_091208_9.03454.03454.2 | 2.5265 | 0.1643 | 99.0% | 1585.7532 | 1585.6677 | 8 | 4.584 | 53.8% | 1 | R.ENSLETTFSSVNTR.D | 2 |
| * | Jamie_alpha_091208_37.13440.13440.2 | 2.9629 | 0.1414 | 98.9% | 2440.1777 | 2438.6501 | 20 | 4.338 | 31.0% | 1 | R.DFDGTGALEFPSEEILVEALER.L | 2 |
| U | contaminant_KERATIN03 | 4 | 4 | 12.5% | 593 | 59519 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_35.12786.12786.3 | 4.2964 | 0.1893 | 100.0% | 3053.6465 | 3054.4277 | 137 | 4.822 | 23.1% | 1 | K.TIDDLKNQILNLTTDNANILLQIDNAR.L | 3 |
| * | Jamie_alpha_091208_9.03630.03630.2 | 2.074 | 0.1243 | 96.7% | 1109.494 | 1110.1681 | 16 | 4.66 | 62.5% | 1 | K.DAEAWFNEK.S | 2 |
| * | Jamie_alpha_091208_18.07048.07048.4 | 4.8904 | 0.2563 | 100.0% | 3198.6401 | 3198.5115 | 2 | 5.473 | 29.5% | 1 | K.SKELTTEIDNNIEQISSYKSEITELRR.N | 4 |
| * | Jamie_alpha_091208_6.02575.02575.2 | 2.8384 | 0.1376 | 98.9% | 1434.7665 | 1435.623 | 1 | 4.693 | 75.0% | 1 | K.IRLENEIQTYR.S | 2 |
| U | YOL127W | 1 | 1 | 12.0% | 142 | 15758 | 10.1 | RPL25 SGDID:S000005487, Chr XV from 80347-80359,80774-81189, Verified ORF, "Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 26S rRNA via a conserved C-terminal motif" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_25.09307.09307.2 | 2.169 | 0.1223 | 95.5% | 1896.9253 | 1898.1228 | 168 | 3.591 | 34.4% | 1 | R.LTADYDALDIANRIGYI.- | 2 |
| U | YOR369C | 1 | 1 | 11.9% | 143 | 15472 | 4.7 | RPS12 SGDID:S000005896, Chr XV from 1028621-1028190, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to rat ribosomal protein S12" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_9.03643.03643.2 | 3.7984 | 0.1839 | 100.0% | 1852.0322 | 1850.1655 | 1 | 4.689 | 62.5% | 1 | K.LVEGLANDPENKVPLIK.V | 2 |
| U | YGR254W | 3 | 3 | 10.8% | 437 | 46816 | 6.6 | ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" |
| U | YHR174W | 3 | 3 | 10.8% | 437 | 46914 | 6.0 | ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_11.04456.04456.3 | 3.9364 | 0.1164 | 98.2% | 2583.3237 | 2584.8455 | 1 | 3.63 | 29.5% | 1 | R.SVYDSRGNPTVEVELTTEKGVFR.S | 3 | |
| Jamie_alpha_091208_32.11754.11754.3 | 6.1635 | 0.438 | 100.0% | 2988.4177 | 2986.269 | 1 | 7.483 | 37.0% | 1 | K.RYPIVSIEDPFAEDDWEAWSHFFK.T | 3 | |
| Jamie_alpha_091208_37.13161.13161.3 | 5.3652 | 0.4558 | 100.0% | 2831.2986 | 2830.0815 | 1 | 7.837 | 47.7% | 1 | R.YPIVSIEDPFAEDDWEAWSHFFK.T | 3 |
| U | Reverse_YDR494W | 1 | 1 | 9.7% | 361 | 41216 | 10.0 | RSM28 SGDID:S000002902, Chr IV from 1436920-1438005, Verified ORF, "Mitochondrial ribosomal protein of the small subunit; genetic interactions suggest a possible role in promoting translation initiation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_39.13993.13993.3 | 3.2827 | 0.1551 | 94.5% | 3938.399 | 3941.174 | 57 | 4.243 | 19.1% | 1 | K.DLKLANSSAKAT*AEQARALISNIFDETVSTSY*HAR.S | 3 |
| U | YAL005C | 3 | 4 | 9.3% | 642 | 69768 | 5.1 | SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" |
| U | YLL024C | 3 | 4 | 9.4% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_12.04703.04703.2 | 3.9625 | 0.373 | 100.0% | 1897.9922 | 1896.0667 | 1 | 6.181 | 53.1% | 1 | K.VNDAVVTVPAYFNDSQR.Q | 2 | |
| Jamie_alpha_091208_15.05617.05617.2 | 3.3387 | 0.2805 | 100.0% | 1529.7126 | 1527.6862 | 2 | 5.448 | 72.7% | 2 | R.ARFEELCADLFR.S | 2 | |
| Jamie_alpha_091208_21.07921.07921.3 | 3.2983 | 0.1211 | 92.2% | 3373.0444 | 3369.8406 | 21 | 3.641 | 21.7% | 1 | R.STLDPVEKVLRDAKLDKSQVDEIVLVGGSTR.I | 3 |
| U | Reverse_YHR089C | 1 | 1 | 9.3% | 205 | 21480 | 11.5 | GAR1 SGDID:S000001131, Chr VIII from 283300-282683, reverse complement, Verified ORF, "Protein component of the H/ACA snoRNP pseudouridylase complex, involved in the modification and cleavage of the 18S pre-rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_58.20168.20168.2 | 2.0881 | 0.1678 | 96.6% | 1845.9305 | 1845.133 | 116 | 4.258 | 33.3% | 1 | R.GMSAGGRGGPAGSRKKKNK.P | 2 |
| U | YOR257W | 1 | 1 | 9.3% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_7.02986.02986.3 | 3.0839 | 0.3184 | 100.0% | 1702.92 | 1703.8871 | 14 | 5.736 | 42.9% | 1 | R.VAKELGETLTDEELR.A | 3 |
| U | contaminant_gi|135017|sp|P07518|SUBT_BAC | 3 | 4 | 9.1% | 275 | 27656 | 6.8 | SUBTILISIN (ALKALINE MESENTERICOPEPTIDASE) |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_3.01385.01385.3 | 3.2578 | 0.2822 | 100.0% | 1529.7734 | 1530.6805 | 2 | 6.201 | 44.6% | 2 | K.APALHSQGYTGSNVK.V | 3 |
| * | Jamie_alpha_091208_3.01316.01316.2 | 3.2913 | 0.398 | 100.0% | 1532.7722 | 1530.6805 | 1 | 6.622 | 60.7% | 1 | K.APALHSQGYTGSNVK.V | 2 |
| * | Jamie_alpha_091208_8.03157.03157.2 | 2.1418 | 0.0492 | 90.2% | 984.5461 | 985.12823 | 356 | 3.596 | 55.6% | 1 | K.GLINVQAAAQ.- | 2 |
| U | YAL012W | 2 | 2 | 8.9% | 394 | 42542 | 6.5 | CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_11.04431.04431.2 | 2.0931 | 0.1996 | 99.0% | 1207.5953 | 1208.3135 | 13 | 4.314 | 65.0% | 1 | R.EASGVFDDLVR.I | 2 |
| * | Jamie_alpha_091208_37.13343.13343.3 | 3.7437 | 0.1949 | 100.0% | 2633.3823 | 2630.9092 | 20 | 4.665 | 30.4% | 1 | R.ISVGIEDTDDLLEDIKQALKQATN.- | 3 |
| U | YKL152C | 1 | 1 | 8.9% | 247 | 27609 | 8.8 | GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_12.04852.04852.2 | 2.7469 | 0.155 | 99.0% | 2374.152 | 2374.5688 | 3 | 5.045 | 38.1% | 1 | R.SFDVPPPPIDASSPFSQKGDER.Y | 2 |
| U | YGR192C | 2 | 2 | 8.7% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YJR009C | 2 | 2 | 8.7% | 332 | 35847 | 7.0 | TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YJL052W | 2 | 2 | 8.7% | 332 | 35750 | 8.3 | TDH1 SGDID:S000003588, Chr X from 338187-339185, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 1, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_7.02692.02692.2 | 2.8638 | 0.1964 | 100.0% | 1822.9785 | 1821.0131 | 1 | 4.366 | 59.4% | 1 | K.IVSNASCTTNCLAPLAK.V | 2 | |
| Jamie_alpha_091208_6.02395.02395.2 | 2.2788 | 0.1131 | 96.0% | 1238.7446 | 1239.5009 | 10 | 3.484 | 59.1% | 1 | K.AVGKVLPELQGK.L | 2 |
| U | YCL043C | 2 | 2 | 7.9% | 522 | 58227 | 4.5 | PDI1 SGDID:S000000548, Chr III from 50221-48653, reverse complement, Verified ORF, "Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_21.08084.08084.3 | 3.7301 | 0.0848 | 91.7% | 2031.1567 | 2031.4001 | 39 | 4.251 | 33.3% | 1 | K.AIESLVKDFLKGDASPIVK.S | 3 |
| * | Jamie_alpha_091208_17.06690.06690.2 | 4.5994 | 0.394 | 100.0% | 2343.9722 | 2343.33 | 1 | 7.103 | 57.1% | 1 | K.AAEEADADAELADEEDAIHDEL.- | 2 |
