| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.05 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 9 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| true | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YIL002W-A | 8 | 8 | 79.7% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01278.01278.2 | 3.0438 | 0.4431 | 100.0% | 1190.8121 | 1191.237 | 1 | 7.88 | 72.7% | 1 | R.DTPEDVSTAGAK.D | 2 |
| * | 08312006.01282.01282.1 | 2.2445 | 0.3343 | 100.0% | 1191.45 | 1191.237 | 2 | 6.707 | 45.5% | 1 | R.DTPEDVSTAGAK.D | 1 |
| * | 08312006.04104.04104.3 | 2.5866 | 0.2841 | 100.0% | 2328.2944 | 2328.622 | 1 | 5.177 | 34.5% | 1 | R.DTPEDVSTAGAKDILDVLNLLK.G | 3 |
| * | 08312006.04092.04092.2 | 4.5461 | 0.5021 | 100.0% | 2328.7922 | 2328.622 | 1 | 9.051 | 40.5% | 1 | R.DTPEDVSTAGAKDILDVLNLLK.G | 2 |
| * | 08312006.03946.03946.2 | 3.5856 | 0.3306 | 100.0% | 1156.2722 | 1156.4081 | 2 | 7.088 | 77.8% | 1 | K.DILDVLNLLK.G | 2 |
| * | 08312006.03948.03948.1 | 3.3118 | 0.3593 | 100.0% | 1157.71 | 1156.4081 | 1 | 6.697 | 72.2% | 1 | K.DILDVLNLLK.G | 1 |
| * | 08312006.02335.02335.2 | 3.1414 | 0.3665 | 100.0% | 1564.9922 | 1563.8036 | 1 | 5.895 | 58.3% | 1 | K.ISEVELKLDEMEK.K | 2 |
| * | 08312006.02928.02928.3 | 3.2744 | 0.3498 | 100.0% | 2341.7944 | 2340.6135 | 1 | 6.158 | 31.6% | 1 | K.MDSLLVQLEDLHRDNNDLAK.S | 3 |
| U | YBR109C | 3 | 4 | 55.1% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03063.03063.3 | 5.3458 | 0.479 | 100.0% | 2602.9143 | 2603.8633 | 1 | 8.723 | 31.5% | 1 | K.EAFALFDKDNNGSISSSELATVMR.S | 3 |
| * | 08312006.04306.04306.3 | 4.9941 | 0.4949 | 100.0% | 4110.474 | 4109.526 | 1 | 6.668 | 23.6% | 2 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
| * | 08312006.03518.03518.2 | 5.4312 | 0.6187 | 100.0% | 2107.632 | 2107.325 | 1 | 11.144 | 52.6% | 1 | R.EVSDGSGEINIQQFAALLSK.- | 2 |
| U | YKL042W | 14 | 15 | 46.0% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02802.02802.2 | 4.0157 | 0.4633 | 100.0% | 2607.4722 | 2608.7546 | 1 | 7.718 | 50.0% | 1 | R.LYDDYYNIPYQYSNPT*PMNR.D | 2 |
| * | 08312006.01202.01202.1 | 1.6637 | 0.2134 | 100.0% | 925.43 | 925.93036 | 15 | 4.618 | 64.3% | 1 | R.DYNDVGSR.I | 1 |
| * | 08312006.02439.02439.2 | 3.9558 | 0.3677 | 100.0% | 2597.7922 | 2598.7546 | 1 | 6.917 | 42.9% | 1 | K.VKDPMVDDDPVS*ENYDQINVPK.H | 2 |
| * | 08312006.02442.02442.3 | 3.5477 | 0.3094 | 100.0% | 2598.6243 | 2598.7546 | 1 | 5.672 | 34.5% | 1 | K.VKDPMVDDDPVS*ENYDQINVPK.H | 3 |
| * | 08312006.03162.03162.3 | 4.0244 | 0.3706 | 100.0% | 2845.5544 | 2846.058 | 1 | 6.206 | 25.0% | 1 | R.SEDGNNDRMS*PLPSPLNTILPINNR.L | 3 |
| * | 08312006.03367.03367.3 | 3.7286 | 0.3729 | 100.0% | 2925.5645 | 2926.058 | 1 | 5.87 | 26.0% | 1 | R.SEDGNNDRMS*PLPS*PLNTILPINNR.L | 3 |
| * | 08312006.02644.02644.2 | 3.7914 | 0.443 | 100.0% | 1958.1322 | 1958.1624 | 1 | 7.965 | 50.0% | 1 | K.VNPSDDDIMMYESAELK.R | 2 |
| * | 08312006.01892.01892.2 | 3.0533 | 0.1857 | 98.5% | 1275.7122 | 1274.4136 | 1 | 5.188 | 77.8% | 1 | K.RVEEEIEELK.R | 2 |
| * | 08312006.03438.03438.3 | 4.696 | 0.4771 | 100.0% | 3063.2043 | 3064.4097 | 1 | 7.262 | 27.9% | 1 | K.LSLNNQLQELQSMMDGDDNIKLDNVSK.H | 3 |
| * | 08312006.02158.02158.2 | 4.4024 | 0.6429 | 100.0% | 2255.0723 | 2254.2546 | 1 | 10.727 | 55.6% | 1 | R.DYSPSSDACLECSNDLYEK.N | 2 |
| * | 08312006.01880.01880.2 | 2.5977 | 0.3831 | 100.0% | 2227.9521 | 2228.355 | 1 | 5.543 | 41.7% | 1 | R.VKPENNMSETFATPT*PNNR.- | 2 |
