| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| con | Exclude protein names matching |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YBR109C | 11 | 20 | 48.3% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| U | YOR257W | 8 | 16 | 47.2% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05513.05513.2 | 5.4766 | 0.3126 | 100.0% | 2392.2231 | 2393.6099 | 1 | 5.881 | 50.0% | 5 | R.SSLQSGPLNSELLEEQKQEIY.E | 2 |
| * | 02142006-Holinger-03_itms_7.05272.05272.2 | 3.1378 | 0.3366 | 100.0% | 1487.5945 | 1488.5708 | 1 | 6.481 | 68.2% | 1 | L.FDMNNDGFLDYH.E | 2 |
| * | 02142006-Holinger-03_itms_7.05274.05274.2 | 3.1871 | 0.2848 | 100.0% | 1336.5842 | 1337.388 | 1 | 5.827 | 75.0% | 1 | M.NNDGFLDYHEL.K | 2 |
| * | 02142006-Holinger-04_itms_6.05647.05647.2 | 3.4654 | 0.2133 | 99.4% | 1222.5437 | 1223.2842 | 2 | 5.354 | 83.3% | 2 | N.NDGFLDYHEL.K | 2 |
| * | 02142006-Holinger-04_itms_8.06438.06438.2 | 4.9019 | 0.362 | 100.0% | 1666.79 | 1667.7667 | 1 | 6.859 | 84.6% | 2 | R.EILDLIDEYDSEGR.H | 2 |
| * | 02142006-Holinger-04_itms_7.05793.05793.2 | 4.9484 | 0.3831 | 100.0% | 1537.741 | 1538.6512 | 1 | 6.399 | 87.5% | 3 | E.ILDLIDEYDSEGR.H | 2 |
| * | 02142006-Holinger-03_itms_6.05098.05098.2 | 2.8899 | 0.339 | 100.0% | 1606.7664 | 1607.773 | 1 | 6.013 | 61.5% | 1 | K.ELGETLTDEELRAM.I | 2 |
| * | 02142006-Holinger-03_itms_6.04887.04887.2 | 3.8193 | 0.2946 | 100.0% | 1465.6366 | 1466.498 | 1 | 6.715 | 75.0% | 1 | M.IEEFDLDGDGEIN.E | 2 |
| U | YJR053W | 17 | 37 | 28.2% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| U | YOR373W | 28 | 47 | 23.1% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| U | YKL042W | 8 | 13 | 22.9% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_7.05718.05718.2 | 3.5549 | 0.3009 | 100.0% | 1796.8202 | 1797.9182 | 2 | 6.156 | 73.1% | 3 | K.SSRLYDDYYNIPYQ.Y | 2 |
| * | 02142006-Holinger-03_itms_8.05834.05834.2 | 3.1991 | 0.3353 | 100.0% | 2256.992 | 2258.4634 | 5 | 5.436 | 41.2% | 1 | R.LYDDYYNIPYQYSNPTPM.N | 2 |
| * | 02142006-Holinger-06_itms_8.06178.06178.2 | 5.1191 | 0.414 | 100.0% | 2527.1357 | 2528.7546 | 1 | 7.718 | 52.6% | 3 | R.LYDDYYNIPYQYSNPTPMNR.D | 2 |
| * | 02142006-Holinger-03_itms_5.04527.04527.2 | 5.3281 | 0.4396 | 100.0% | 2078.9302 | 2080.2275 | 1 | 7.332 | 70.6% | 1 | K.VKDPMVDDDPVSENYDQI.N | 2 |
| * | 02142006-Holinger-03_itms_6.04823.04823.2 | 2.833 | 0.2668 | 99.3% | 1728.7916 | 1729.859 | 1 | 5.035 | 66.7% | 1 | R.SEDGNNDRMSPLPSPL.N | 2 |
| * | 02142006-Holinger-03_itms_6.04779.04779.2 | 2.6763 | 0.1045 | 93.7% | 1642.8812 | 1642.7809 | 31 | 4.261 | 42.9% | 1 | S.EDGNNDRMSPLPSPL.N | 2 |
| * | 02142006-Holinger-03_itms_5.04582.04582.2 | 2.4637 | 0.1464 | 99.1% | 1526.6904 | 1527.7474 | 1 | 4.861 | 66.7% | 1 | T.VKVNPSDDDIMMY.E | 2 |
| * | 02142006-Holinger-03_itms_8.05939.05939.2 | 3.5575 | 0.2072 | 99.2% | 1517.7692 | 1518.7252 | 1 | 5.13 | 75.0% | 2 | K.LSLNNQLQELQSM.M | 2 |
| U | YPL079W | 3 | 4 | 19.4% | 160 | 18274 | 10.4 | RPL21B SGDID:S000006000, Chr XVI from 406633-406643,407065-407536, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Ap and has similarity to rat L21 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-04_itms_6.05483.05483.2 | 2.2287 | 0.3342 | 99.4% | 1021.5591 | 1022.1864 | 1 | 5.292 | 81.2% | 1 | I.YKVGDIVDI.K | 2 | |
| 02142006-Holinger-06_itms_6.05425.05425.2 | 3.7288 | 0.3496 | 100.0% | 2171.1504 | 2172.4429 | 1 | 6.359 | 50.0% | 1 | S.RIVSTEGNVPQTLAPVPYET.F | 2 | |
| 02142006-Holinger-02_itms_9.06702.06702.2 | 3.9086 | 0.3673 | 100.0% | 2275.1912 | 2276.5916 | 2 | 7.111 | 47.5% | 2 | R.IVSTEGNVPQTLAPVPYETFI.- | 2 |
| U | YIL149C | 42 | 64 | 17.8% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| U | YDR356W | 22 | 61 | 17.2% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| U | YOR234C | 1 | 1 | 16.8% | 107 | 12168 | 11.1 | RPL33B SGDID:S000005760, Chr XV from 779405-779387,778859-778555, reverse complement, Verified ORF, "Ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Ap and has similarity to rat L35a; rpl33b null mutant exhibits normal growth while rpl33a rpl33b double null mutant is inviable" |
| U | YPL143W | 1 | 1 | 16.8% | 107 | 12154 | 11.1 | RPL33A SGDID:S000006064, Chr XVI from 282121-282139,282665-282969, Verified ORF, "N-terminally acetylated ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Bp and has similarity to rat L35a; rpl33a null mutant exhibits slow growth while rpl33a rpl33b double null mutant is inviable" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_7.05904.05904.2 | 3.159 | 0.2219 | 95.7% | 1893.0516 | 1894.1783 | 3 | 4.403 | 44.1% | 1 | R.VNNPNVSLIKIEGVATPQ.E | 2 |
| U | YPL124W | 8 | 13 | 15.0% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07645.07645.1 | 2.3167 | 0.1488 | 100.0% | 1004.5145 | 1005.1583 | 1 | 5.499 | 68.8% | 3 | R.LPPPPFSSY.G | 1 |
| * | 02142006-Holinger-02_itms_4.03465.03465.2 | 2.3932 | 0.2607 | 98.2% | 1101.5537 | 1102.1893 | 3 | 4.645 | 81.2% | 1 | Q.NVIDDQRLE.I | 2 |
| * | 02142006-Holinger-03_itms_5.04534.04534.2 | 2.7364 | 0.0718 | 98.8% | 1214.6403 | 1215.3489 | 57 | 4.694 | 77.8% | 1 | Q.NVIDDQRLEI.K | 2 |
| * | 02142006-Holinger-05_itms_6.05390.05390.2 | 4.308 | 0.3283 | 100.0% | 1634.8463 | 1635.8143 | 1 | 6.591 | 76.9% | 2 | L.ERIVYDQGTVIDNL.T | 2 |
| * | 02142006-Holinger-04_itms_6.05178.05178.2 | 3.5143 | 0.2612 | 100.0% | 1505.8195 | 1506.6989 | 4 | 5.713 | 62.5% | 3 | E.RIVYDQGTVIDNL.T | 2 |
| * | 02142006-Holinger-04_itms_5.05081.05081.3 | 3.8756 | 0.2046 | 100.0% | 1693.8845 | 1694.8821 | 9 | 5.492 | 42.9% | 1 | R.IVYDQGTVIDNLTSR.I | 3 |
| * | 02142006-Holinger-04_itms_5.05093.05093.2 | 5.1651 | 0.3402 | 100.0% | 1693.891 | 1694.8821 | 1 | 6.626 | 75.0% | 1 | R.IVYDQGTVIDNLTSR.I | 2 |
| * | 02142006-Holinger-06_itms_9.06880.06880.2 | 3.7133 | 0.4179 | 100.0% | 1908.0181 | 1909.1466 | 1 | 7.014 | 59.4% | 1 | R.IVYDQGTVIDNLTSRIT.R | 2 |
| U | YFR028C | 11 | 18 | 14.7% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| U | Reverse_YDR382W | 1 | 1 | 13.6% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_20.13365.13365.2 | 1.616 | 0.2047 | 96.8% | 1103.821 | 1105.1063 | 6 | 4.515 | 46.4% | 1 | A.DGGAAAGAAGAAASS.A | 2 |