| U | YLR407W | 1 | 1 | 7.9% | 229 | 25687 | 8.6 | YLR407W SGDID:S000004399, Chr XII from 932965-933654, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_69.23864.23864.2 | 2.2543 | 0.0699 | 91.8% | 2174.4756 | 2176.536 | 168 | 3.742 | 32.4% | 1 | K.LAQKSKAPFCNAEKIWKR.R | 2 |
| U | YKL096W | 1 | 1 | 7.9% | 239 | 24268 | 4.7 | CWP1 SGDID:S000001579, Chr XI from 260776-261495, Verified ORF, "Cell wall mannoprotein, linked to a beta-1,3- and beta-1,6-glucan heteropolymer through a phosphodiester bond; involved in cell wall organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.04955.04955.2 | 4.2326 | 0.4049 | 100.0% | 2033.9722 | 2032.214 | 1 | 7.934 | 55.6% | 1 | K.SSSGFYAIKDGSSYIFSSK.Q | 2 |
| U | YLR044C | 2 | 2 | 7.8% | 563 | 61495 | 6.2 | PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_10.03949.03949.2 | 4.8712 | 0.4524 | 100.0% | 2000.9692 | 1999.1063 | 1 | 8.992 | 52.8% | 1 | R.WAGNANELNAAYAADGYAR.I | 22 | |
| * | Jamie_alpha_091208_21.07909.07909.2 | 3.5628 | 0.403 | 100.0% | 2742.508 | 2744.2065 | 1 | 7.18 | 39.6% | 1 | R.TTYVTQRPVYLGLPANLVDLNVPAK.L | 2 |
| U | YPR148C | 1 | 1 | 7.8% | 435 | 49279 | 4.8 | YPR148C SGDID:S000006352, Chr XVI from 828136-826829, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_11.04248.04248.3 | 4.846 | 0.3032 | 100.0% | 3865.5842 | 3865.7427 | 1 | 4.82 | 22.7% | 1 | K.TAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIK.V | 3 |
| U | YGR234W | 1 | 1 | 7.8% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_59.20602.20602.2 | 4.3496 | 0.4561 | 100.0% | 3348.703 | 3349.762 | 1 | 8.012 | 31.7% | 1 | K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 2 |
| U | YEL034W | 1 | 1 | 7.6% | 157 | 17114 | 5.0 | HYP2 SGDID:S000000760, Chr V from 85676-86149, Verified ORF, "Translation initiation factor eIF-5A, promotes formation of the first peptide bond; similar to and functionally redundant with Anb1p; undergoes an essential hypusination modification; expressed under aerobic conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_16.06224.06224.2 | 2.4199 | 0.1821 | 98.9% | 1312.7621 | 1313.5828 | 14 | 4.698 | 54.5% | 1 | K.VHLVAIDIFTGK.K | 2 |
| U | YLR134W | 2 | 2 | 7.5% | 563 | 61912 | 6.4 | PDC5 SGDID:S000004124, Chr XII from 410724-412415, Verified ORF, "Minor isoform of pyruvate decarboxylase, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde, regulation is glucose- and ethanol-dependent, repressed by thiamine, involved in amino acid catabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_10.03949.03949.2 | 4.8712 | 0.4524 | 100.0% | 2000.9692 | 1999.1063 | 1 | 8.992 | 52.8% | 1 | R.WAGNANELNAAYAADGYAR.I | 22 | |
| * | Jamie_alpha_091208_39.13948.13948.2 | 2.6389 | 0.3461 | 100.0% | 2325.465 | 2322.6262 | 1 | 5.847 | 34.1% | 1 | A.GSYAEHVGVLHVVGVPSISSQAK.Q | 2 |
| U | YHR203C | 1 | 1 | 7.3% | 261 | 29410 | 10.1 | RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| U | YJR145C | 1 | 1 | 7.3% | 261 | 29410 | 10.1 | RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_16.06325.06325.2 | 2.908 | 0.0064 | 90.0% | 2120.152 | 2117.496 | 2 | 3.147 | 41.7% | 1 | R.LNNVFVIGEQGKPYISLPK.G | 2 |
| U | YER091C | 2 | 2 | 7.2% | 767 | 85860 | 6.5 | MET6 SGDID:S000000893, Chr V from 342163-339860, reverse complement, Verified ORF, "Cobalamin-independent methionine synthase, involved in amino acid biosynthesis; requires a minimum of two glutamates on the methyltetrahydrofolate substrate, similar to bacterial metE homologs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_52.18445.18445.2 | 3.1831 | 0.2738 | 100.0% | 3513.2764 | 3513.9258 | 14 | 5.485 | 23.3% | 1 | K.EAGVDIIPSNDFSFYDQVLDLSLLFNVIPDR.Y | 2 |
| * | Jamie_alpha_091208_59.20664.20664.2 | 2.2537 | 0.1132 | 95.5% | 2742.8657 | 2744.195 | 84 | 3.435 | 26.1% | 1 | K.DSLDLEPLSLLEQLLPLYTEILSK.L | 2 |
| U | YBR127C | 2 | 2 | 7.2% | 517 | 57749 | 5.1 | VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_18.06892.06892.2 | 2.5721 | 0.1622 | 98.1% | 1930.0686 | 1931.2395 | 128 | 3.961 | 35.3% | 1 | R.LNYNTVSGVNGPLVILEK.V | 2 |
| * | Jamie_alpha_091208_20.07616.07616.2 | 3.774 | 0.2831 | 100.0% | 2157.2212 | 2155.3716 | 1 | 5.981 | 50.0% | 1 | K.VFAEDYLDINGSPINPYAR.I | 2 |
| U | YMR131C | 1 | 1 | 7.2% | 511 | 57261 | 4.6 | RRB1 SGDID:S000004738, Chr XIII from 534697-533162, reverse complement, Verified ORF, "Essential nuclear protein involved in early steps of ribosome biogenesis; physically interacts with the ribosomal protein Rpl3p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_12.04666.04666.4 | 4.4676 | 0.2639 | 100.0% | 4287.9365 | 4289.3447 | 1 | 4.507 | 20.8% | 1 | K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNR.L | 4 |
| U | YLR196W | 1 | 1 | 7.1% | 576 | 63803 | 4.6 | PWP1 SGDID:S000004186, Chr XII from 543970-545700, Verified ORF, "Protein with WD-40 repeats involved in rRNA processing; associates with trans-acting ribosome biogenesis factors; similar to beta-transducin superfamily" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_20.07571.07571.3 | 3.0675 | 0.2227 | 100.0% | 4754.1245 | 4756.004 | 108 | 4.018 | 15.6% | 1 | K.YWSAMAGEEIETVTFASENIILCGTDS*GNVYSFDIRNNENR.K | 3 |
| U | YGL031C | 1 | 1 | 7.1% | 155 | 17614 | 11.3 | RPL24A SGDID:S000002999, Chr VII from 437939-437472, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Bp and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
| U | YGR148C | 1 | 1 | 7.1% | 155 | 17547 | 11.4 | RPL24B SGDID:S000003380, Chr VII from 787784-787317, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Ap and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_2.00774.00774.2 | 2.1115 | 0.1216 | 95.3% | 1136.5739 | 1136.2963 | 5 | 4.348 | 65.0% | 1 | K.GAFQKVAATSR.- | 2 |
| U | YDR385W | 3 | 3 | 7.0% | 842 | 93289 | 6.3 | EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| U | YOR133W | 3 | 3 | 7.0% | 842 | 93289 | 6.3 | EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_39.13870.13870.2 | 2.8399 | 0.231 | 100.0% | 2745.4373 | 2745.1543 | 1 | 5.233 | 35.4% | 1 | R.FVEPIDDCPAGNIIGLVGIDQFLLK.T | 2 | |
| Jamie_alpha_091208_7.03044.03044.2 | 2.7915 | 0.2505 | 100.0% | 1973.9521 | 1973.2365 | 95 | 4.819 | 35.3% | 1 | R.GQVVSEEQRPGTPLFTVK.A | 2 | |
| Jamie_alpha_091208_19.07181.07181.2 | 2.7214 | 0.29 | 100.0% | 1799.8866 | 1801.0087 | 8 | 5.54 | 43.3% | 1 | K.AYLPVNESFGFTGELR.Q | 2 |