| * | 08312006.01831.01831.2 | 2.7319 | 0.2745 | 97.0% | 2228.372 | 2228.355 | 1 | 5.07 | 44.4% | 2 | R.VKPENNMSETFAT*PTPNNR.- | 2 |
| * | 08312006.01795.01795.3 | 4.1287 | 0.4226 | 100.0% | 2230.1042 | 2228.355 | 1 | 6.198 | 36.1% | 1 | R.VKPENNMSETFAT*PTPNNR.- | 3 |
| * | 08312006.01842.01842.2 | 2.8391 | 0.2192 | 95.0% | 2307.9922 | 2308.355 | 1 | 5.384 | 38.9% | 1 | R.VKPENNMS*ETFATPT*PNNR.- | 2 |
| U | contaminant_SPA1_STAAU | 18 | 25 | 31.1% | 524 | 57320 | 5.7 | owl|P02976| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03242.03242.3 | 3.1723 | 0.1819 | 100.0% | 3514.0444 | 3513.7795 | 1 | 4.524 | 21.6% | 2 | K.ADAQQNNFNKDQQSAFYEILNMPNLNEAQR.N | 3 |
| * | 08312006.03392.03392.2 | 2.9335 | 0.4456 | 100.0% | 2382.0522 | 2382.6099 | 1 | 6.835 | 42.1% | 1 | K.DQQSAFYEILNMPNLNEAQR.N | 2 |
| 08312006.02612.02612.2 | 4.1759 | 0.4416 | 100.0% | 2349.172 | 2349.5596 | 1 | 6.823 | 45.2% | 2 | R.NGFIQSLKDDPSQSTNVLGEAK.K | 2 | |
| 08312006.02614.02614.3 | 2.8454 | 0.1447 | 100.0% | 2350.4944 | 2349.5596 | 1 | 4.056 | 34.5% | 1 | R.NGFIQSLKDDPSQSTNVLGEAK.K | 3 | |
| 08312006.01694.01694.2 | 4.1838 | 0.5628 | 100.0% | 1460.2922 | 1461.5254 | 1 | 9.848 | 73.1% | 2 | K.DDPSQSTNVLGEAK.K | 2 | |
| 08312006.03262.03262.3 | 5.0974 | 0.3424 | 100.0% | 3285.7444 | 3285.5286 | 1 | 6.884 | 32.7% | 1 | K.ADNNFNKEQQNAFYEILNMPNLNEEQR.N | 3 | |
| 08312006.03318.03318.3 | 4.1999 | 0.3224 | 100.0% | 2481.1443 | 2481.699 | 1 | 6.293 | 38.2% | 1 | K.EQQNAFYEILNMPNLNEEQR.N | 3 | |
| 08312006.03312.03312.2 | 4.1212 | 0.4949 | 100.0% | 2481.392 | 2481.699 | 1 | 9.143 | 52.6% | 1 | K.EQQNAFYEILNMPNLNEEQR.N | 2 | |
| * | 08312006.02670.02670.2 | 3.5743 | 0.5046 | 100.0% | 2363.152 | 2363.5864 | 1 | 7.484 | 40.5% | 2 | R.NGFIQSLKDDPSQSANLLSEAK.K | 2 |
| * | 08312006.02828.02828.3 | 4.4973 | 0.4626 | 100.0% | 2364.1743 | 2363.5864 | 1 | 6.702 | 28.6% | 2 | R.NGFIQSLKDDPSQSANLLSEAK.K | 3 |
| * | 08312006.01978.01978.2 | 3.9423 | 0.4727 | 100.0% | 1475.4122 | 1475.5522 | 1 | 9.359 | 76.9% | 1 | K.DDPSQSANLLSEAK.K | 2 |
| 08312006.03284.03284.3 | 3.2964 | 0.4167 | 100.0% | 2485.8843 | 2486.7031 | 1 | 6.124 | 30.3% | 1 | K.EQQNAFYEILHLPNLNEEQR.N | 3 | |
| 08312006.03286.03286.2 | 3.4099 | 0.333 | 100.0% | 2487.2122 | 2486.7031 | 1 | 6.162 | 42.1% | 1 | K.EQQNAFYEILHLPNLNEEQR.N | 2 | |
| 08312006.02866.02866.2 | 3.554 | 0.3693 | 100.0% | 2347.632 | 2347.5872 | 1 | 6.345 | 45.2% | 2 | R.NGFIQSLKDDPSQSANLLAEAK.K | 2 | |
| 08312006.02715.02715.3 | 4.695 | 0.2368 | 100.0% | 2348.0344 | 2347.5872 | 1 | 6.855 | 41.7% | 2 | R.NGFIQSLKDDPSQSANLLAEAK.K | 3 | |
| 08312006.02026.02026.2 | 4.0318 | 0.5305 | 100.0% | 1458.9722 | 1459.5529 | 1 | 9.672 | 76.9% | 1 | K.DDPSQSANLLAEAK.K | 2 | |
| 08312006.03360.03360.2 | 3.408 | 0.3659 | 100.0% | 2473.5923 | 2473.7043 | 1 | 6.655 | 36.8% | 1 | K.EQQNAFYEILHLPNLTEEQR.N | 2 | |
| 08312006.03354.03354.3 | 2.7746 | 0.2621 | 100.0% | 2476.3743 | 2473.7043 | 1 | 4.885 | 27.6% | 1 | K.EQQNAFYEILHLPNLTEEQR.N | 3 |
| U | YNL225C | 9 | 10 | 23.4% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02662.02662.3 | 4.3243 | 0.3526 | 100.0% | 3296.6042 | 3297.4758 | 4 | 6.636 | 22.3% | 2 | R.LDSPVS*ENGEIKDGEPIPQNWLNENHVGK.S | 3 |
| * | 08312006.02742.02742.3 | 3.9193 | 0.3663 | 100.0% | 3376.0745 | 3377.4758 | 2 | 6.126 | 23.2% | 1 | R.LDS*PVS*ENGEIKDGEPIPQNWLNENHVGK.S | 3 |
| * | 08312006.01878.01878.2 | 3.0429 | 0.4441 | 100.0% | 2246.4922 | 2246.2983 | 1 | 6.483 | 38.2% | 1 | R.DSYEENKS*PSMDQMNYAR.N | 2 |