| U | YBR118W | 5 | 8 | 12.7% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| U | YPR080W | 5 | 8 | 12.7% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_10.07188.07188.1 | 2.0023 | 0.3149 | 100.0% | 1102.597 | 1103.3062 | 1 | 5.545 | 61.1% | 1 | K.TVPFVPISGW.N | 1 | |
| 02142006-Holinger-03_itms_9.06849.06849.2 | 2.4727 | 0.1116 | 92.1% | 2047.9846 | 2049.3057 | 151 | 4.196 | 33.3% | 1 | K.TVPFVPISGWNGDNMIEAT.T | 2 | |
| 02142006-Holinger-05_itms_9.06646.06646.2 | 4.4068 | 0.3146 | 100.0% | 1555.84 | 1556.7563 | 1 | 5.585 | 80.8% | 3 | K.TLLEAIDAIEQPSR.P | 2 | |
| 02142006-Holinger-06_itms_8.06537.06537.2 | 3.8057 | 0.3578 | 100.0% | 1476.8182 | 1477.8022 | 1 | 6.026 | 73.1% | 2 | R.VETGVIKPGMVVTF.A | 2 | |
| 02142006-Holinger-06_itms_8.06461.06461.2 | 2.3148 | 0.2622 | 98.8% | 1283.645 | 1284.457 | 73 | 4.71 | 55.0% | 1 | E.AFSEYPPLGRF.A | 2 |
| U | YDL229W | 6 | 10 | 12.2% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05936.05936.2 | 3.0091 | 0.2737 | 100.0% | 1493.7684 | 1494.6873 | 1 | 5.738 | 66.7% | 1 | S.FVAFTPEERLIGD.A | 2 |
| 02142006-Holinger-03_itms_5.04600.04600.2 | 2.4769 | 0.1007 | 91.7% | 1396.7723 | 1397.6116 | 2 | 4.182 | 70.8% | 1 | F.KVIDVDGNPVIEV.Q | 2 | |
| 02142006-Holinger-05_itms_6.05447.05447.2 | 3.2414 | 0.3397 | 100.0% | 1564.8168 | 1565.769 | 1 | 5.789 | 69.2% | 2 | K.AVITVPAYFNDAQR.Q | 2 | |
| 02142006-Holinger-04_itms_9.06939.06939.2 | 3.521 | 0.2949 | 100.0% | 1250.5752 | 1251.3379 | 1 | 5.443 | 77.8% | 2 | Q.DFDTNLLEHF.K | 2 | |
| 02142006-Holinger-06_itms_9.06694.06694.2 | 3.1484 | 0.211 | 99.3% | 1602.7339 | 1603.6825 | 1 | 4.888 | 73.1% | 1 | D.SLFDGEDFESSLTR.A | 2 | |
| 02142006-Holinger-04_itms_7.06254.06254.2 | 3.2721 | 0.2426 | 99.4% | 1278.6605 | 1279.4326 | 1 | 5.366 | 85.0% | 3 | K.ENTLLGEFDLK.N | 2 |
| U | YHR021C | 1 | 1 | 12.2% | 82 | 8865 | 9.1 | RPS27B SGDID:S000001063, Chr VIII from 148662-148660,148109-147864, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps27Ap and has similarity to rat S27 ribosomal protein" |
| U | YKL156W | 1 | 1 | 12.2% | 82 | 8879 | 9.1 | RPS27A SGDID:S000001639, Chr XI from 158619-158621,158972-159217, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps27Bp and has similarity to rat S27 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-05_itms_7.05536.05536.2 | 3.3775 | 0.3322 | 100.0% | 1134.6532 | 1135.3489 | 1 | 6.322 | 88.9% | 1 | M.VLVQDLLHPT.A | 2 |
| U | YNL225C | 8 | 19 | 11.9% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05466.05466.2 | 3.9275 | 0.2341 | 100.0% | 1307.7065 | 1308.5786 | 1 | 5.966 | 85.0% | 1 | R.MLENVILGYQK.K | 2 |
| * | 02142006-Holinger-04_itms_6.05496.05496.2 | 5.4217 | 0.2195 | 100.0% | 1529.8469 | 1530.7588 | 1 | 5.877 | 87.5% | 5 | K.IEEQTVLIENLTK.D | 2 |
| * | 02142006-Holinger-02_itms_13.08735.08735.1 | 2.0477 | 0.3032 | 100.0% | 1214.7172 | 1215.4753 | 70 | 5.735 | 55.0% | 1 | K.AELFEIPIGIL.F | 1 |
| * | 02142006-Holinger-03_itms_12.08628.08628.1 | 2.0173 | 0.1995 | 100.0% | 1143.6707 | 1144.3965 | 1 | 5.337 | 66.7% | 1 | A.ELFEIPIGIL.F | 1 |
| * | 02142006-Holinger-03_itms_6.04804.04804.2 | 3.5649 | 0.36 | 100.0% | 1580.6792 | 1581.6324 | 1 | 6.64 | 83.3% | 1 | L.FFDLYDSEENSSK.L | 2 |
| * | 02142006-Holinger-05_itms_7.05978.05978.2 | 5.7109 | 0.3583 | 100.0% | 1693.7788 | 1694.7919 | 1 | 7.255 | 84.6% | 8 | L.FFDLYDSEENSSKL.D | 2 |
| * | 02142006-Holinger-04_itms_5.05001.05001.2 | 2.8787 | 0.1624 | 98.0% | 1146.6151 | 1147.2706 | 69 | 4.599 | 72.2% | 1 | T.NTLSKELDNL.R | 2 |
| * | 02142006-Holinger-04_itms_6.05283.05283.2 | 2.4486 | 0.1969 | 94.1% | 1085.6604 | 1086.317 | 141 | 4.29 | 66.7% | 1 | Q.NTVKEIVLAV.G | 2 |
| U | YLR457C | 3 | 5 | 11.6% | 319 | 37354 | 10.2 | NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_6.05205.05205.2 | 2.889 | 0.2591 | 99.3% | 1226.6193 | 1227.3623 | 1 | 5.003 | 83.3% | 1 | I.FQTIRDVFSN.D | 2 |
| * | 02142006-Holinger-04_itms_6.05634.05634.2 | 4.2864 | 0.3211 | 100.0% | 1552.7906 | 1553.7094 | 1 | 6.802 | 73.1% | 3 | R.ILEDLLDSSNIHPS.Y | 2 |
| * | 02142006-Holinger-03_itms_5.04232.04232.2 | 3.2361 | 0.201 | 98.7% | 1546.7319 | 1547.7258 | 1 | 4.75 | 70.8% | 1 | T.YNRDGNIPEMQPL.Q | 2 |
| U | YDL083C | 2 | 7 | 10.5% | 143 | 15847 | 10.3 | RPS16B SGDID:S000002241, Chr IV from 307789-307766,307333-306926, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Ap and has similarity to E. coli S9 and rat S16 ribosomal proteins" |
| U | YMR143W | 2 | 7 | 10.5% | 143 | 15847 | 10.3 | RPS16A SGDID:S000004751, Chr XIII from 551927-551950,552495-552902, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Bp and has similarity to E. coli S9 and rat S16 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_9.07001.07001.2 | 5.1595 | 0.3665 | 100.0% | 1636.9352 | 1637.917 | 1 | 7.46 | 75.0% | 5 | K.VNGSPITLVEPEILR.F | 2 | |
| 02142006-Holinger-06_itms_9.06856.06856.2 | 2.8585 | 0.2229 | 99.3% | 1423.821 | 1424.6805 | 37 | 4.874 | 54.2% | 2 | N.GSPITLVEPEILR.F | 2 |
| U | YHL015W | 1 | 1 | 9.9% | 121 | 13907 | 9.5 | RPS20 SGDID:S000001007, Chr VIII from 75409-75774, Verified ORF, "Protein component of the small (40S) ribosomal subunit; overproduction suppresses mutations affecting RNA polymerase III-dependent transcription; has similarity to E. coli S10 and rat S20 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05759.05759.2 | 3.1313 | 0.123 | 99.3% | 1387.766 | 1388.647 | 1 | 4.96 | 81.8% | 1 | R.YIDLEAPVQIVK.R | 2 |
| U | YBL003C | 1 | 1 | 9.8% | 132 | 13989 | 10.7 | HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| U | YDR225W | 1 | 1 | 9.8% | 132 | 13989 | 10.7 | HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-05_itms_8.06103.06103.2 | 2.4476 | 0.1743 | 98.0% | 1444.7347 | 1445.5693 | 2 | 4.605 | 62.5% | 1 | R.NDDELNKLLGNVT.I | 2 |
| U | YML078W | 1 | 1 | 9.3% | 182 | 19919 | 8.7 | CPR3 SGDID:S000004543, Chr XIII from 111002-111550, Verified ORF, "Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06909.06909.2 | 2.6416 | 0.1077 | 95.6% | 1760.7507 | 1762.9597 | 61 | 4.36 | 40.6% | 1 | D.LTNGFGGKSIYGSKFAD.E | 2 |