| U | YOL086C | 1 | 1 | 6.9% | 348 | 36849 | 6.7 | ADH1 SGDID:S000005446, Chr XV from 160593-159547, reverse complement, Verified ORF, "Alcohol dehydrogenase, fermentative isozyme active as homo- or heterotetramers; required for the reduction of acetaldehyde to ethanol, the last step in the glycolytic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_11.04378.04378.2 | 2.8338 | 0.2793 | 100.0% | 2312.1826 | 2313.4863 | 4 | 4.93 | 28.3% | 1 | K.ATDGGAHGVINVSVSEAAIEASTR.Y | 2 |
| U | YPL229W | 1 | 1 | 6.8% | 206 | 23260 | 6.3 | YPL229W SGDID:S000006150, Chr XVI from 117067-117687, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_7.02851.02851.1 | 1.3139 | 0.2507 | 100.0% | 1517.73 | 1516.6049 | 2 | 4.472 | 38.5% | 1 | Q.PISPPLFLVGAGT*S*.E | 1 |
| U | Reverse_YNL053W | 1 | 1 | 6.7% | 489 | 54218 | 7.2 | MSG5 SGDID:S000004998, Chr XIV from 529943-531412, Verified ORF, "Dual-specificity protein phosphatase required for maintenance of a low level of signaling through the cell integrity pathway; regulates and is regulated by Slt2p; also required for adaptive response to pheromone" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_37.13254.13254.3 | 3.1887 | 0.1507 | 93.1% | 3896.7244 | 3896.349 | 199 | 3.976 | 18.0% | 1 | R.MIYAVILSASRS*VGCQCHVLIKKGQS*HATHIIR.T | 3 |
| U | YDR372C | 1 | 1 | 6.7% | 345 | 39287 | 5.1 | VPS74 SGDID:S000002780, Chr IV from 1222139-1221102, reverse complement, Verified ORF, "Non-essential protein of unknown function involved in vacuolar protein sorting; belongs to a family of cytosolic Golgi-associated proteins suggesting that it may play a role in secretion; also detected in the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_52.18420.18420.2 | 2.725 | 0.0703 | 95.6% | 2661.7122 | 2658.9678 | 72 | 3.482 | 27.3% | 1 | K.NDEPLSISNWIDLLSGETWNLLK.I | 2 |
| U | YAL025C | 1 | 1 | 6.5% | 306 | 35694 | 5.3 | MAK16 SGDID:S000000023, Chr I from 101146-100226, reverse complement, Verified ORF, "Essential nuclear protein, constituent of 66S pre-ribosomal particles; required for normal concentration of free 60S ribosomal subunits; required for maintenance of M1 satellite double-stranded RNA of the L-A virus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_12.04735.04735.2 | 3.1056 | 0.1068 | 98.2% | 2403.0642 | 2403.4749 | 35 | 3.395 | 34.2% | 1 | K.VEIEYEEEHEVQNAEQEVAQ.- | 2 |
| U | YPL124W | 2 | 3 | 6.3% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_7.02960.02960.2 | 4.4747 | 0.3115 | 100.0% | 1925.8889 | 1923.9855 | 1 | 6.154 | 66.7% | 2 | R.SSQIHIENEST*EDILK.I | 2 |
| * | Jamie_alpha_091208_7.03051.03051.3 | 3.6636 | 0.1399 | 97.8% | 1926.6112 | 1923.9855 | 2 | 4.597 | 43.3% | 1 | R.SSQIHIENES*TEDILK.I | 3 |
| U | Reverse_YNL263C | 1 | 1 | 6.1% | 314 | 35498 | 8.9 | YIF1 SGDID:S000005207, Chr XIV from 147841-146897, reverse complement, Verified ORF, "Integral membrane protein required for the fusion of ER-derived COPII transport vesicles with the Golgi; interacts with Yip1p and Yos1p; localizes to the Golgi, the ER, and COPII vesicles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_8.03404.03404.2 | 2.1147 | 0.1408 | 95.2% | 2205.4722 | 2205.2139 | 38 | 3.821 | 30.6% | 1 | K.KVTS*KSIS*VHIDDDEAGSR.S | 2 |
| U | YNL225C | 2 | 3 | 6.0% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_1.00133.00133.2 | 2.3475 | 0.0463 | 93.7% | 1279.6218 | 1277.3335 | 88 | 3.723 | 60.0% | 2 | K.DKS*PIGTDVHK.K | 2 |
| * | Jamie_alpha_091208_49.17301.17301.2 | 3.0736 | 0.263 | 100.0% | 2776.2798 | 2778.0845 | 8 | 4.821 | 32.6% | 1 | K.AELFEIPIGILFFDLYDSEENSSK.L | 2 |
| U | YGL253W | 1 | 1 | 6.0% | 486 | 53943 | 5.3 | HXK2 SGDID:S000003222, Chr VII from 23935-25395, Verified ORF, "Hexokinase isoenzyme 2 that catalyzes phosphorylation of glucose in the cytosol; predominant hexokinase during growth on glucose; functions in the nucleus to repress expression of HXK1 and GLK1 and to induce expression of its own gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_32.11775.11775.2 | 2.6048 | 0.1514 | 98.2% | 3459.0122 | 3459.6147 | 1 | 5.158 | 25.0% | 1 | R.IEEDPFENLEDTDDLFQNEFGINTTVQER.K | 2 |
| U | YOR221C | 1 | 1 | 5.8% | 360 | 40707 | 6.9 | MCT1 SGDID:S000005747, Chr XV from 757558-756476, reverse complement, Verified ORF, "Predicted malonyl-CoA:ACP transferase, putative component of a type-II mitochondrial fatty acid synthase that produces intermediates for phospholipid remodeling" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_10.04009.04009.2 | 2.2785 | 0.2597 | 91.7% | 2449.1802 | 2447.8115 | 81 | 4.381 | 27.5% | 1 | K.FEMWALSSPRATDLPQEVQKL.L | 2 |
| U | YJR123W | 1 | 1 | 5.8% | 225 | 25039 | 8.6 | RPS5 SGDID:S000003884, Chr X from 651816-652493, Verified ORF, "Protein component of the small (40S) ribosomal subunit, the least basic of the non-acidic ribosomal proteins; phosphorylated in vivo; essential for viability; has similarity to E. coli S7 and rat S5 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05912.05912.2 | 2.2832 | 0.1305 | 96.7% | 1340.8119 | 1340.609 | 1 | 4.147 | 62.5% | 1 | R.VNQAIALLTIGAR.E | 2 |
| U | Reverse_YOR334W | 1 | 1 | 5.7% | 470 | 54203 | 9.4 | MRS2 SGDID:S000005861, Chr XV from 944591-946003, Verified ORF, "Mitochondrial inner membrane Mg(2+) channel, required for maintenance of intramitochondrial Mg(2+) concentrations at the correct level to support splicing of group II introns" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_75.26135.26135.3 | 2.8499 | 0.1484 | 90.8% | 3192.1743 | 3195.439 | 84 | 3.57 | 23.1% | 1 | K.S*ELDY*MLVSLKAAASPNTTDFVYVKDR.E | 3 |
| U | YCL028W | 1 | 1 | 5.7% | 405 | 42580 | 6.6 | RNQ1 SGDID:S000000533, Chr III from 70150-71367, Verified ORF, "[PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_17.06363.06363.2 | 3.6771 | 0.409 | 100.0% | 2506.2122 | 2506.7441 | 1 | 5.567 | 36.4% | 1 | K.LTSAAQSNPNDEQMSTIESLIQK.I | 2 |
| U | YDR074W | 1 | 1 | 5.6% | 896 | 102976 | 8.1 | TPS2 SGDID:S000002481, Chr IV from 593889-596579, Verified ORF, "Phosphatase subunit of the trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_54.18990.18990.4 | 2.9192 | 0.2087 | 100.0% | 5374.9717 | 5371.9683 | 32 | 4.129 | 14.3% | 1 | K.KTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVDLDSRGHVKNS*ESSLK.S | 4 |