| * | 08312006.01510.01510.2 | 2.5998 | 0.3535 | 100.0% | 1814.3922 | 1814.8632 | 1 | 6.767 | 57.1% | 1 | R.NTSYQES*PGLQERPK.N | 2 |
| * | 08312006.01174.01174.2 | 2.2855 | 0.2758 | 97.2% | 1276.6322 | 1277.3335 | 41 | 4.586 | 50.0% | 1 | K.DKS*PIGTDVHK.K | 2 |
| * | 08312006.02054.02054.2 | 2.0883 | 0.3061 | 97.1% | 1363.0721 | 1363.4294 | 1 | 5.183 | 65.0% | 1 | K.DVPNFIHST*PR.E | 2 |
| * | 08312006.01832.01832.3 | 4.4041 | 0.47 | 100.0% | 2967.5044 | 2966.9226 | 1 | 6.488 | 30.8% | 1 | R.ANEQASAQPTDEHTSPDIS*IEDCNGAK.I | 3 |
| * | 08312006.04506.04506.3 | 6.6609 | 0.622 | 100.0% | 2907.2344 | 2906.2585 | 1 | 10.536 | 36.5% | 1 | R.KAELFEIPIGILFFDLYDSEENSSK.L | 3 |
| * | 08312006.04658.04658.2 | 4.6888 | 0.6253 | 100.0% | 2776.132 | 2778.0845 | 1 | 12.346 | 50.0% | 1 | K.AELFEIPIGILFFDLYDSEENSSK.L | 2 |
| U | YOR257W | 3 | 3 | 16.8% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02916.02916.2 | 3.9532 | 0.4846 | 100.0% | 1823.6322 | 1823.9542 | 1 | 8.666 | 67.9% | 1 | K.REILDLIDEYDSEGR.H | 2 |
| * | 08312006.03074.03074.2 | 4.5297 | 0.5585 | 100.0% | 1667.4122 | 1667.7667 | 1 | 8.906 | 65.4% | 1 | R.EILDLIDEYDSEGR.H | 2 |
| * | 08312006.02179.02179.2 | 3.2117 | 0.3712 | 100.0% | 1404.9722 | 1405.5016 | 1 | 7.02 | 72.7% | 1 | K.ELGETLTDEELR.A | 2 |
| U | YIL149C | 26 | 36 | 16.4% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03647.03647.2 | 4.2002 | 0.5261 | 100.0% | 2409.7522 | 2409.7876 | 1 | 8.996 | 47.5% | 1 | K.ISEFLNVPFESLQGVTYPVLR.K | 2 |
| * | 08312006.01958.01958.2 | 3.5522 | 0.486 | 100.0% | 1687.5521 | 1687.804 | 1 | 8.116 | 57.7% | 1 | K.EELNGLKDQLNEER.S | 2 |
| * | 08312006.01570.01570.2 | 4.0373 | 0.4369 | 100.0% | 1447.6721 | 1448.443 | 1 | 7.827 | 75.0% | 1 | R.DQGNDSLNDDLNK.E | 2 |
| * | 08312006.01526.01526.2 | 4.4904 | 0.4726 | 100.0% | 1818.9922 | 1819.8363 | 1 | 8.606 | 63.3% | 4 | R.DQGNDSLNDDLNKENK.L | 2 |
| * | 08312006.02591.02591.2 | 2.8155 | 0.3628 | 100.0% | 2601.2722 | 2601.666 | 22 | 5.386 | 26.2% | 1 | K.NDDNSCRNPEHTDVIDELIDTK.L | 2 |
| * | 08312006.02587.02587.3 | 5.2837 | 0.5835 | 100.0% | 2601.5942 | 2601.666 | 1 | 9.512 | 35.7% | 1 | K.NDDNSCRNPEHTDVIDELIDTK.L | 3 |
| * | 08312006.02587.02587.2 | 2.2227 | 0.2969 | 98.6% | 1734.7322 | 1739.8767 | 1 | 5.218 | 42.9% | 1 | R.NPEHTDVIDELIDTK.L | 3 |
| * | 08312006.04026.04026.3 | 2.97 | 0.2778 | 100.0% | 2144.3943 | 2145.4197 | 2 | 4.74 | 39.1% | 1 | K.FQLQNQLEDFILELEHK.T | 3 |
| * | 08312006.02378.02378.2 | 5.3893 | 0.5158 | 100.0% | 2245.7722 | 2246.4363 | 1 | 10.612 | 63.2% | 2 | K.ILESSNIVNENDSQAIITER.L | 2 |
| * | 08312006.01567.01567.2 | 2.3799 | 0.3124 | 98.6% | 1882.6921 | 1882.9966 | 1 | 6.732 | 43.3% | 1 | K.ESEISHNENKMDFSSK.E | 2 |
| * | 08312006.03722.03722.2 | 5.5297 | 0.497 | 100.0% | 2692.6921 | 2693.9243 | 1 | 9.513 | 50.0% | 5 | K.DANSQIQAYEEIISSNENALIELK.N | 2 |
| * | 08312006.03723.03723.3 | 5.6026 | 0.3433 | 100.0% | 2693.5745 | 2693.9243 | 1 | 6.836 | 33.7% | 2 | K.DANSQIQAYEEIISSNENALIELK.N | 3 |
| * | 08312006.01378.01378.2 | 3.9878 | 0.5663 | 100.0% | 1221.8121 | 1222.2604 | 1 | 9.201 | 80.0% | 1 | K.DAADCQAELTK.T | 2 |
| * | 08312006.01130.01130.2 | 3.0995 | 0.3769 | 100.0% | 1613.5122 | 1613.6812 | 1 | 7.671 | 53.6% | 1 | K.VDDTAANNGDKDHLK.L | 2 |
| * | 08312006.02168.02168.2 | 2.6602 | 0.1842 | 98.6% | 1530.2922 | 1529.7114 | 1 | 5.512 | 72.7% | 1 | K.ILVYESEMEQCK.Q | 2 |