| U | YFR031C-A | 3 | 4 | 8.7% | 254 | 27408 | 11.1 | RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" |
| U | YIL018W | 3 | 4 | 8.7% | 254 | 27408 | 11.1 | RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_9.06772.06772.2 | 3.1606 | 0.2376 | 99.2% | 1936.0818 | 1937.2438 | 28 | 5.07 | 39.5% | 1 | K.ASLNVGNVLPLGSVPEGTIV.S | 2 | |
| 02142006-Holinger-03_itms_9.06388.06388.2 | 3.1382 | 0.329 | 100.0% | 2023.114 | 2024.322 | 14 | 6.252 | 37.5% | 1 | K.ASLNVGNVLPLGSVPEGTIVS.N | 2 | |
| 02142006-Holinger-03_itms_8.06182.06182.2 | 4.22 | 0.2687 | 100.0% | 2137.1592 | 2138.4258 | 1 | 6.109 | 45.2% | 2 | K.ASLNVGNVLPLGSVPEGTIVSN.V | 2 |
| U | YDL130W | 1 | 1 | 8.5% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_10.07428.07428.2 | 2.3113 | 0.0836 | 98.2% | 1020.8487 | 1022.1864 | 3 | 4.631 | 68.8% | 1 | K.DLKEILSGF.H | 2 |
| U | YLL050C | 1 | 1 | 8.4% | 143 | 15901 | 5.2 | COF1 SGDID:S000003973, Chr XII from 40413-40400,40220-39803, reverse complement, Verified ORF, "Cofilin, promotes actin filament depolarization in a pH-dependent manner; binds both actin monomers and filaments and severs filaments , thought to be regulated by phosphorylation at SER4, ubiquitous and essential in eukaryotes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_11.08312.08312.2 | 2.1219 | 0.1612 | 92.2% | 1347.594 | 1345.4984 | 6 | 4.201 | 50.0% | 1 | Y.EINGNEGKRSKI.V | 2 |
| U | YPL255W | 2 | 5 | 8.3% | 385 | 45384 | 6.5 | BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_8.06119.06119.2 | 3.8225 | 0.2721 | 99.2% | 2125.1003 | 2126.3708 | 1 | 5.097 | 50.0% | 2 | L.SNSQIPFIPPQEDDPLLSK.L | 2 |
| * | 02142006-Holinger-03_itms_6.04930.04930.2 | 4.4486 | 0.2676 | 99.2% | 1668.8159 | 1669.8285 | 1 | 5.139 | 79.2% | 3 | R.LYQEEDLKNFEIQ.T | 2 |
| U | YBR031W | 3 | 4 | 8.3% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| U | YDR012W | 3 | 4 | 8.3% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_8.05953.05953.1 | 1.6706 | 0.1698 | 100.0% | 1067.6395 | 1068.2988 | 1 | 5.027 | 61.1% | 1 | K.IPEIPLVVST.D | 1 | |
| 02142006-Holinger-06_itms_10.07865.07865.2 | 3.9085 | 0.423 | 100.0% | 1881.071 | 1882.2047 | 1 | 6.754 | 53.1% | 1 | K.IPEIPLVVSTDLESIQK.T | 2 | |
| 02142006-Holinger-05_itms_5.04900.04900.2 | 2.9103 | 0.3194 | 100.0% | 1374.7281 | 1375.5645 | 20 | 5.75 | 50.0% | 2 | K.VGYTLPSHIISTS.D | 2 |
| U | YHL001W | 1 | 3 | 8.0% | 138 | 15153 | 10.9 | RPL14B SGDID:S000000993, Chr VIII from 104272-104400,104799-105086, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Ap and has similarity to rat L14 ribosomal protein" |
| U | YKL006W | 1 | 3 | 8.0% | 138 | 15167 | 10.9 | RPL14A SGDID:S000001489, Chr XI from 431549-431677,432076-432363, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Bp and has similarity to rat L14 ribosomal protein; rpl14a csh5 double null mutant exhibits synthetic slow growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-04_itms_7.05899.05899.2 | 3.802 | 0.341 | 100.0% | 1212.7244 | 1213.46 | 1 | 5.586 | 80.0% | 3 | K.LAAIVEIIDQK.K | 2 |
| U | YCR031C | 1 | 1 | 8.0% | 137 | 14537 | 10.7 | RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" |
| U | YJL191W | 1 | 1 | 8.0% | 138 | 14650 | 10.5 | RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_5.04419.04419.2 | 2.1679 | 0.1822 | 99.3% | 1237.5865 | 1238.3422 | 47 | 4.913 | 50.0% | 1 | Y.ASFNDTFVHVT.D | 2 |
| U | YNR074C | 2 | 2 | 7.9% | 378 | 41335 | 7.4 | AIF1 SGDID:S000005357, Chr XIV from 778738-777602, reverse complement, Verified ORF, "Mitochondrial cell death effector that translocates to the nucleus in response to apoptotic stimuli, homolog of mammalian Apoptosis-Inducing Factor, putative reductase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_8.06412.06412.2 | 2.5597 | 0.1446 | 98.9% | 2385.1943 | 2384.525 | 267 | 4.784 | 26.1% | 1 | G.TEASLVDADCLETGHAPSGVSLGP.N | 2 |
| * | 02142006-Holinger-03_itms_6.04925.04925.2 | 2.9313 | 0.2112 | 96.0% | 1782.7552 | 1783.8949 | 1 | 4.436 | 50.0% | 1 | L.ETGHAPSGVSLGPNAGFGQ.F | 2 |
| U | YJL190C | 1 | 1 | 7.7% | 130 | 14626 | 9.9 | RPS22A SGDID:S000003726, Chr X from 75301-74909, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| U | YLR367W | 1 | 1 | 7.7% | 130 | 14626 | 9.9 | RPS22B SGDID:S000004359, Chr XII from 856441-856573,857057-857316, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-04_itms_6.05159.05159.2 | 2.4906 | 0.09 | 97.7% | 1027.6162 | 1029.1381 | 112 | 4.553 | 77.8% | 1 | V.LADALNAINN.A | 2 |
| U | YBL002W | 1 | 1 | 7.6% | 131 | 14237 | 10.1 | HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" |
| U | YDR224C | 1 | 1 | 7.6% | 131 | 14252 | 10.1 | HTB1 SGDID:S000002632, Chr IV from 914706-914311, reverse complement, Verified ORF, "One of two nearly identical (see HTB2) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-04_itms_7.05858.05858.2 | 3.063 | 0.3407 | 100.0% | 1240.6011 | 1241.3458 | 1 | 6.471 | 83.3% | 1 | L.NSFVNDIFER.I | 2 |
| U | YER074W | 1 | 1 | 7.4% | 135 | 15329 | 10.5 | RPS24A SGDID:S000000876, Chr V from 306319-306321,306788-307192, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" |
| U | YIL069C | 1 | 1 | 7.4% | 135 | 15329 | 10.5 | RPS24B SGDID:S000001331, Chr IX from 232366-232364,231954-231550, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-05_itms_6.05397.05397.2 | 3.014 | 0.3255 | 100.0% | 1167.62 | 1168.3378 | 4 | 5.707 | 72.2% | 1 | K.QFVVDVLHPN.R | 2 |
| U | YDR072C | 1 | 1 | 7.0% | 527 | 60873 | 7.9 | IPT1 SGDID:S000002479, Chr IV from 591341-589758, reverse complement, Verified ORF, "Inositolphosphotransferase 1, involved in synthesis of mannose-(inositol-P)2-ceramide (M(IP)2C), which is the most abundant sphingolipid in cells, mutation confers resistance to the antifungals syringomycin E and DmAMP1 in some growth media" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_10.07371.07371.3 | 1.9379 | 0.0709 | 100.0% | 4133.219 | 4129.798 | 113 | 5.446 | 13.2% | 1 | V.ILHLTAPILTAVYLYVFQPPGTLKCFS*FALGLQNIAG.V | 3 |