| U | YKL054C | 1 | 1 | 5.6% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_7.02750.02750.4 | 5.2871 | 0.204 | 100.0% | 4705.0273 | 4705.733 | 284 | 3.557 | 15.8% | 1 | K.VNEQETSAQEQEEETAEPSEENEDRVPEVDGEEVQEEAEKK.E | 4 |
| U | YHR019C | 1 | 1 | 5.6% | 554 | 62207 | 5.8 | DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_21.08016.08016.4 | 3.5616 | 0.1385 | 92.9% | 3579.644 | 3579.7717 | 45 | 3.772 | 19.4% | 1 | K.DAITWLNEHDIKNEEGEDFKFGDDIAEAAER.K | 4 |
| U | YBL057C | 1 | 1 | 5.6% | 214 | 23128 | 5.4 | PTH2 SGDID:S000000153, Chr II from 113447-112803, reverse complement, Verified ORF, "One of two (see also PTH1) mitochondrially-localized peptidyl-tRNA hydrolases; dispensable for cell growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_9.03659.03659.2 | 2.6364 | 0.088 | 96.7% | 1432.7855 | 1431.6042 | 2 | 4.021 | 59.1% | 1 | K.SSAT*LLRSKEMK.E | 2 |
| U | YOL092W | 1 | 1 | 5.5% | 308 | 34873 | 4.9 | YOL092W SGDID:S000005452, Chr XV from 144203-145129, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_7.02993.02993.2 | 3.0437 | 0.2187 | 100.0% | 1722.8322 | 1720.765 | 1 | 4.573 | 43.8% | 1 | E.EMAAPSSDGNAGDDNLR.E | 2 |
| U | Reverse_YLR167W | 1 | 1 | 5.3% | 152 | 17216 | 9.9 | RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_2.00435.00435.2 | 2.1174 | 0.0485 | 91.7% | 871.5125 | 872.0615 | 80 | 3.103 | 71.4% | 1 | R.KKGGGRLR.L | 2 |
| U | YKL042W | 2 | 2 | 5.2% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_9.03726.03726.2 | 4.3355 | 0.3879 | 100.0% | 2333.8613 | 2334.2546 | 1 | 5.959 | 52.8% | 1 | R.DY*SPSSDACLECSNDLYEK.N | 2 |
| * | Jamie_alpha_091208_7.02856.02856.2 | 3.7032 | 0.3997 | 100.0% | 2334.8723 | 2334.2546 | 1 | 6.384 | 41.7% | 1 | R.DYS*PSSDACLECSNDLYEK.N | 2 |
| U | YLR153C | 2 | 2 | 5.1% | 683 | 75492 | 6.7 | ACS2 SGDID:S000004143, Chr XII from 447576-445525, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform, required for growth on glucose; expressed under anaerobic conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_6.02670.02670.2 | 2.5108 | 0.2202 | 100.0% | 1639.8522 | 1639.8027 | 2 | 4.472 | 50.0% | 1 | R.VGEAEIAKYDTSSLR.V | 2 |
| * | Jamie_alpha_091208_21.07836.07836.2 | 2.4139 | 0.1622 | 98.2% | 2342.141 | 2342.6128 | 21 | 3.998 | 31.6% | 1 | R.VLGSVGEPISPDLWEWYHEK.V | 2 |
| U | Reverse_YOR324C | 1 | 1 | 5.0% | 602 | 67293 | 9.4 | FRT1 SGDID:S000005851, Chr XV from 925035-923227, reverse complement, Verified ORF, "Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_62.21513.21513.2 | 1.7213 | 0.1326 | 93.0% | 3499.5923 | 3501.584 | 7 | 4.537 | 20.7% | 1 | R.NSNFDT*KPS*VRFPDDLSSAGSYSRSHRGVR.N | 2 |
| U | YBR118W | 1 | 1 | 5.0% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| U | YPR080W | 1 | 1 | 5.0% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_7.02922.02922.2 | 2.3804 | 0.065 | 93.7% | 2551.3123 | 2551.793 | 7 | 3.8 | 31.8% | 1 | K.SVEMHHEQLEQGVPGDNVGFNVK.N | 2 |
| U | YML105C | 1 | 1 | 4.8% | 273 | 31170 | 9.1 | SEC65 SGDID:S000004573, Chr XIII from 58687-57866, reverse complement, Verified ORF, "Subunit of the signal recognition particle (SRP), involved in protein targeting to the ER; interacts with Srp54p; homolog of mammalian SRP19" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_6.02602.02602.2 | 2.8154 | 0.1403 | 99.0% | 1456.7517 | 1457.5834 | 160 | 4.207 | 54.2% | 1 | K.ENGQLIGAAT*KFK.G | 2 |
| U | YBR031W | 1 | 1 | 4.7% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| U | YDR012W | 1 | 1 | 4.7% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_10.03886.03886.3 | 3.1934 | 0.3587 | 100.0% | 1846.9777 | 1847.0782 | 1 | 5.378 | 39.1% | 1 | K.VGYTLPSHIISTSDVTR.I | 3 |
| U | YBR079C | 1 | 1 | 4.6% | 964 | 110344 | 6.3 | RPG1 SGDID:S000000283, Chr II from 398271-395377, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_10.03976.03976.4 | 4.4553 | 0.1072 | 96.3% | 5061.217 | 5062.149 | 2 | 4.34 | 17.1% | 1 | K.EVSEEENTEPEVQEEKEETDEALGPQETEDGEEKEEESDPVIIR.N | 4 |
| U | YGR124W | 1 | 1 | 4.5% | 572 | 64593 | 5.9 | ASN2 SGDID:S000003356, Chr VII from 739949-741667, Verified ORF, "Asparagine synthetase, isozyme of Asn1p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_53.18591.18591.2 | 2.122 | 0.1285 | 95.4% | 3271.6743 | 3271.6165 | 49 | 3.388 | 24.0% | 1 | K.ITRYFTPDWLDEKRIPST*PVDYHAIR.H | 2 |
| U | YLR019W | 1 | 1 | 4.5% | 397 | 44772 | 4.8 | PSR2 SGDID:S000004009, Chr XII from 180287-181480, Verified ORF, "Functionally redundant Psr1p homolog, a plasma membrane phosphatase involved in the general stress response; required with Psr1p and Whi2p for full activation of STRE-mediated gene expression, possibly through dephosphorylation of Msn2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_53.18568.18568.2 | 2.0492 | 0.2237 | 98.9% | 2036.9829 | 2035.0667 | 206 | 4.067 | 29.4% | 1 | K.T*MQENGNSGNGKLAPLS*R.D | 2 |
| U | YOL038W | 1 | 1 | 4.3% | 254 | 28439 | 7.4 | PRE6 SGDID:S000005398, Chr XV from 255335-256099, Verified ORF, "20S proteasome alpha-type subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_9.03577.03577.2 | 2.2471 | 0.2495 | 100.0% | 1144.0013 | 1145.3416 | 90 | 4.722 | 65.0% | 1 | R.SLLEVVQTGAK.N | 2 |
| U | YJL138C | 1 | 1 | 4.1% | 395 | 44697 | 5.1 | TIF2 SGDID:S000003674, Chr X from 154609-153422, reverse complement, Verified ORF, "Translation initiation factor eIF4A, identical to Tif1p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" |
| U | YKR059W | 1 | 1 | 4.1% | 395 | 44697 | 5.1 | TIF1 SGDID:S000001767, Chr XI from 554629-555816, Verified ORF, "Translation initiation factor eIF4A, identical to Tif2p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_14.05410.05410.2 | 4.1034 | 0.3235 | 100.0% | 1786.6522 | 1785.9536 | 1 | 7.074 | 56.7% | 1 | R.GVFGYGFEEPSAIQQR.A | 2 |
| U | YGR279C | 1 | 1 | 4.1% | 386 | 40173 | 4.8 | SCW4 SGDID:S000003511, Chr VII from 1049964-1048804, reverse complement, Verified ORF, "Cell wall protein with similarity to glucanases; scw4 scw10 double mutants exhibit defects in mating" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_8.03412.03412.2 | 2.3115 | 0.1506 | 98.3% | 1885.899 | 1887.0656 | 37 | 4.37 | 40.0% | 1 | R.LYGTDCNQVENVFKAK.A | 2 |
| U | Reverse_YIL077C | 1 | 1 | 4.1% | 320 | 36946 | 8.9 | YIL077C SGDID:S000001339, Chr IX from 215950-214988, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_23.08457.08457.2 | 1.9637 | 0.1178 | 94.2% | 1466.7781 | 1464.6272 | 11 | 3.296 | 54.2% | 1 | -.SRNGGYRGSQLLR.Q | 2 |