| * | 08312006.01966.01966.3 | 3.0812 | 0.1492 | 100.0% | 1587.9844 | 1587.7294 | 65 | 4.268 | 37.5% | 1 | K.DKLEQDLHFENAK.V | 3 |
| * | 08312006.01962.01962.2 | 4.8263 | 0.387 | 100.0% | 1590.8922 | 1587.7294 | 1 | 7.885 | 58.3% | 2 | K.DKLEQDLHFENAK.V | 2 |
| * | 08312006.02138.02138.2 | 4.7705 | 0.5486 | 100.0% | 1735.2122 | 1735.7582 | 1 | 9.539 | 73.3% | 1 | K.GSGEDAEEELWNSPSK.G | 2 |
| * | 08312006.02150.02150.2 | 4.3785 | 0.4627 | 100.0% | 1814.7122 | 1815.7582 | 2 | 8.259 | 66.7% | 1 | K.GSGEDAEEELWNSPS*K.G | 2 |
| * | 08312006.02194.02194.2 | 3.7811 | 0.4499 | 100.0% | 1815.5721 | 1815.7582 | 1 | 7.099 | 53.3% | 1 | K.GSGEDAEEELWNS*PSK.G | 2 |
| * | 08312006.02607.02607.3 | 4.2403 | 0.3694 | 100.0% | 3470.9944 | 3472.5767 | 1 | 6.027 | 25.8% | 1 | K.GSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N | 3 |
| * | 08312006.02703.02703.3 | 3.2649 | 0.3302 | 100.0% | 3475.4944 | 3472.5767 | 1 | 4.432 | 21.0% | 1 | K.GSGEDAEEELWNSPS*KGNSERPSAVAGFINQK.N | 3 |
| * | 08312006.01882.01882.2 | 4.3574 | 0.5856 | 100.0% | 1686.2522 | 1686.7906 | 1 | 10.361 | 57.1% | 1 | K.NDVSFNDSQSMVTNK.E | 2 |
| * | 08312006.02175.02175.3 | 5.146 | 0.5382 | 100.0% | 2986.5244 | 2987.1382 | 1 | 8.292 | 33.3% | 1 | K.NDVSFNDSQSMVTNKENNIVDSSAAGNK.A | 3 |
| * | 08312006.01339.01339.2 | 2.472 | 0.3124 | 98.6% | 1319.7922 | 1319.3708 | 4 | 6.12 | 62.5% | 1 | K.ENNIVDSSAAGNK.A | 2 |
| * | 08312006.01082.01082.2 | 2.5214 | 0.3041 | 96.9% | 1698.6322 | 1698.741 | 23 | 5.19 | 42.9% | 1 | K.RPIESGTSS*DPDTKK.V | 2 |
| U | YPL124W | 4 | 8 | 16.2% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01346.01346.2 | 2.2469 | 0.2557 | 97.4% | 1217.2122 | 1217.2377 | 1 | 5.127 | 87.5% | 1 | K.KFQDDT*LNR.V | 2 |
| * | 08312006.01723.01723.2 | 3.4635 | 0.298 | 100.0% | 1906.3722 | 1905.9298 | 1 | 5.832 | 50.0% | 1 | K.LREENFSSNT*SELGNK.K | 2 |
| * | 08312006.02206.02206.2 | 4.3106 | 0.4677 | 100.0% | 1923.7322 | 1923.9855 | 1 | 8.365 | 63.3% | 5 | R.SSQIHIENEST*EDILK.I | 2 |
| * | 08312006.02134.02134.3 | 4.7146 | 0.5164 | 100.0% | 1923.8644 | 1923.9855 | 1 | 7.705 | 50.0% | 1 | R.SSQIHIENEST*EDILK.I | 3 |
| U | YDR356W | 14 | 17 | 15.4% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01710.01710.2 | 2.3958 | 0.3627 | 100.0% | 1203.3722 | 1203.162 | 1 | 6.474 | 77.8% | 1 | R.S*IDDTIDSTR.L | 2 |
| * | 08312006.02979.02979.2 | 3.2391 | 0.4192 | 100.0% | 1940.4122 | 1941.0148 | 1 | 5.933 | 63.3% | 1 | R.LFSEASQFDDS*FPEIK.A | 2 |
| * | 08312006.01286.01286.2 | 2.0552 | 0.3293 | 96.4% | 931.5722 | 931.981 | 6 | 5.743 | 50.0% | 3 | K.ANIPPS*PR.S | 2 |
| * | 08312006.02379.02379.2 | 4.6325 | 0.4422 | 100.0% | 2401.1921 | 2400.4688 | 1 | 8.64 | 52.6% | 1 | K.EKNDTLNNYDTLEEETDDLK.N | 2 |
| * | 08312006.02522.02522.2 | 4.5437 | 0.5893 | 100.0% | 2142.3323 | 2143.1792 | 1 | 9.8 | 58.8% | 1 | K.NDTLNNYDTLEEETDDLK.N | 2 |
| * | 08312006.02415.02415.2 | 3.8766 | 0.5835 | 100.0% | 2411.7322 | 2413.4705 | 1 | 9.618 | 42.1% | 1 | K.NDTLNNYDTLEEETDDLKNR.L | 2 |
| * | 08312006.02418.02418.3 | 3.5783 | 0.3389 | 100.0% | 2412.4443 | 2413.4705 | 1 | 6.143 | 35.5% | 1 | K.NDTLNNYDTLEEETDDLKNR.L | 3 |
| * | 08312006.02346.02346.2 | 5.4879 | 0.5878 | 100.0% | 1831.3522 | 1831.9744 | 1 | 11.141 | 73.3% | 2 | K.DQVLELENNSDVQSLK.L | 2 |
| * | 08312006.01614.01614.2 | 3.2758 | 0.2818 | 100.0% | 1205.9922 | 1206.2921 | 1 | 6.273 | 83.3% | 1 | K.DSEDKIEELK.I | 2 |
| * | 08312006.02994.02994.2 | 5.5709 | 0.4882 | 100.0% | 2350.5723 | 2351.5786 | 1 | 9.419 | 57.9% | 1 | K.SEQSNIQHDLNLQILNLENK.L | 2 |