| U | YKL096W | 1 | 1 | 6.7% | 239 | 24268 | 4.7 | CWP1 SGDID:S000001579, Chr XI from 260776-261495, Verified ORF, "Cell wall mannoprotein, linked to a beta-1,3- and beta-1,6-glucan heteropolymer through a phosphodiester bond; involved in cell wall organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06871.06871.2 | 3.0045 | 0.2022 | 92.0% | 1728.8153 | 1729.8834 | 6 | 4.193 | 46.7% | 1 | K.SSSGFYAIKDGSSYIF.S | 2 |
| U | YJL158C | 1 | 1 | 6.6% | 227 | 23242 | 4.7 | CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family" |
| U | YKL164C | 1 | 1 | 4.4% | 341 | 34622 | 6.5 | PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" |
| U | YKL163W | 1 | 1 | 4.6% | 325 | 33004 | 5.7 | PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway" |
| U | YJL160C | 1 | 1 | 5.2% | 287 | 30215 | 9.0 | YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YJL159W | 1 | 1 | 3.9% | 387 | 38619 | 5.4 | HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_7.05293.05293.2 | 2.5504 | 0.1584 | 97.5% | 1635.7869 | 1636.804 | 34 | 4.541 | 46.4% | 1 | R.QFQFDGPPPQAGAIY.A | 2 |
| U | YLR212C | 4 | 12 | 6.3% | 473 | 52628 | 4.7 | TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_9.06967.06967.2 | 4.6817 | 0.3797 | 100.0% | 1809.8417 | 1810.9734 | 1 | 7.871 | 73.3% | 3 | M.MDSEPSVIADVENTFR.G | 2 |
| * | 02142006-Holinger-04_itms_9.06959.06959.2 | 4.6624 | 0.4369 | 100.0% | 1678.8011 | 1679.7808 | 1 | 7.484 | 71.4% | 4 | M.DSEPSVIADVENTFR.G | 2 |
| * | 02142006-Holinger-04_itms_8.06714.06714.2 | 4.6692 | 0.5032 | 100.0% | 1563.7734 | 1564.6921 | 1 | 8.71 | 84.6% | 4 | D.SEPSVIADVENTFR.G | 2 |
| * | 02142006-Holinger-03_itms_6.04707.04707.2 | 3.4098 | 0.2486 | 100.0% | 1632.7421 | 1630.7051 | 1 | 5.439 | 65.4% | 1 | K.IDKEIDSTDNFEGF.Q | 2 |
| U | YPL229W | 1 | 1 | 6.3% | 206 | 23260 | 6.3 | YPL229W SGDID:S000006150, Chr XVI from 117067-117687, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_4.03498.03498.1 | 1.572 | 0.1354 | 100.0% | 1205.6075 | 1206.2695 | 151 | 5.068 | 41.7% | 1 | N.PGSMSSSPPNSAS.S | 1 |
| U | YOR096W | 1 | 1 | 6.3% | 190 | 21622 | 9.8 | RPS7A SGDID:S000005622, Chr XV from 505794-505937,506339-506767, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Bp; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_10.07759.07759.1 | 2.5786 | 0.2242 | 100.0% | 1197.7306 | 1198.4912 | 72 | 5.112 | 54.5% | 1 | K.ALAIFVPVPSLA.G | 1 |
| U | YGL147C | 1 | 1 | 6.3% | 191 | 21569 | 9.7 | RPL9A SGDID:S000003115, Chr VII from 228334-227759, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins" |
| U | YNL067W | 1 | 1 | 6.3% | 191 | 21657 | 9.7 | RPL9B SGDID:S000005011, Chr XIV from 499682-500257, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Ap and has similarity to E. coli L6 and rat L9 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_7.06057.06057.2 | 2.4169 | 0.2103 | 99.3% | 1345.7192 | 1346.526 | 4 | 5.02 | 63.6% | 1 | R.NVPVRDGVTIEF.S | 2 |
| U | YAL047C | 3 | 4 | 6.1% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.07188.07188.2 | 3.9917 | 0.3521 | 100.0% | 2205.057 | 2206.3306 | 1 | 5.398 | 47.5% | 2 | K.DGNAPSLGNDTDFRNSIIEGL.N | 2 |
| * | 02142006-Holinger-06_itms_8.06640.06640.2 | 3.4454 | 0.0934 | 95.4% | 1456.807 | 1457.6671 | 2 | 4.352 | 70.8% | 1 | R.NSIIEGLNLEINK.L | 2 |
| * | 02142006-Holinger-03_itms_6.04879.04879.2 | 3.1773 | 0.1595 | 99.3% | 1268.6519 | 1269.3971 | 1 | 4.949 | 85.0% | 1 | K.LNEQSHLLDSL.E | 2 |
| U | YBR127C | 2 | 2 | 5.4% | 517 | 57749 | 5.1 | VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06892.06892.2 | 3.7052 | 0.1612 | 98.4% | 1930.0721 | 1931.2395 | 2 | 4.674 | 52.9% | 1 | R.LNYNTVSGVNGPLVILEK.V | 2 |
| * | 02142006-Holinger-06_itms_6.05346.05346.2 | 2.6342 | 0.2177 | 95.7% | 1047.5905 | 1048.2273 | 101 | 4.388 | 66.7% | 1 | R.GQKIPIFSAS.G | 2 |
| U | YLR075W | 1 | 1 | 5.0% | 221 | 25361 | 10.0 | RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07818.07818.2 | 3.4056 | 0.3278 | 100.0% | 1246.7216 | 1247.4801 | 1 | 6.051 | 80.0% | 1 | R.VDIGQIIFSVR.T | 2 |
| U | Reverse_YOL010W | 1 | 1 | 4.6% | 367 | 40171 | 8.8 | RCL1 SGDID:S000005370, Chr XV from 307938-309041, Verified ORF, "RNA terminal phosphate cyclase-like protein involved in rRNA processing at sites A0, A1, and A2; does not possess detectable RNA cyclase activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_13.09676.09676.2 | 2.0884 | 0.1742 | 98.0% | 1754.7312 | 1756.0176 | 19 | 4.607 | 37.5% | 1 | V.LHVEGGGLPPSGRKLTH.L | 2 |
| U | Reverse_YDR410C | 1 | 1 | 4.6% | 239 | 27888 | 7.9 | STE14 SGDID:S000002818, Chr IV from 1293081-1292362, reverse complement, Verified ORF, "Farnesyl cysteine-carboxyl methyltransferase, mediates the carboxyl methylation step during C-terminal CAAX motif processing of a-factor and RAS proteins in the endoplasmic reticulum, localizes to the ER membrane " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_19.13198.13198.2 | 1.5416 | 0.0699 | 94.8% | 1275.6882 | 1276.6049 | 233 | 4.316 | 45.0% | 1 | V.FIFIVLSLPNL.L | 2 |
| U | YGR192C | 1 | 1 | 4.5% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YJR009C | 1 | 1 | 4.5% | 332 | 35847 | 7.0 | TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_9.06523.06523.2 | 3.3464 | 0.3311 | 100.0% | 1550.8011 | 1551.8995 | 1 | 5.396 | 64.3% | 1 | K.VVITAPSSTAPMFVM.G | 2 |
| U | Reverse_YHR199C | 1 | 4 | 4.5% | 310 | 34113 | 9.1 | YHR199C SGDID:S000001242, Chr VIII from 498422-497490, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_10.07867.07867.2 | 3.5976 | 0.2047 | 96.3% | 1379.8428 | 1381.7422 | 10 | 4.479 | 69.2% | 4 | F.ISALALGTLVPVVK.S | 2 |
| U | YPR125W | 1 | 1 | 4.4% | 454 | 52175 | 9.3 | YPR125W SGDID:S000006329, Chr XVI from 787957-789321, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05762.05762.2 | 2.1307 | 0.1657 | 95.3% | 2319.0012 | 2317.6042 | 6 | 4.34 | 31.6% | 1 | G.VPESRQQLIEVARLFTDDTV.L | 2 |
| U | YFL039C | 1 | 2 | 4.3% | 375 | 41690 | 5.7 | ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05546.05546.2 | 3.9292 | 0.2553 | 99.3% | 1790.8986 | 1791.9554 | 1 | 4.922 | 70.0% | 2 | K.SYELPDGQVITIGNER.F | 2 |