| U | YJL053W | 1 | 1 | 4.0% | 379 | 42547 | 8.3 | PEP8 SGDID:S000003589, Chr X from 335814-336953, Verified ORF, "Vacuolar protein sorting protein that forms part of the multimeric membrane-associated retromer complex along with Vps35p, Vps29p, Vps17p, and Vps5p; essential for endosome-to-Golgi retrograde protein transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_22.08434.08434.4 | 2.807 | 0.1504 | 93.5% | 1777.4565 | 1773.857 | 13 | 3.822 | 34.5% | 1 | R.KHVDIATRSS*NSSYK.S | 4 |
| U | YBR193C | 1 | 1 | 4.0% | 223 | 25268 | 5.5 | MED8 SGDID:S000000397, Chr II from 609748-609077, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_14.05399.05399.2 | 1.9369 | 0.0998 | 94.2% | 1041.5122 | 1039.2229 | 3 | 3.568 | 68.8% | 1 | R.LAQLTHSLR.R | 2 |
| U | YKL012W | 1 | 1 | 3.9% | 583 | 69065 | 8.9 | PRP40 SGDID:S000001495, Chr XI from 417953-419704, Verified ORF, "U1 snRNP protein involved in splicing, interacts with the branchpoint-binding protein during the formation of the second commitment complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_62.21777.21777.3 | 3.216 | 0.2077 | 100.0% | 2917.75 | 2914.0715 | 76 | 4.018 | 27.3% | 1 | K.EAKDASGRIY*YYNTLTKKST*WEK.P | 3 |
| U | Reverse_YPR055W | 1 | 1 | 3.8% | 1065 | 122224 | 6.8 | SEC8 SGDID:S000006259, Chr XVI from 667673-670870, Verified ORF, "Essential 121kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeting of secretory vesicles to active sites of exocytosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_17.06558.06558.3 | 3.2305 | 0.2084 | 97.8% | 4624.995 | 4622.1294 | 297 | 3.632 | 15.6% | 1 | K.NINNITKLLFGIRNFGENEQNRSPALPAQT*AANEQLMINGK.N | 3 |
| U | YLR303W | 1 | 1 | 3.8% | 444 | 48672 | 6.4 | MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05725.05725.2 | 2.5699 | 0.0942 | 95.4% | 2087.2476 | 2087.2065 | 26 | 3.397 | 37.5% | 1 | R.FVEGDNPEEFEKVFDER.T | 2 |
| U | Reverse_YHR097C | 1 | 1 | 3.8% | 366 | 40663 | 9.9 | YHR097C SGDID:S000001139, Chr VIII from 298612-298488,298363-297388, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_45.16035.16035.2 | 1.9489 | 0.0973 | 91.2% | 1609.017 | 1611.8821 | 11 | 3.446 | 46.2% | 1 | K.DITDVNKPPKVKTR.S | 2 |
| U | YOL094C | 1 | 1 | 3.7% | 323 | 36149 | 9.1 | RFC4 SGDID:S000005454, Chr XV from 142554-141583, reverse complement, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_9.03729.03729.2 | 2.2298 | 0.0501 | 90.3% | 1345.6997 | 1346.656 | 4 | 3.065 | 63.6% | 1 | K.IVDSPHPLIVKK.M | 2 |
| U | contaminant_KERATIN22 | 1 | 1 | 3.6% | 645 | 65865 | 8.0 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_2.00740.00740.2 | 2.3097 | 0.2436 | 100.0% | 1741.7722 | 1742.716 | 1 | 4.869 | 38.6% | 1 | R.GGSGGGGSISGGGYGSGGGSGGR.Y | 2 |
| U | YMR273C | 1 | 1 | 3.5% | 915 | 103358 | 6.4 | ZDS1 SGDID:S000004886, Chr XIII from 813979-811232, reverse complement, Verified ORF, "Protein that interacts with silencing proteins at the telomere, involved in transcriptional silencing; has a role in localization of Bcy1p, a regulatory subunit of protein kinase A; implicated in mRNA nuclear export" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_53.18616.18616.3 | 3.4632 | 0.2917 | 100.0% | 3458.0044 | 3455.6016 | 127 | 4.532 | 20.2% | 1 | K.PHHKHDASSSPSSSPS*SSPSIPNNDAVHVRVR.K | 3 |
| U | YJL158C | 1 | 1 | 3.5% | 227 | 23242 | 4.7 | CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family" |
| U | YKL164C | 1 | 1 | 2.3% | 341 | 34622 | 6.5 | PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" |
| U | YKL163W | 1 | 1 | 2.5% | 325 | 33004 | 5.7 | PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway" |
| U | YJL160C | 1 | 1 | 2.8% | 287 | 30215 | 9.0 | YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YJL159W | 1 | 1 | 2.1% | 387 | 38619 | 5.4 | HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_3.01110.01110.2 | 2.1514 | 0.1942 | 98.9% | 829.49133 | 829.9749 | 1 | 4.384 | 85.7% | 1 | R.IGSIVANR.Q | 2 |
| U | Reverse_YOR322C | 1 | 1 | 3.4% | 818 | 89826 | 8.6 | LDB19 SGDID:S000005849, Chr XV from 921057-918601, reverse complement, Verified ORF, "Protein of unknown function; null mutant shows a reduced affinity for the alcian blue dye suggesting a decreased net negative charge of the cell surface" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05923.05923.4 | 3.4875 | 0.1496 | 96.2% | 2936.5923 | 2931.961 | 183 | 3.656 | 22.8% | 1 | R.AAGTPVSVINS*NSAGNSAKEKNT*SHNSK.N | 4 |
| U | YCR053W | 1 | 1 | 3.3% | 514 | 57474 | 5.6 | THR4 SGDID:S000000649, Chr III from 216692-218236, Verified ORF, "Threonine synthase, conserved protein that catalyzes formation of threonine from 0-phosphohomoserine; expression is regulated by the GCN4-mediated general amino acid control pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_52.18363.18363.2 | 2.6158 | 0.0951 | 96.0% | 2059.4417 | 2060.3599 | 304 | 3.898 | 34.4% | 1 | K.DVALQFVGNLFEYFLQR.T | 2 |
| U | YFL037W | 1 | 1 | 3.3% | 457 | 50923 | 4.7 | TUB2 SGDID:S000001857, Chr VI from 56335-57708, Verified ORF, "Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_12.04576.04576.2 | 2.6893 | 0.1525 | 98.1% | 1599.847 | 1599.7814 | 3 | 3.495 | 60.7% | 1 | R.SINVDLEPGTIDAVR.N | 2 |
| U | YML076C | 1 | 1 | 3.2% | 944 | 107560 | 7.6 | WAR1 SGDID:S000004541, Chr XIII from 115347-112513, reverse complement, Verified ORF, "Homodimeric Zn2Cys6 zinc finger transcription factor; binds to a weak acid response element to induce transcription of PDR12 and FUN34, encoding an acid transporter and a putative ammonia transporter, respectively" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_47.16776.16776.4 | 4.1631 | 0.2467 | 100.0% | 3332.7366 | 3334.3582 | 45 | 4.282 | 20.7% | 1 | K.GPT*DSEESSLKDGTSYLAS*FPSDPNAKQFP.N | 4 |
| U | Reverse_YOR076C | 1 | 1 | 3.2% | 747 | 84779 | 7.8 | SKI7 SGDID:S000005602, Chr XV from 471621-469378, reverse complement, Verified ORF, "Antiviral adaptor protein that mediates interactions via its N-terminus between the exosome and Ski complex (Ski2p, Ski3p, Ski8p) which operate in the 3'-to-5' mRNA-decay pathway; cytoplasmic protein required for degrading nonstop mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_62.21680.21680.3 | 3.1471 | 0.1646 | 96.4% | 2765.6042 | 2765.1423 | 131 | 3.959 | 26.1% | 1 | K.KLASLKLSLSVSHQNPTFDS*RKVK.D | 3 |