| * | 08312006.01330.01330.2 | 3.3778 | 0.3401 | 100.0% | 1589.1522 | 1589.6592 | 1 | 7.303 | 62.5% | 1 | R.EKEELNENSNNIR.I | 2 |
| * | 08312006.01334.01334.3 | 2.6713 | 0.2498 | 100.0% | 1589.6643 | 1589.6592 | 11 | 4.277 | 35.4% | 1 | R.EKEELNENSNNIR.I | 3 |
| * | 08312006.02763.02763.2 | 3.6607 | 0.4648 | 100.0% | 1696.9321 | 1696.8113 | 1 | 7.769 | 57.7% | 1 | K.NYLSEITSLQEENR.R | 2 |
| * | 08312006.03075.03075.2 | 4.711 | 0.5972 | 100.0% | 1920.4122 | 1921.0858 | 1 | 10.386 | 70.0% | 1 | K.DNDSTMQLNDIISYYK.L | 2 |
| U | YOR373W | 13 | 15 | 14.6% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01968.01968.2 | 2.2053 | 0.3403 | 96.7% | 2101.1921 | 2100.1655 | 15 | 5.61 | 30.6% | 1 | K.VPSGFSGTTATS*HQEAQWK.Q | 2 |
| * | 08312006.03375.03375.3 | 3.5934 | 0.4393 | 100.0% | 3634.0444 | 3633.9507 | 1 | 5.851 | 21.4% | 1 | K.QYFPGIGS*GGGTNFGGAVGTANKVPESDLIVSDLVK.D | 3 |
| * | 08312006.01306.01306.2 | 5.017 | 0.4941 | 100.0% | 2171.3323 | 2172.152 | 1 | 8.994 | 61.1% | 3 | K.NNNNNNNNNNNNSININNK.D | 2 |
| * | 08312006.01314.01314.3 | 3.9879 | 0.3812 | 100.0% | 2172.1143 | 2172.152 | 1 | 6.812 | 40.3% | 1 | K.NNNNNNNNNNNNSININNK.D | 3 |
| * | 08312006.01290.01290.3 | 3.9957 | 0.3066 | 100.0% | 2627.8145 | 2628.6106 | 1 | 5.699 | 33.0% | 1 | K.NNNNNNNNNNNNSININNKDNAR.T | 3 |
| * | 08312006.01896.01896.2 | 3.5537 | 0.4718 | 100.0% | 2337.2722 | 2338.401 | 1 | 6.96 | 39.5% | 1 | K.KIQEEENLANSDDT*PLDTPK.F | 2 |
| * | 08312006.02046.02046.2 | 6.0849 | 0.6108 | 100.0% | 2129.4922 | 2130.2268 | 1 | 10.882 | 66.7% | 1 | K.IQEEENLANSDDTPLDTPK.F | 2 |
| * | 08312006.02052.02052.2 | 4.1295 | 0.3313 | 100.0% | 2209.5322 | 2210.2268 | 1 | 8.115 | 50.0% | 1 | K.IQEEENLANSDDTPLDT*PK.F | 2 |
| * | 08312006.02090.02090.2 | 4.0379 | 0.4012 | 100.0% | 2210.632 | 2210.2268 | 1 | 6.971 | 52.8% | 1 | K.IQEEENLANS*DDTPLDTPK.F | 2 |
| * | 08312006.01982.01982.2 | 4.6245 | 0.33 | 100.0% | 2211.3123 | 2210.2268 | 1 | 7.868 | 58.3% | 1 | K.IQEEENLANSDDT*PLDTPK.F | 2 |
| * | 08312006.02955.02955.3 | 4.4004 | 0.3909 | 100.0% | 3075.8342 | 3076.211 | 1 | 5.437 | 30.0% | 1 | K.IQEEENLANSDDTPLDT*PKFNDLFTK.N | 3 |
| * | 08312006.02471.02471.2 | 4.9599 | 0.5511 | 100.0% | 2142.5122 | 2143.2659 | 1 | 10.21 | 58.3% | 1 | R.VEDITSISEVNTSFNETEK.Q | 2 |
| * | 08312006.02458.02458.2 | 3.745 | 0.4366 | 100.0% | 2222.892 | 2223.2659 | 1 | 8.325 | 50.0% | 1 | R.VEDITSISEVNTS*FNETEK.Q | 2 |
| U | YPL255W | 4 | 4 | 14.0% | 385 | 45384 | 6.5 | BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02740.02740.2 | 3.6999 | 0.4814 | 100.0% | 1462.8922 | 1462.5714 | 1 | 7.364 | 70.8% | 1 | K.DALFGTDIS*PSMK.Y | 2 |
| * | 08312006.02230.02230.2 | 2.6208 | 0.3724 | 100.0% | 1540.2922 | 1540.5461 | 1 | 6.218 | 58.3% | 1 | R.SNS*WSGLDSTLHR.K | 2 |
| * | 08312006.01823.01823.2 | 1.882 | 0.362 | 96.3% | 1273.5721 | 1273.4348 | 1 | 5.74 | 55.0% | 1 | R.SLRS*PAPIVPR.E | 2 |
| * | 08312006.03826.03826.2 | 5.3451 | 0.5249 | 100.0% | 2059.372 | 2059.2834 | 1 | 8.877 | 65.6% | 1 | R.DNYESEIHDLLLQLSLR.N | 2 |
| U | YJR053W | 3 | 3 | 10.6% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03190.03190.3 | 4.6334 | 0.4912 | 100.0% | 3179.4844 | 3180.2068 | 1 | 7.049 | 28.0% | 1 | K.QADDDQDMEVDQDDEFLNDFQEFQNK.K | 3 |
| * | 08312006.02300.02300.2 | 2.0528 | 0.3385 | 96.8% | 1848.5521 | 1848.8773 | 8 | 5.461 | 38.5% | 1 | R.DWNTQQELDS*FKEK.R | 2 |