| U | YDL055C | 1 | 1 | 4.2% | 361 | 39566 | 6.3 | PSA1 SGDID:S000002213, Chr IV from 356759-355674, reverse complement, Verified ORF, "GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase), synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07750.07750.2 | 2.6954 | 0.2045 | 96.5% | 1725.9629 | 1726.0814 | 5 | 4.493 | 50.0% | 1 | Y.ILNPEVIDLIEMKPT.S | 2 |
| U | YLR340W | 1 | 1 | 4.2% | 312 | 33717 | 4.8 | RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.05972.05972.2 | 3.4016 | 0.2477 | 100.0% | 1470.7399 | 1471.6042 | 13 | 5.846 | 62.5% | 1 | S.SILDITDEELVSH.F | 2 |
| U | YIL011W | 1 | 1 | 4.1% | 269 | 26308 | 4.3 | TIR3 SGDID:S000001273, Chr IX from 333724-334533, Verified ORF, "Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins; expressed under anaerobic conditions and required for anaerobic growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_26.15889.15889.2 | 1.2356 | 0.1675 | 94.5% | 955.6212 | 954.9231 | 25 | 4.312 | 50.0% | 1 | S.ATASSDASSAS.E | 2 |
| U | YML092C | 1 | 1 | 4.0% | 250 | 27162 | 5.7 | PRE8 SGDID:S000004557, Chr XIII from 86739-85987, reverse complement, Verified ORF, "20S proteasome beta-type subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_16.10851.10851.2 | 2.0062 | 0.0172 | 90.9% | 1048.6426 | 1048.1815 | 39 | 4.151 | 50.0% | 1 | V.IATEKKSSSP.L | 2 |
| U | YDR502C | 1 | 1 | 3.9% | 384 | 42256 | 5.4 | SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
| U | YLR180W | 1 | 1 | 3.9% | 382 | 41818 | 5.2 | SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_6.05133.05133.2 | 3.1028 | 0.1482 | 99.2% | 1444.7632 | 1445.6182 | 7 | 5.117 | 60.7% | 1 | R.FVIGGPQGDAGLTGR.K | 2 |
| U | YMR055C | 1 | 1 | 3.9% | 306 | 35028 | 8.6 | BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06766.06766.2 | 2.6193 | 0.2127 | 99.2% | 1465.702 | 1466.5902 | 2 | 5.134 | 59.1% | 1 | R.QFPDFDADEIIR.L | 2 |
| U | YDL014W | 1 | 1 | 3.7% | 327 | 34465 | 10.2 | NOP1 SGDID:S000002172, Chr IV from 427361-428344, Verified ORF, "Nucleolar protein, component of the small subunit processome complex, which is required for processing of pre-18S rRNA; has similarity to mammalian fibrillarin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.05957.05957.2 | 3.5241 | 0.3415 | 100.0% | 1216.6627 | 1217.4075 | 1 | 5.757 | 77.3% | 1 | M.GGLDELFIAPGK.K | 2 |
| U | YKL060C | 1 | 2 | 3.6% | 359 | 39621 | 5.8 | FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_8.06634.06634.2 | 3.1677 | 0.371 | 100.0% | 1399.7308 | 1400.5742 | 3 | 6.427 | 58.3% | 2 | K.TGVIVGEDVHNLF.T | 2 |
| U | YML110C | 1 | 1 | 3.6% | 307 | 34685 | 6.6 | COQ5 SGDID:S000004578, Chr XIII from 50954-50031, reverse complement, Verified ORF, "2-hexaprenyl-6-methoxy-1,4-benzoquinone methyltransferase, involved in ubiquinone (Coenzyme Q) biosynthesis; located in mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_8.06539.06539.2 | 2.302 | 0.1443 | 92.8% | 1008.58777 | 1009.06055 | 406 | 4.227 | 60.0% | 1 | I.DVAGGSGDIAF.G | 2 |
| U | Reverse_YBR257W | 1 | 1 | 3.6% | 279 | 32881 | 9.2 | POP4 SGDID:S000000461, Chr II from 728880-729719, Verified ORF, "Subunit of both RNase MRP, which cleaves pre-rRNA, and nuclear RNase P, which cleaves tRNA precursors to generate mature 5' ends; binds to the RPR1 RNA subunit in Rnase P" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_6.04747.04747.2 | 2.6355 | 0.1531 | 92.1% | 1192.615 | 1193.4288 | 14 | 4.197 | 72.2% | 1 | D.TIKNEYALKL.C | 2 |
| U | YOL154W | 1 | 1 | 3.6% | 249 | 27567 | 5.0 | ZPS1 SGDID:S000005514, Chr XV from 34657-35406, Verified ORF, "Putative GPI-anchored protein; transcription is induced under low-zinc conditions, as mediated by the Zap1p transcription factor, and at alkaline pH" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_15.09867.09867.2 | 1.4308 | 0.0695 | 92.9% | 988.50995 | 986.1558 | 433 | 4.238 | 68.8% | 1 | K.FSSGKSIIF.A | 2 |
| U | YNR075W | 1 | 1 | 3.5% | 374 | 43867 | 7.5 | COS10 SGDID:S000005358, Chr XIV from 779916-781040, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_5.05118.05118.2 | 1.0315 | 0.2448 | 99.4% | 1518.7579 | 1517.6595 | 336 | 5.299 | 37.5% | 1 | P.DMSDFFICANLSP.A | 2 |
| U | YAL038W | 1 | 3 | 3.4% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05903.05903.2 | 4.29 | 0.4025 | 100.0% | 1724.9156 | 1725.9365 | 1 | 6.885 | 62.5% | 3 | K.GVNLPGTDVDLPALSEK.D | 2 |
| U | YML085C | 1 | 2 | 3.4% | 447 | 49800 | 5.1 | TUB1 SGDID:S000004550, Chr XIII from 99400-99376,99259-97941, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules" |
| U | YML124C | 1 | 2 | 3.4% | 445 | 49694 | 5.2 | TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_9.06755.06755.2 | 4.3284 | 0.3282 | 100.0% | 1744.9209 | 1745.9701 | 1 | 6.529 | 75.0% | 2 | R.AIYVDLEPNVIDEVR.N | 2 |
| U | YCR012W | 1 | 1 | 3.4% | 416 | 44738 | 7.6 | PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06688.06688.2 | 2.9147 | 0.349 | 100.0% | 1439.8271 | 1440.683 | 1 | 6.092 | 61.5% | 1 | K.ASAPGSVILLENLR.Y | 2 |
| U | YKL218C | 1 | 1 | 3.4% | 326 | 34899 | 7.2 | SRY1 SGDID:S000001701, Chr XI from 18339-17359, reverse complement, Verified ORF, "3-hydroxyaspartate dehydratase, deaminates L-threo-3-hydroxyaspartate to form oxaloacetate and ammonia; required for survival in the presence of hydroxyaspartate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_8.06446.06446.2 | 2.1624 | 0.1216 | 90.8% | 1138.5924 | 1139.3396 | 202 | 4.144 | 55.0% | 1 | Q.LAAEHGFALIP.P | 2 |
| U | YHR172W | 2 | 2 | 3.3% | 823 | 96825 | 6.4 | SPC97 SGDID:S000001215, Chr VIII from 448335-450806, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_5.04787.04787.2 | 2.4953 | 0.1659 | 99.2% | 1132.6415 | 1133.3329 | 85 | 5.135 | 55.6% | 1 | R.YTNNIPLLGK.L | 2 |
| * | 02142006-Holinger-03_itms_6.05060.05060.2 | 4.2184 | 0.3186 | 100.0% | 2090.9326 | 2092.2227 | 2 | 5.451 | 59.4% | 1 | R.YFNDYEPSDPETPIEFK.I | 2 |