| U | Reverse_YNL293W | 1 | 1 | 3.2% | 633 | 72999 | 7.6 | MSB3 SGDID:S000005237, Chr XIV from 80640-82541, Verified ORF, "GTPase-activating protein for Sec4p and several other Rab GTPases, regulates exocytosis via its action on Sec4p, also required for proper actin organization; similar to Msb4p; both Msb3p and Msb4p localize to sites of polarized growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_54.19052.19052.2 | 2.418 | 0.2094 | 98.9% | 2404.0024 | 2406.7654 | 20 | 4.332 | 31.6% | 1 | R.MQKVKEKISNNWHVGALS*KK.F | 2 |
| U | YJR059W | 1 | 1 | 3.1% | 818 | 91400 | 8.9 | PTK2 SGDID:S000003820, Chr X from 545701-548157, Verified ORF, "Putative serine/threonine protein kinase involved in regulation of ion transport across plasma membrane; enhances spermine uptake" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_52.18176.18176.2 | 2.7177 | 0.3127 | 100.0% | 2679.2996 | 2677.8906 | 6 | 5.343 | 31.2% | 1 | N.NPYLNSPSDILGTGTGIASTRDRDR.A | 2 |
| U | Reverse_YLR023C | 1 | 1 | 3.1% | 543 | 62571 | 9.2 | IZH3 SGDID:S000004013, Chr XII from 187128-185497, reverse complement, Verified ORF, "Membrane protein involved in zinc metabolism, member of the four-protein IZH family, expression induced by zinc deficiency; deletion reduces sensitivity to elevated zinc and shortens lag phase, overexpression reduces Zap1p activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_56.19668.19668.3 | 2.8757 | 0.1452 | 91.5% | 2389.1274 | 2387.4495 | 421 | 3.697 | 32.8% | 1 | K.SHT*NYFRY*GHIIYRNER.W | 3 |
| U | Reverse_YDR306C | 1 | 1 | 3.1% | 478 | 54437 | 8.6 | YDR306C SGDID:S000002714, Chr IV from 1075165-1073729, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_72.24826.24826.2 | 2.6712 | 0.0965 | 95.9% | 1762.1548 | 1759.7876 | 2 | 3.317 | 50.0% | 1 | K.SALGLSGS*CELYLT*K.L | 2 |
| U | YPL217C | 1 | 1 | 3.0% | 1183 | 135571 | 6.8 | BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_10.04074.04074.3 | 3.635 | 0.152 | 98.1% | 4092.8594 | 4090.0945 | 51 | 3.613 | 19.1% | 1 | R.IYGKPVQEEDADIDNLPSDEEPY*TNDDDVQDSEPR.M | 3 |
| U | YDR395W | 1 | 1 | 3.0% | 944 | 108405 | 4.7 | SXM1 SGDID:S000002803, Chr IV from 1263314-1266148, Verified ORF, "Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_60.21141.21141.2 | 2.7707 | 0.2486 | 100.0% | 3148.0693 | 3145.4468 | 1 | 4.611 | 29.6% | 1 | R.DYIDSVIEELFPIVEGIASNIGSQTDYR.S | 2 |
| U | YKR010C | 1 | 1 | 2.9% | 771 | 86366 | 8.0 | TOF2 SGDID:S000001718, Chr XI from 460882-458567, reverse complement, Verified ORF, "Nonessential mitochondrial protein of unknown function with sequence similarity to Net1p; identified as a topoisomerase I (Top1p) binding protein; displays synthetic genetic interactions with TOP1 and HPR1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.05093.05093.4 | 3.167 | 0.1439 | 93.8% | 2737.2874 | 2732.9236 | 28 | 3.423 | 27.8% | 1 | R.FKPT*GETKVQKRNSITEPY*YGK.F | 4 |
| U | YBL099W | 1 | 1 | 2.9% | 545 | 58618 | 9.0 | ATP1 SGDID:S000000195, Chr II from 37050-38687, Verified ORF, "Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05953.05953.2 | 2.792 | 0.1651 | 98.9% | 1566.7723 | 1564.8253 | 12 | 3.918 | 43.3% | 1 | R.TGNIVDVPVGPGLLGR.V | 2 |
| U | YGR162W | 1 | 1 | 2.8% | 952 | 107101 | 6.0 | TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_58.20332.20332.3 | 3.8607 | 0.2099 | 100.0% | 2847.5225 | 2848.2231 | 1 | 4.768 | 26.9% | 1 | R.TGQATLEGSQLLDSLFGILDNIIQTAK.I | 3 |
| U | YGL008C | 1 | 1 | 2.8% | 918 | 99619 | 5.1 | PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" |
| U | YPL036W | 1 | 1 | 2.7% | 947 | 102172 | 5.0 | PMA2 SGDID:S000005957, Chr XVI from 482841-485684, Verified ORF, "Plasma membrane H+-ATPase, isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_9.03442.03442.3 | 4.147 | 0.2744 | 100.0% | 3022.4307 | 3022.2114 | 1 | 4.863 | 28.0% | 1 | K.TVEEDHPIPEDVHENYENKVAELASR.G | 3 |
| U | YDL206W | 1 | 1 | 2.8% | 762 | 85983 | 6.2 | YDL206W SGDID:S000002365, Chr IV from 90177-92465, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_25.09472.09472.2 | 2.7102 | 0.3327 | 100.0% | 2405.112 | 2406.5254 | 66 | 5.089 | 27.5% | 1 | Y.VRPLGDTQIDEDNAISLDPT*R.L | 2 |
| U | Reverse_YDR365C | 1 | 1 | 2.7% | 628 | 72410 | 5.3 | ESF1 SGDID:S000002773, Chr IV from 1206373-1204487, reverse complement, Verified ORF, "Nucleolar protein involved in pre-rRNA processing; depletion causes severely decreased 18S rRNA levels" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_14.05363.05363.2 | 1.9083 | 0.1223 | 93.6% | 2006.0322 | 2004.1328 | 41 | 3.266 | 37.5% | 1 | K.GGKPVFS*SFTIMLDES*K.V | 2 |
| U | YBL054W | 1 | 1 | 2.7% | 525 | 59226 | 9.3 | YBL054W SGDID:S000000150, Chr II from 117592-119169, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_23.08553.08553.2 | 2.2104 | 0.1152 | 95.5% | 1781.195 | 1779.9255 | 191 | 4.062 | 42.3% | 1 | R.RAS*LVVS*PYMSPRR.L | 2 |
| U | contaminant_SPA1_STAAU | 1 | 1 | 2.7% | 524 | 57320 | 5.7 | owl|P02976| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| U | contaminant_SPA2_STAAU | 1 | 1 | 2.8% | 508 | 55439 | 5.7 | owl|P38507| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_6.02648.02648.2 | 3.6525 | 0.3244 | 100.0% | 1460.7109 | 1459.5529 | 1 | 6.323 | 80.8% | 1 | K.DDPSQSANLLAEAK.K | 2 |
| U | YMR205C | 1 | 1 | 2.6% | 959 | 104618 | 6.7 | PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_16.05967.05967.2 | 1.7208 | 0.1268 | 91.2% | 2966.912 | 2967.1104 | 15 | 3.635 | 27.1% | 1 | -.MT*VT*TPFVNGTSYCTVTAYSVQSYK.A | 2 |
| U | YCR084C | 1 | 1 | 2.5% | 713 | 78308 | 5.7 | TUP1 SGDID:S000000680, Chr III from 262448-260307, reverse complement, Verified ORF, "General repressor of transcription, forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_10.03851.03851.2 | 3.1524 | 0.2731 | 100.0% | 1997.9321 | 1998.1107 | 1 | 5.782 | 44.1% | 1 | K.DVENLNTSSSPSSDLYIR.S | 2 |
| U | Reverse_YLR072W | 2 | 2 | 2.5% | 693 | 78212 | 6.2 | YLR072W SGDID:S000004062, Chr XII from 278863-280944, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_11.04349.04349.2 | 2.7698 | 0.1484 | 98.1% | 1824.9885 | 1826.0135 | 154 | 3.779 | 40.6% | 1 | R.PSGFS*TVSPLPKLTDAK.E | 2 |
| * | Jamie_alpha_091208_11.04407.04407.2 | 3.0421 | 0.0894 | 97.4% | 1827.9934 | 1826.0135 | 17 | 3.445 | 50.0% | 1 | R.PSGFST*VSPLPKLTDAK.E | 2 |