| * | 08312006.02944.02944.2 | 5.1722 | 0.7149 | 100.0% | 2355.3123 | 2356.5146 | 1 | 12.104 | 60.0% | 1 | R.DETIISVDEETIMDESTVNSK.R | 2 |
| U | YFR028C | 3 | 3 | 9.8% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03530.03530.3 | 5.6056 | 0.4052 | 100.0% | 3250.9744 | 3251.5354 | 1 | 7.366 | 29.6% | 1 | K.YEHVEFGDFNVLTPDFIAFASPQEDHPK.G | 3 |
| * | 08312006.01699.01699.3 | 4.9983 | 0.4373 | 100.0% | 2992.4944 | 2991.04 | 1 | 7.163 | 31.0% | 1 | R.KVVIESNNS*DDESMQDTNGTSNHYPK.V | 3 |
| * | 08312006.01778.01778.3 | 3.1114 | 0.3301 | 100.0% | 2861.5444 | 2862.866 | 1 | 5.507 | 29.2% | 1 | K.VVIESNNS*DDESMQDTNGTSNHYPK.V | 3 |
| U | YPL131W | 1 | 1 | 9.4% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.04402.04402.3 | 4.2275 | 0.3177 | 100.0% | 3343.5842 | 3343.602 | 1 | 5.565 | 22.2% | 1 | R.SYIFGGHVSQYMEELADDDEERFSELFK.G | 3 |
| U | YIR017C | 1 | 1 | 9.1% | 187 | 21590 | 10.1 | MET28 SGDID:S000001456, Chr IX from 384116-383553, reverse complement, Verified ORF, "Transcriptional activator in the Cbf1p-Met4p-Met28p complex, participates in the regulation of sulfur metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02047.02047.2 | 2.792 | 0.0748 | 97.5% | 2064.2522 | 2064.324 | 190 | 3.627 | 37.5% | 1 | K.NFENMNKLQNLNTQINK.L | 2 |
| U | contaminant_KERATIN02 | 2 | 2 | 8.7% | 622 | 61987 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03610.03610.3 | 3.7466 | 0.3181 | 100.0% | 2906.3643 | 2904.1597 | 1 | 6.436 | 21.9% | 1 | K.NYSPYYNTIDDLKDQIVDLTVGNNK.T | 3 |
| * | 08312006.03216.03216.3 | 4.2808 | 0.4373 | 100.0% | 3265.3145 | 3266.413 | 1 | 7.627 | 28.6% | 1 | K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E | 3 |
| U | YNL178W | 1 | 1 | 7.1% | 240 | 26503 | 9.4 | RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01854.01854.2 | 3.2958 | 0.3914 | 100.0% | 1904.9521 | 1905.9696 | 1 | 7.985 | 53.1% | 1 | K.DYRPAEETEAQAEPVEA.- | 2 |
| U | YDL229W | 2 | 2 | 6.9% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| U | YNL209W | 2 | 2 | 6.9% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 08312006.03100.03100.2 | 4.1257 | 0.6 | 100.0% | 2160.5322 | 2161.4138 | 1 | 9.624 | 55.6% | 1 | K.VIDVDGNPVIEVQYLEETK.T | 2 | |
| 08312006.03572.03572.2 | 3.4499 | 0.4365 | 100.0% | 2413.7522 | 2412.6562 | 1 | 8.143 | 36.4% | 1 | K.IEAALSDALAALQIEDPSADELR.K | 2 |
| U | YCR015C | 1 | 1 | 6.9% | 317 | 36278 | 7.4 | YCR015C SGDID:S000000608, Chr III from 142167-141214, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02688.02688.2 | 1.9161 | 0.3999 | 100.0% | 2772.872 | 2766.853 | 1 | 5.862 | 26.2% | 1 | K.TIIIS*DFDETITRVDT*ICT*IAK.L | 2 |
| U | YAL005C | 2 | 2 | 6.5% | 642 | 69768 | 5.1 | SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" |
| U | YLL024C | 2 | 2 | 6.6% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 08312006.01667.01667.2 | 3.7467 | 0.4987 | 100.0% | 1676.2522 | 1676.6964 | 1 | 8.413 | 50.0% | 1 | K.ATAGDTHLGGEDFDNR.L | 2 | |
| 08312006.03443.03443.2 | 3.0807 | 0.3051 | 98.5% | 2583.2122 | 2578.7925 | 1 | 6.209 | 26.0% | 1 | R.SINPDEAVAYGAAVQAAILTGDESSK.T | 2 |
| U | YMR131C | 1 | 1 | 6.3% | 511 | 57261 | 4.6 | RRB1 SGDID:S000004738, Chr XIII from 534697-533162, reverse complement, Verified ORF, "Essential nuclear protein involved in early steps of ribosome biogenesis; physically interacts with the ribosomal protein Rpl3p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02639.02639.3 | 3.5821 | 0.305 | 100.0% | 3701.2444 | 3701.7546 | 1 | 4.914 | 20.2% | 1 | K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLR.D | 3 |