| U | YOR360C | 1 | 1 | 3.2% | 526 | 61000 | 6.6 | PDE2 SGDID:S000005887, Chr XV from 1014817-1013237, reverse complement, Verified ORF, "High-affinity cyclic AMP phosphodiesterase, component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_12.08257.08257.2 | 2.3254 | 0.1992 | 99.1% | 1790.9572 | 1793.931 | 1 | 4.84 | 50.0% | 1 | G.INKNSYGTVNGNSVPTQ.A | 2 |
| U | Reverse_YHL021C | 1 | 1 | 3.2% | 465 | 53135 | 7.5 | YHL021C SGDID:S000001013, Chr VIII from 65856-64459, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06705.06705.2 | 2.0425 | 0.2294 | 95.3% | 1621.7864 | 1624.7068 | 102 | 4.34 | 42.9% | 1 | A.YHANVSTAQSANVDF.T | 2 |
| U | Reverse_YDR190C | 1 | 1 | 3.2% | 463 | 50453 | 5.9 | RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_8.06473.06473.2 | 2.3104 | 0.1204 | 94.7% | 1680.8379 | 1678.0281 | 1 | 4.315 | 50.0% | 1 | L.TRVILLRDILDPPVG.H | 2 |
| U | Reverse_YDR014W | 1 | 2 | 3.1% | 647 | 74722 | 5.9 | RAD61 SGDID:S000002421, Chr IV from 474043-475986, Verified ORF, "Protein of unknown function; mutation confers radiation sensitivity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_8.06096.06096.2 | 4.1156 | 0.0908 | 91.7% | 2304.0625 | 2305.7476 | 1 | 4.183 | 42.1% | 2 | H.VEMNTLLILIKILSDDDLMD.K | 2 |
| U | Reverse_YFR051C | 1 | 1 | 3.1% | 546 | 60628 | 5.2 | RET2 SGDID:S000001947, Chr VI from 251790-250150, reverse complement, Verified ORF, "Delta subunit of the coatomer complex (COPI), which coats Golgi-derived transport vesicles; involved in retrograde transport between Golgi and ER" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06736.06736.2 | 2.2896 | 0.2535 | 90.4% | 1646.7799 | 1643.8553 | 210 | 4.13 | 37.5% | 1 | H.GARQSTAMPSAVPAVEA.A | 2 |
| U | Reverse_YJR002W | 1 | 1 | 3.0% | 593 | 66953 | 4.7 | MPP10 SGDID:S000003762, Chr X from 438779-440560, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, interacts with and controls the stability of Imp3p and Imp4p, essential for viability; similar to human Mpp10p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05716.05716.2 | 3.3401 | 0.0941 | 92.9% | 2027.9716 | 2029.004 | 21 | 4.242 | 41.2% | 1 | A.STKEDDMSPEEDNESLSD.N | 2 |
| U | Reverse_YOR313C | 1 | 2 | 3.0% | 338 | 38591 | 9.6 | SPS4 SGDID:S000005840, Chr XV from 902869-901853, reverse complement, Verified ORF, "Protein whose expression is induced during sporulation; not required for sporulation; heterologous expression in E. coli induces the SOS response that senses DNA damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_9.06410.06410.2 | 2.8433 | 0.1848 | 94.3% | 1113.7496 | 1112.4012 | 1 | 4.311 | 72.2% | 2 | T.QALIIRTLAI.K | 2 |
| U | Reverse_YLR114C | 1 | 1 | 2.9% | 764 | 86426 | 4.5 | YLR114C SGDID:S000004104, Chr XII from 377239-374945, reverse complement, Uncharacterized ORF, "Mutation is syntheticly lethal with apl2 vps1 double mutant" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_20.13733.13733.2 | 1.4762 | 0.1504 | 94.1% | 2612.152 | 2614.87 | 40 | 4.31 | 26.2% | 1 | D.YLLTFYTFTEEFSHSGDPLAQF.P | 2 |
| U | YBR158W | 1 | 2 | 2.9% | 549 | 62686 | 9.1 | AMN1 SGDID:S000000362, Chr II from 556543-558192, Verified ORF, "Protein required for daughter cell separation, multiple mitotic checkpoints, and chromosome stability; contains 12 degenerate leucine-rich repeat motifs; expression is induced by the Mitotic Exit Network (MEN)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_6.05213.05213.2 | 3.7088 | 0.1759 | 98.9% | 1827.8562 | 1829.9293 | 2 | 4.8 | 53.3% | 2 | G.FAGCDVDDAGIWEFAR.L | 2 |
| U | Reverse_YPR127W | 1 | 1 | 2.9% | 345 | 38601 | 6.0 | YPR127W SGDID:S000006331, Chr XVI from 790079-791116, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_10.07042.07042.2 | 2.0913 | 0.1189 | 91.2% | 1088.6372 | 1086.19 | 42 | 4.162 | 66.7% | 1 | L.QALTISNNQP.R | 2 |
| U | Reverse_YML041C | 1 | 1 | 2.9% | 280 | 32021 | 9.5 | VPS71 SGDID:S000004505, Chr XIII from 195755-194913, reverse complement, Verified ORF, "Protein of unknown function, component of the Swr1p complex that incorporates Htz1p into chromatin; required for vacuolar protein sorting" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_18.11781.11781.2 | 1.372 | 0.1672 | 95.1% | 898.6111 | 896.90497 | 132 | 4.338 | 57.1% | 1 | N.GCNVCSSI.S | 2 |
| U | YNL126W | 2 | 2 | 2.8% | 846 | 98227 | 7.5 | SPC98 SGDID:S000005070, Chr XIV from 387229-389769, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.06162.06162.2 | 2.4347 | 0.2205 | 98.2% | 1233.6627 | 1234.3977 | 2 | 4.61 | 72.2% | 1 | K.SQNQFDLIRL.N | 2 |
| * | 02142006-Holinger-05_itms_8.06083.06083.2 | 3.3729 | 0.2119 | 99.3% | 1631.7946 | 1632.7673 | 1 | 5.036 | 69.2% | 1 | K.TLNIDELESVHNTF.L | 2 |
| U | Reverse_YJR062C | 1 | 1 | 2.8% | 457 | 51897 | 5.2 | NTA1 SGDID:S000003823, Chr X from 554763-553390, reverse complement, Verified ORF, "Amidase, removes the amide group from N-terminal asparagine and glutamine residues to generate proteins with N-terminal aspartate and glutamate residues that are targets of ubiquitin-mediated degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_11.08396.08396.2 | 2.5056 | 0.0616 | 93.5% | 1550.7805 | 1551.7771 | 2 | 4.256 | 75.0% | 1 | L.FTKELVTDKIVEE.S | 2 |
| U | YHR143W | 1 | 2 | 2.8% | 325 | 33417 | 4.5 | DSE2 SGDID:S000001186, Chr VIII from 385513-386490, Verified ORF, "Daughter cell-specific secreted protein with similarity to glucanases, degrades cell wall from the daughter side causing daughter to separate from mother; expression is repressed by cAMP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_6.05115.05115.2 | 2.2388 | 0.1015 | 95.6% | 876.5237 | 876.98236 | 40 | 4.364 | 62.5% | 2 | T.STLVPSSSV.D | 2 |
| U | YMR001C | 1 | 2 | 2.7% | 705 | 81031 | 9.0 | CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06739.06739.2 | 3.9725 | 0.2952 | 100.0% | 2194.046 | 2194.3594 | 1 | 6.028 | 52.8% | 2 | M.SEAPNFEDIPEEQSLVNFK.D | 2 |