| U | Reverse_YGL003C | 1 | 1 | 2.5% | 566 | 62822 | 8.6 | CDH1 SGDID:S000002971, Chr VII from 494178-492478, reverse complement, Verified ORF, "Cell-cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C), which directs ubiquitination of mitotic cyclins resulting in exit from mitosis; targets the APC/C to specific substrates including CDC20, ASE1 and CIN8" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_3.01047.01047.4 | 3.2718 | 0.1273 | 92.6% | 1794.9043 | 1794.882 | 164 | 3.752 | 34.6% | 1 | R.RGKRQQYT*LLS*AGR.V | 4 |
| U | YMR307W | 1 | 1 | 2.5% | 559 | 59582 | 4.7 | GAS1 SGDID:S000004924, Chr XIII from 887002-888681, Verified ORF, "Beta-1.3-glucanosyltransferase, required for cell wall assembly; localizes to the cell surface via a glycosylphosphatidylinositol (GPI) anchor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_23.08753.08753.2 | 2.1364 | 0.1655 | 98.3% | 1703.5294 | 1701.8297 | 251 | 4.144 | 42.3% | 1 | R.DDPTWTVDLFNSYK.T | 2 |
| U | YOR086C | 1 | 1 | 2.4% | 1186 | 133576 | 7.2 | TCB1 SGDID:S000005612, Chr XV from 486780-483220, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_58.20295.20295.2 | 2.5619 | 0.2132 | 100.0% | 3374.791 | 3373.781 | 1 | 5.592 | 28.6% | 1 | R.DTLNPVWDETLYVLLNSFTDPLTISVYDK.R | 2 |
| U | YIL166C | 1 | 1 | 2.4% | 542 | 61898 | 8.9 | YIL166C SGDID:S000001428, Chr IX from 32566-30938, reverse complement, Uncharacterized ORF, "Hypothetical protein, member of the Dal5p subfamily of the major facilitator family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_15.05909.05909.1 | 1.2155 | 0.2726 | 100.0% | 1721.58 | 1721.8241 | 6 | 4.042 | 33.3% | 1 | M.AVATKFYY*IS*RNK.Y | 1 |
| U | YBR148W | 1 | 1 | 2.3% | 609 | 70175 | 7.1 | YSW1 SGDID:S000000352, Chr II from 537870-539699, Verified ORF, "Protein expressed specifically in spores" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_51.17876.17876.2 | 2.0952 | 0.074 | 90.1% | 1736.9521 | 1735.851 | 269 | 3.466 | 38.5% | 1 | R.NSIFKS*ANDVKEFR.N | 2 |
| U | YHR102W | 1 | 1 | 2.2% | 1080 | 117061 | 8.0 | KIC1 SGDID:S000001144, Chr VIII from 316575-319817, Verified ORF, "Protein kinase of the PAK/Ste20 kinase family, required for cell integrity possibly through regulating 1,6-beta-glucan levels in the wall; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_58.20435.20435.3 | 3.1371 | 0.1352 | 91.9% | 2905.3765 | 2902.1738 | 68 | 3.471 | 23.9% | 1 | R.YYGSYLKDTSLWIIMEHCAGGS*LR.S | 3 |
| U | YDR356W | 2 | 2 | 2.2% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.05185.05185.3 | 5.1941 | 0.4327 | 100.0% | 2431.3076 | 2429.7332 | 4 | 7.696 | 37.5% | 1 | K.TVKDQVLELENNSDVQSLKLR.S | 3 |
| * | Jamie_alpha_091208_10.03880.03880.2 | 4.1032 | 0.3129 | 100.0% | 1833.8922 | 1831.9744 | 1 | 5.95 | 66.7% | 1 | K.DQVLELENNSDVQSLK.L | 2 |
| U | YOR373W | 1 | 1 | 2.2% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_6.02640.02640.2 | 3.8206 | 0.2871 | 100.0% | 2289.9172 | 2290.2268 | 1 | 6.046 | 47.2% | 1 | K.IQEEENLANSDDT*PLDT*PK.F | 2 |
| U | Reverse_YGR266W | 1 | 1 | 2.1% | 701 | 81191 | 6.9 | YGR266W SGDID:S000003498, Chr VII from 1022662-1024767, Verified ORF, "Protein of unknown function;predicted to contain a single transmembrane domain; localized to both the mitochondrion and the plasma membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_22.08222.08222.2 | 2.4508 | 0.26 | 90.9% | 1765.8121 | 1766.963 | 73 | 4.403 | 39.3% | 1 | R.GVTLFNETKMFSDNY.S | 2 |
| U | YMR186W | 1 | 1 | 2.0% | 705 | 80900 | 4.8 | HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" |
| U | YPL240C | 1 | 1 | 2.0% | 709 | 81406 | 4.9 | HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_6.02467.02467.2 | 3.2806 | 0.1893 | 100.0% | 1739.7612 | 1740.7748 | 1 | 4.761 | 69.2% | 1 | K.DFELEETDEEKAER.E | 2 |
| U | YNL287W | 1 | 1 | 1.9% | 935 | 104831 | 5.1 | SEC21 SGDID:S000005231, Chr XIV from 91994-94801, Verified ORF, "Gamma subunit of coatomer, a heptameric protein complex that together with Arf1p forms the COPI coat; involved in ER to Golgi transport of selective cargo" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_20.07656.07656.2 | 2.1598 | 0.089 | 93.6% | 2199.6653 | 2202.3396 | 256 | 3.476 | 32.4% | 1 | K.FESVQLETAKLIT*SFAT*R.N | 2 |
| U | YDL126C | 1 | 1 | 1.9% | 835 | 91996 | 4.9 | CDC48 SGDID:S000002284, Chr IV from 238664-236157, reverse complement, Verified ORF, "ATPase in ER, nuclear membrane and cytosol with homology to mammalian p97; in a complex with Npl4p and Ufd1p participates in retrotranslocation of ubiquitinated proteins from the ER into the cytosol for degradation by the proteasome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_21.07929.07929.2 | 2.3321 | 0.19 | 99.0% | 1741.8823 | 1739.9689 | 132 | 3.945 | 40.0% | 1 | K.ATQGFSGADLLYIVQR.A | 2 |
| U | YDR443C | 1 | 1 | 1.7% | 1420 | 160000 | 5.8 | SSN2 SGDID:S000002851, Chr IV from 1349928-1345666, reverse complement, Verified ORF, "Protein required for stable association of Srb10p-Srb11p kinase with RNA polymerase holoenzyme; subunit of the RNA polymerase II mediator complex; essential for transcriptional regulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_52.18434.18434.2 | 1.8792 | 0.1126 | 92.4% | 2773.4207 | 2774.832 | 33 | 3.027 | 26.1% | 1 | K.VNNSVS*KTGSVDTLHNKEGT*LEQR.E | 2 |
| U | YLR067C | 1 | 1 | 1.7% | 965 | 112646 | 9.3 | PET309 SGDID:S000004057, Chr XII from 270711-267814, reverse complement, Verified ORF, "Specific translational activator for the COX1 mRNA, also influences stability of intron-containing COX1 primary transcripts; located in the mitochondrial inner membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_12.04571.04571.2 | 3.3578 | 0.0598 | 96.7% | 1771.853 | 1770.9774 | 132 | 3.172 | 46.7% | 1 | R.IENIENLPSSTTPNIK.L | 2 |
| U | YDR176W | 1 | 1 | 1.7% | 702 | 79282 | 5.1 | NGG1 SGDID:S000002583, Chr IV from 814447-816555, Verified ORF, "Transcriptional regulator involved in glucose repression of Gal4p-regulated genes; component of transcriptional adaptor and histone acetyltransferase complexes, the ADA complex, the SAGA complex, and the SLIK complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_47.16772.16772.2 | 2.0436 | 0.0982 | 94.3% | 1546.1129 | 1545.5162 | 51 | 3.244 | 50.0% | 1 | K.Y*NVAS*YPTNDLK.D | 2 |