| U | YMR024W | 1 | 1 | 6.2% | 390 | 44000 | 9.4 | MRPL3 SGDID:S000004626, Chr XIII from 321874-323046, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03894.03894.2 | 2.4923 | 0.3363 | 96.0% | 2781.2722 | 2780.832 | 1 | 5.458 | 30.4% | 1 | K.SPVFIVHVFSGEETLGEGY*GS*S*LK.E | 2 |
| U | YDR171W | 1 | 1 | 6.1% | 375 | 42817 | 5.1 | HSP42 SGDID:S000002578, Chr IV from 806616-807743, Verified ORF, "Small cytosolic stress-induced chaperone that forms barrel-shaped oligomers and suppresses the aggregation of non-native proteins; oligomer dissociation is not required for function; involved in cytoskeleton reorganization after heat shock" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03088.03088.2 | 4.2448 | 0.5294 | 100.0% | 2670.652 | 2671.828 | 1 | 8.405 | 38.6% | 1 | R.IAIEEIPDEELEFEENPNPTVEN.- | 2 |
| U | YDR432W | 1 | 1 | 5.3% | 414 | 45407 | 5.5 | NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03938.03938.2 | 5.0982 | 0.5533 | 100.0% | 2439.6921 | 2438.6501 | 1 | 9.97 | 50.0% | 1 | R.DFDGTGALEFPSEEILVEALER.L | 2 |
| U | YKL081W | 1 | 1 | 5.1% | 412 | 46520 | 7.8 | TEF4 SGDID:S000001564, Chr XI from 282535-282739,283066-284099, Verified ORF, "Translation elongation factor EF-1 gamma" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03160.03160.2 | 2.1509 | 0.2443 | 97.4% | 2435.5723 | 2437.5806 | 1 | 4.253 | 30.0% | 1 | R.GQDFAPAFDVAPDWESYEYTK.L | 2 |
| U | YKL054C | 2 | 2 | 4.2% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01662.01662.3 | 5.1769 | 0.519 | 100.0% | 3613.7043 | 3614.653 | 1 | 7.957 | 24.2% | 1 | K.NNYNYYQTQNGQEQQSPNQGVAQHSEDSQQK.Q | 3 |
| * | 08312006.01708.01708.3 | 4.4186 | 0.3356 | 100.0% | 3695.6042 | 3694.653 | 1 | 6.483 | 24.2% | 1 | K.NNYNYYQTQNGQEQQS*PNQGVAQHSEDSQQK.Q | 3 |
| U | YOL041C | 1 | 1 | 3.1% | 459 | 51942 | 9.4 | NOP12 SGDID:S000005401, Chr XV from 252644-251265, reverse complement, Verified ORF, "Nucleolar protein, required for pre-25S rRNA processing; contains an RNA recognition motif (RRM) and has similarity to Nop13p, Nsr1p, and putative orthologs in Drosophila and S. pombe" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01248.01248.2 | 2.7255 | 0.0955 | 97.4% | 1448.2322 | 1448.6134 | 72 | 4.835 | 34.6% | 1 | K.TDETSVPLTSAAKK.V | 2 |
| U | YBR235W | 1 | 1 | 2.9% | 1120 | 123998 | 8.5 | YBR235W SGDID:S000000439, Chr II from 686896-690258, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02492.02492.3 | 2.8761 | 0.1326 | 97.2% | 3558.8342 | 3561.1155 | 35 | 3.687 | 19.4% | 1 | K.GDQPAAITTNFDTYTLILQLAAILVTVPEWKR.T | 3 |
| U | Reverse_YPL256C | 1 | 1 | 2.9% | 545 | 61697 | 5.8 | CLN2 SGDID:S000006177, Chr XVI from 66614-64977, reverse complement, Verified ORF, "G1 cyclin involved in regulation of the cell cycle; activates Cdc28p kinase to promote the G1 to S phase transition; late G1 specific expression depends on transcription factor complexes, MBF (Swi6p-Mbp1p) and SBF (Swi6p-Swi4p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02423.02423.2 | 2.6325 | 0.3341 | 95.8% | 1968.1122 | 1967.8687 | 1 | 4.759 | 46.7% | 1 | R.EDVT*ADSDQSLQS*QRK.E | 2 |
| U | YGL075C | 1 | 1 | 2.8% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01310.01310.2 | 3.0261 | 0.4483 | 100.0% | 1182.9521 | 1183.1771 | 1 | 7.53 | 70.0% | 1 | K.NTEGAGIST*PR.K | 2 |