| U | Reverse_YER068W | 1 | 1 | 2.7% | 587 | 65354 | 8.1 | MOT2 SGDID:S000000870, Chr V from 293048-294811, Verified ORF, "Component of the CCR4-NOT transcription regulatory complex, which represses transcription, at least in part, by inhibiting functional TBP-DNA interactions and also aids in transcription elongation; interacts with C-terminal region of Not1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05792.05792.2 | 2.6398 | 0.1312 | 90.8% | 1721.8098 | 1721.821 | 1 | 4.147 | 53.3% | 1 | N.ETTPTTHHGLSDNLTP.L | 2 |
| U | YDR385W | 3 | 3 | 2.6% | 842 | 93289 | 6.3 | EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| U | YOR133W | 3 | 3 | 2.6% | 842 | 93289 | 6.3 | EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-06_itms_9.06912.06912.2 | 2.6739 | 0.1571 | 95.7% | 1210.5927 | 1211.3623 | 2 | 4.383 | 83.3% | 1 | R.LWGDSFFNPK.T | 2 | |
| 02142006-Holinger-04_itms_7.05952.05952.2 | 3.1977 | 0.2804 | 100.0% | 1282.7037 | 1283.4673 | 1 | 5.766 | 77.3% | 1 | K.NANDLPKLVEGL.K | 2 | |
| 02142006-Holinger-04_itms_7.05808.05808.2 | 2.4235 | 0.243 | 99.1% | 1097.6237 | 1098.2847 | 9 | 4.843 | 72.2% | 1 | A.NDLPKLVEGL.K | 2 |
| U | Reverse_YEL041W | 1 | 1 | 2.6% | 495 | 55874 | 5.8 | YEL041W SGDID:S000000767, Chr V from 75944-77431, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_6.05013.05013.2 | 2.3481 | 0.248 | 99.1% | 1351.6135 | 1352.3948 | 1 | 4.863 | 58.3% | 1 | Y.LNSTDEGVITESS.L | 2 |
| U | YMR068W | 1 | 1 | 2.6% | 426 | 47140 | 9.3 | AVO2 SGDID:S000004672, Chr XIII from 406303-407583, Verified ORF, "Component of a complex containing the Tor2p kinase and other proteins, which may have a role in regulation of cell growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_17.11250.11250.2 | 1.8279 | 0.0579 | 90.5% | 1135.7815 | 1133.1167 | 10 | 4.137 | 55.0% | 1 | D.SFSSSSNSSSR.L | 2 |
| U | YGR279C | 1 | 2 | 2.6% | 386 | 40173 | 4.8 | SCW4 SGDID:S000003511, Chr VII from 1049964-1048804, reverse complement, Verified ORF, "Cell wall protein with similarity to glucanases; scw4 scw10 double mutants exhibit defects in mating" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05196.05196.2 | 3.3013 | 0.1116 | 99.3% | 1159.6505 | 1160.3585 | 6 | 5.031 | 77.8% | 2 | L.AQLTDFPVIR.L | 2 |
| U | YCR089W | 1 | 1 | 2.4% | 1609 | 166036 | 4.9 | FIG2 SGDID:S000000685, Chr III from 267430-272259, Verified ORF, "Cell wall adhesin, expressed specifically during mating; may be involved in maintenance of cell wall integrity during mating" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_13.09540.09540.3 | 2.4394 | 0.2599 | 100.0% | 4363.492 | 4365.0146 | 9 | 4.527 | 17.1% | 1 | L.LFPALSTEMINTTVVSRKTLIISTEVCSHSKCVPTVITE.V | 3 |
| U | YIL014W | 1 | 1 | 2.4% | 630 | 72410 | 5.6 | MNT3 SGDID:S000001276, Chr IX from 326101-327993, Verified ORF, "Alpha-1,3-mannosyltransferase, adds the fourth and fifth alpha-1,3-linked mannose residues to O-linked glycans during protein O-glycosylation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_9.06777.06777.2 | 2.5602 | 0.1724 | 90.3% | 1692.8535 | 1691.879 | 29 | 4.122 | 42.9% | 1 | E.SIAKISETAKETEQR.V | 2 |
| U | YBR248C | 1 | 1 | 2.4% | 552 | 61068 | 5.5 | HIS7 SGDID:S000000452, Chr II from 716460-714802, reverse complement, Verified ORF, "Imidazole glycerol phosphate synthase (glutamine amidotransferase:cyclase), catalyzes the fifth and sixth steps of histidine biosynthesis and also produces 5-aminoimidazole-4-carboxamide ribotide (AICAR), a purine precursor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_20.13738.13738.2 | 1.8677 | 0.1606 | 98.0% | 1394.709 | 1395.5522 | 6 | 4.595 | 45.8% | 1 | G.SVESPKSTGLNYI.D | 2 |
| U | YBL045C | 1 | 1 | 2.4% | 457 | 50228 | 7.3 | COR1 SGDID:S000000141, Chr II from 135519-134146, reverse complement, Verified ORF, "Core subunit of the ubiquinol-cytochrome c reductase complex (bc1 complex), which is a component of the mitochondrial inner membrane electron transport chain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_5.04665.04665.2 | 1.9539 | 0.0614 | 91.3% | 1112.6202 | 1113.1693 | 1 | 4.164 | 65.0% | 1 | L.AVEGEPVNSPN.Y | 2 |
| U | YNL009W | 1 | 1 | 2.4% | 420 | 47856 | 9.2 | IDP3 SGDID:S000004954, Chr XIV from 614822-616084, Verified ORF, "Peroxisomal NADP-dependent isocitrate dehydrogenase, catalyzes oxidation of isocitrate to alpha-ketoglutarate with the formation of NADP(H+), required for growth on unsaturated fatty acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_19.12340.12340.2 | 1.2381 | 0.06 | 90.6% | 963.7325 | 963.1982 | 1 | 4.131 | 61.1% | 1 | F.PKSGGIAMAM.F | 2 |
| U | YKL072W | 1 | 1 | 2.3% | 766 | 88836 | 8.6 | STB6 SGDID:S000001555, Chr XI from 299226-301526, Verified ORF, "Protein that binds Sin3p in a two-hybrid assay" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05585.05585.2 | 3.3512 | 0.1842 | 94.2% | 2086.9712 | 2085.556 | 114 | 4.307 | 41.2% | 1 | D.IFKFKKVVKSTVQDMTGK.G | 2 |
| U | YJL019W | 1 | 1 | 2.3% | 682 | 79175 | 5.3 | MPS3 SGDID:S000003556, Chr X from 402813-404861, Verified ORF, "Essential integral membrane protein required for spindle pole body duplication and for nuclear fusion, localizes to the spindle pole body half bridge, interacts with DnaJ-like chaperone Jem1p and with centrin homolog Cdc31p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_11.08496.08496.2 | 3.1075 | 0.3291 | 100.0% | 1801.9435 | 1803.0221 | 1 | 6.103 | 63.3% | 1 | R.LLPSNLVNFENDINSL.T | 2 |
| U | YER143W | 1 | 1 | 2.3% | 428 | 47354 | 5.1 | DDI1 SGDID:S000000945, Chr V from 456314-457600, Verified ORF, "DNA damage-inducible v-SNARE binding protein, contains a ubiquitin-associated (UBA) domain, may act as a negative regulator of constitutive exocytosis, may play a role in S-phase checkpoint control" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_6.05062.05062.2 | 2.1091 | 0.172 | 92.4% | 1073.5289 | 1074.2163 | 192 | 4.205 | 66.7% | 1 | L.DTDIDVLIGL.D | 2 |
| U | YGL075C | 1 | 1 | 2.3% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05775.05775.2 | 2.6962 | 0.1938 | 99.3% | 1013.0403 | 1014.2505 | 38 | 4.917 | 75.0% | 1 | K.LTESPIKLL.S | 2 |