| U | Reverse_YPL137C | 1 | 1 | 1.6% | 1276 | 140891 | 7.4 | YPL137C SGDID:S000006058, Chr XVI from 296646-292816, reverse complement, Uncharacterized ORF, "Glc7-interacting protein whose overexpression relocalizes Glc7p from the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_44.15804.15804.2 | 2.2045 | 0.0779 | 92.4% | 2064.652 | 2063.146 | 99 | 3.866 | 34.2% | 1 | K.GKGVS*SS*ATANIASSALRPK.S | 2 |
| U | YGL086W | 1 | 1 | 1.6% | 749 | 87651 | 5.4 | MAD1 SGDID:S000003054, Chr VII from 347122-349371, Verified ORF, "Coiled-coil protein involved in the spindle-assembly checkpoint; phosphorylated by Mps1p upon checkpoint activation which leads to inhibition of the activity of the anaphase promoting complex; forms a complex with Mad2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_10.03847.03847.2 | 2.1122 | 0.0982 | 94.9% | 1484.7128 | 1487.6067 | 146 | 3.331 | 50.0% | 1 | K.YLIADLNENT*LK.S | 2 |
| U | YAR009C | 1 | 1 | 1.4% | 1196 | 136732 | 8.6 | YAR009C SGDID:S000000067, Chr I from 164188-160598, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YML045W | 1 | 1 | 1.0% | 1755 | 198524 | 8.2 | YML045W SGDID:S000004508, Chr XIII from 184461-185765,185767-189729, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YML039W | 1 | 1 | 1.0% | 1755 | 198571 | 8.1 | YML039W SGDID:S000004503, Chr XIII from 196628-197932,197934-201896, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YLR227W-B | 1 | 1 | 1.0% | 1755 | 198404 | 7.9 | YLR227W-B SGDID:S000007376, Chr XII from 593440-594744,594746-598708, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YLR157C-B | 1 | 1 | 1.0% | 1755 | 198544 | 8.1 | YLR157C-B SGDID:S000007374, Chr XII from 481602-480298,480296-476334, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YLR035C-A | 1 | 1 | 1.5% | 1155 | 131617 | 8.7 | YLR035C-A SGDID:S000007225, Chr XII from 218908-215441, reverse complement, transposable_element_gene, "Ty ORF" |
| U | YJR029W | 1 | 1 | 1.0% | 1755 | 198616 | 8.3 | YJR029W SGDID:S000003790, Chr X from 478258-479558,479560-483526, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YJR027W | 1 | 1 | 1.0% | 1755 | 198651 | 8.0 | YJR027W SGDID:S000003788, Chr X from 472674-473975,473977-477942, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YHR214C-B | 1 | 1 | 0.9% | 1793 | 202816 | 8.3 | YHR214C-B SGDID:S000003534, Chr VIII from 549346-547931,547929-543964, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YGR161C-D | 1 | 1 | 1.0% | 1755 | 198558 | 8.5 | YGR161C-D SGDID:S000007368, Chr VII from 823020-821716,821714-817752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YGR038C-B | 1 | 1 | 1.0% | 1755 | 198520 | 8.2 | YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YGR027W-B | 1 | 1 | 1.0% | 1755 | 198656 | 8.2 | YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YER160C | 1 | 1 | 1.0% | 1755 | 198568 | 8.5 | YER160C SGDID:S000000962, Chr V from 498119-496818,496816-492851, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YER138C | 1 | 1 | 1.0% | 1755 | 198561 | 8.1 | YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR365W-B | 1 | 1 | 1.0% | 1755 | 198658 | 8.0 | YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR316W-B | 1 | 1 | 1.0% | 1755 | 198526 | 8.2 | YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR261C-D | 1 | 1 | 1.1% | 1604 | 181660 | 7.5 | YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR210C-D | 1 | 1 | 1.0% | 1755 | 198838 | 8.4 | YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR098C-B | 1 | 1 | 1.0% | 1755 | 198594 | 8.4 | YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YBR012W-B | 1 | 1 | 1.0% | 1756 | 198868 | 8.5 | YBR012W-B SGDID:S000002155, Chr II from 259867-261171,261173-265138, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YBL005W-B | 1 | 1 | 1.0% | 1755 | 198968 | 8.2 | YBL005W-B SGDID:S000002147, Chr II from 221333-222637,222639-226601, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_alpha_091208_53.18606.18606.2 | 3.8069 | 0.3577 | 100.0% | 1981.3674 | 1982.3275 | 2 | 6.451 | 46.9% | 1 | R.REDSILDVFTTILAFIK.N | 2 |
| U | YGL207W | 1 | 1 | 1.4% | 1035 | 118630 | 5.1 | SPT16 SGDID:S000003175, Chr VII from 98973-102080, Verified ORF, "Subunit of the heterodimeric FACT complex (Spt16p-Pob3p), facilitates RNA Polymerase II transcription elongation through nucleosomes by destabilizing and then reassembling nucleosome structure" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_17.06352.06352.2 | 2.5287 | 0.2278 | 100.0% | 1686.6322 | 1684.9304 | 45 | 4.576 | 46.4% | 1 | K.ALADVVQQDKLIENK.T | 2 |
| U | YGL120C | 1 | 1 | 1.3% | 767 | 87562 | 6.4 | PRP43 SGDID:S000003088, Chr VII from 283943-281640, reverse complement, Verified ORF, "RNA helicase in the DEAH-box family, involved in release of the lariat-intron from the spliceosome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.04952.04952.2 | 1.957 | 0.1168 | 94.9% | 1205.6322 | 1203.2511 | 63 | 3.547 | 61.1% | 1 | K.LGEEVGYS*IR.F | 2 |
| U | Reverse_YPR018W | 1 | 1 | 1.3% | 606 | 70210 | 6.7 | RLF2 SGDID:S000006222, Chr XVI from 594473-596293, Verified ORF, "Largest subunit (p90) of the Chromatin Assembly Complex (CAF-I) with Cac2p and Msi1p that assembles newly synthesized histones onto recently replicated DNA; involved in the maintenance of transcriptionally silent chromatin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_1.00019.00019.2 | 2.0494 | 0.0528 | 90.5% | 1029.6504 | 1029.2308 | 17 | 3.425 | 71.4% | 1 | K.QKKLEARR.Q | 2 |
| U | YDR150W | 1 | 1 | 0.4% | 2748 | 313032 | 5.4 | NUM1 SGDID:S000002557, Chr IV from 755623-763869, Verified ORF, "Protein required for nuclear migration, localizes to the mother cell cortex and the bud tip; may mediate interactions of dynein and cytoplasmic microtubules with the cell cortex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_60.21102.21102.2 | 1.8524 | 0.0945 | 90.1% | 1537.738 | 1536.5618 | 2 | 3.023 | 54.5% | 1 | K.RLSAS*RRSVST*R.S | 2 |
| U | YKR054C | 1 | 1 | 0.2% | 4092 | 471351 | 6.3 | DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_alpha_091208_13.05070.05070.2 | 1.9446 | 0.1682 | 98.2% | 1109.5339 | 1108.2085 | 3 | 4.102 | 75.0% | 1 | K.ESLY*GSMLK.A | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 10063 | 46767 | 51529 |
| Filtered | 135 | 275 | 291 |
| Forward matches | 112 | 251 | 267 |
| Decoy matches | 23 | 24 | 24 |
| Forward FP rate | 20.54% | 9.56% | 8.99% |