| U | Reverse_YDR484W | 1 | 1 | 2.3% | 641 | 74333 | 5.8 | VPS52 SGDID:S000002892, Chr IV from 1422753-1424678, Verified ORF, "Component of the GARP (Golgi-associated retrograde protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for the recycling of proteins from endosomes to the late Golgi; involved in localization of actin and chitin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01254.01254.2 | 2.0502 | 0.2855 | 97.3% | 1651.6921 | 1652.8163 | 1 | 5.168 | 42.9% | 1 | K.DFDKPALMASNEADK.N | 2 |
| U | YDR251W | 1 | 2 | 2.2% | 830 | 92872 | 8.4 | PAM1 SGDID:S000002659, Chr IV from 960608-963100, Verified ORF, "Essential protein of unknown function; exhibits variable expression during colony morphogenesis; overexpression permits survival without protein phosphatase 2A, inhibits growth, and induces a filamentous phenotype" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01911.01911.2 | 3.1801 | 0.0587 | 97.4% | 2065.9722 | 2064.382 | 2 | 4.026 | 52.9% | 2 | K.MGIAMNNPNFQNEQTILK.H | 2 |
| U | Reverse_YKR031C | 1 | 1 | 1.9% | 1683 | 195203 | 7.6 | SPO14 SGDID:S000001739, Chr XI from 506037-500986, reverse complement, Verified ORF, "Phospholipase D, catalyzes the hydrolysis of phosphatidylcholine, producing choline and phosphatidic acid; involved in Sec14p-independent secretion; required for meiosis and spore formation; differently regulated in secretion and meiosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.02619.02619.3 | 3.1016 | 0.0839 | 97.1% | 3528.2644 | 3519.798 | 1 | 3.054 | 18.5% | 1 | K.ADDIEGSNFNTIKPIIQSLLDDLSGDDLEQNK.L | 3 |
| U | YMR205C | 1 | 1 | 1.0% | 959 | 104618 | 6.7 | PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01847.01847.2 | 2.0287 | 0.3389 | 96.6% | 1305.2722 | 1305.3464 | 1 | 5.182 | 66.7% | 1 | K.VHS*YTDLAYR.M | 2 |
| U | Reverse_YNL139C | 1 | 1 | 0.9% | 1597 | 183930 | 7.7 | RLR1 SGDID:S000005083, Chr XIV from 365719-360926, reverse complement, Verified ORF, "Subunit of the THO complex, which is required for efficient transcription elongation and involved in transcriptional elongation-associated recombination; required for LacZ RNA expression from certain plasmids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.01612.01612.2 | 2.983 | 0.314 | 98.5% | 1703.8522 | 1703.8944 | 7 | 5.284 | 46.2% | 1 | K.VNDWISYFNVFGNK.L | 2 |
| U | YLR454W | 1 | 1 | 0.6% | 2628 | 303478 | 8.0 | YLR454W SGDID:S000004446, Chr XII from 1043995-1051881, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.04988.04988.2 | 1.7787 | 0.3328 | 97.3% | 2278.172 | 2281.41 | 4 | 4.902 | 31.2% | 1 | K.HYLT*RLCNPIY*VQDLSK.H | 2 |
| U | Reverse_YDL140C | 1 | 1 | 0.6% | 1733 | 191610 | 5.6 | RPO21 SGDID:S000002299, Chr IV from 210562-205361, reverse complement, Verified ORF, "RNA polymerase II largest subunit B220, part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.03256.03256.2 | 2.3493 | 0.0939 | 96.2% | 1355.1522 | 1355.592 | 2 | 3.584 | 65.0% | 1 | R.MLENHEDLLLK.G | 2 |
| U | YLR024C | 1 | 1 | 0.4% | 1872 | 216777 | 6.3 | UBR2 SGDID:S000004014, Chr XII from 193282-187664, reverse complement, Verified ORF, "Cytoplasmic ubiquitin-protein ligase (E3)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 08312006.05747.05747.1 | 1.0164 | 0.3569 | 100.0% | 830.31 | 829.9719 | 211 | 4.888 | 33.3% | 1 | K.LPTETIR.N | 1 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 5185 | 7813 | 8980 |
| Filtered | 38 | 151 | 181 |
| Forward matches | 33 | 146 | 176 |
| Decoy matches | 5 | 5 | 5 |
| Forward FP rate | 15.15% | 3.42% | 2.84% |