| U | Reverse_YOR239W | 1 | 1 | 2.2% | 628 | 71486 | 4.7 | ABP140 SGDID:S000005765, Chr XV from 784857-785687,785689-786744, Verified ORF, "Nonessential protein that binds actin filaments and localizes to actin patches and cables, has similarity to S-adenosylmethionine (AdoMet)-dependent methyltransferases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_17.10882.10882.2 | 1.6681 | 0.0283 | 95.5% | 1560.9424 | 1562.8671 | 415 | 4.377 | 42.3% | 1 | A.SFVFIMVAIDVSHP.E | 2 |
| U | YOR025W | 1 | 2 | 2.2% | 447 | 50524 | 9.1 | HST3 SGDID:S000005551, Chr XV from 378218-379561, Verified ORF, "Member of the Sir2 family of NAD(+)-dependent protein deacetylases; involved along with Hst4p in telomeric silencing, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_17.10983.10983.2 | 2.0297 | 0.0708 | 94.1% | 1048.6483 | 1050.1407 | 1 | 4.296 | 66.7% | 2 | S.PPASRSGSMC.S | 2 |
| U | Reverse_YHR179W | 1 | 1 | 2.2% | 400 | 45011 | 6.6 | OYE2 SGDID:S000001222, Chr VIII from 462502-463704, Verified ORF, "Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye3p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism" |
| U | Reverse_YPL171C | 1 | 1 | 2.2% | 400 | 44920 | 5.6 | OYE3 SGDID:S000006092, Chr XVI from 227370-226168, reverse complement, Verified ORF, "Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye2p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-03_itms_6.05132.05132.2 | 2.0587 | 0.1134 | 92.5% | 1049.5402 | 1050.1998 | 113 | 4.214 | 62.5% | 1 | V.ADVVELTFR.A | 2 |
| U | Reverse_YMR094W | 1 | 1 | 2.1% | 478 | 56336 | 9.1 | CTF13 SGDID:S000004700, Chr XIII from 455824-457260, Verified ORF, "Subunit of the CBF3 complex, which binds to the CDE III element of centromeres, bending the DNA upon binding, and may be involved in sister chromatid cohesion during mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05217.05217.2 | 2.5875 | 0.2156 | 99.4% | 1205.6545 | 1206.4056 | 439 | 5.373 | 55.6% | 1 | G.TRSIQNMRSL.R | 2 |
| U | Reverse_YLR337C | 1 | 1 | 2.0% | 817 | 82594 | 9.9 | VRP1 SGDID:S000004329, Chr XII from 805106-802653, reverse complement, Verified ORF, "Proline-rich, actin-associated protein involved in cytoskeletal organization and cytokinesis; related to mammalian Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_19.12945.12945.2 | 1.9147 | 0.221 | 97.1% | 1561.8734 | 1563.8369 | 33 | 4.526 | 40.0% | 1 | V.NPLSPPPPATPPLPPA.H | 2 |
| U | YHR015W | 1 | 1 | 2.0% | 659 | 75920 | 9.4 | MIP6 SGDID:S000001057, Chr VIII from 134547-136526, Verified ORF, "Putative RNA-binding protein, interacts with Mex67p, which is a component of the nuclear pore involved in nuclear mRNA export" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_5.04364.04364.2 | 2.4046 | 0.1943 | 98.2% | 1471.7794 | 1474.6965 | 1 | 4.641 | 54.2% | 1 | L.DYFSTIGPIKSVF.I | 2 |
| U | YML031W | 1 | 1 | 2.0% | 655 | 74134 | 8.3 | NDC1 SGDID:S000004493, Chr XIII from 214189-216156, Verified ORF, "Nuclear envelope protein with multiple putative transmembrane domains, required for nuclear pore complex assembly and spindle pole body duplication; required for meiosis II" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_8.06081.06081.2 | 4.0204 | 0.2853 | 100.0% | 1626.7941 | 1627.7966 | 1 | 5.803 | 79.2% | 1 | E.NFFQAPQDYVLER.V | 2 |
| U | Reverse_YIR039C | 1 | 1 | 2.0% | 537 | 58214 | 4.3 | YPS6 SGDID:S000001478, Chr IX from 432107-430494, reverse complement, Verified ORF, "Putative GPI-anchored aspartic protease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_12.08727.08727.2 | 1.7074 | 0.1203 | 97.5% | 1104.7222 | 1104.3502 | 2 | 4.549 | 60.0% | 1 | L.IAVSQATIIMG.P | 2 |
| U | Reverse_YCR045C | 1 | 1 | 2.0% | 491 | 55068 | 5.4 | YCR045C SGDID:S000000641, Chr III from 209605-208130, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_11.08424.08424.2 | 2.5033 | 0.1115 | 90.1% | 1275.6887 | 1276.4412 | 60 | 4.114 | 66.7% | 1 | V.KTCHEVIFEL.G | 2 |
| U | YDL063C | 1 | 1 | 1.9% | 620 | 70164 | 5.2 | YDL063C SGDID:S000002221, Chr IV from 340134-338272, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_12.08511.08511.2 | 2.1445 | 0.2279 | 97.3% | 1297.6708 | 1298.6061 | 417 | 4.526 | 50.0% | 1 | E.IAIDLITAIIEI.V | 2 |
| U | YLL024C | 2 | 2 | 1.9% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07282.07282.2 | 3.7725 | 0.3305 | 100.0% | 1362.7573 | 1363.5939 | 1 | 6.605 | 81.8% | 1 | S.LLSIEDGIFEVK.A | 2 |
| * | 02142006-Holinger-03_itms_6.04862.04862.2 | 1.9627 | 0.0687 | 98.9% | 1136.5867 | 1137.275 | 97 | 4.808 | 61.1% | 1 | L.SIEDGIFEVK.A | 2 |
| U | Reverse_YDR458C | 1 | 1 | 1.8% | 663 | 76377 | 7.8 | YDR458C SGDID:S000002866, Chr IV from 1382036-1380045, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_6.05194.05194.2 | 2.3587 | 0.1283 | 93.4% | 1357.6837 | 1358.7942 | 49 | 4.255 | 59.1% | 1 | Q.IKKILFLVGLTI.F | 2 |
| U | Reverse_YIL155C | 1 | 1 | 1.8% | 649 | 72389 | 7.9 | GUT2 SGDID:S000001417, Chr IX from 53708-51759, reverse complement, Verified ORF, "Mitochondrial glycerol-3-phosphate dehydrogenase; expression is repressed by both glucose and cAMP and derepressed by non-fermentable carbon sources in a Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_16.11472.11472.2 | 1.6304 | 0.1661 | 95.8% | 1146.7457 | 1147.2737 | 78 | 4.424 | 50.0% | 1 | R.VVGQTASGKKGD.A | 2 |
| U | YER020W | 1 | 1 | 1.8% | 449 | 50448 | 6.4 | GPA2 SGDID:S000000822, Chr V from 195167-196516, Verified ORF, "Nucleotide binding alpha subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p, has signaling role in response to nutrients; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_4.03490.03490.2 | 2.5641 | 0.0983 | 90.3% | 968.4945 | 969.03613 | 7 | 4.122 | 78.6% | 1 | S.LSEYDQTL.M | 2 |
| U | Reverse_YNL298W | 1 | 1 | 1.7% | 842 | 93909 | 9.1 | CLA4 SGDID:S000005242, Chr XIV from 68915-71443, Verified ORF, "Cdc42p activated signal transducing kinase of the PAK (p21-activated kinase) family, involved in septin ring assembly and cytokinesis; directly phosphorylates septins Cdc3p and Cdc10p; other yeast PAK family members are Ste20p and Skm1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.06260.06260.2 | 2.8173 | 0.0062 | 91.0% | 1517.7671 | 1518.812 | 2 | 4.155 | 57.7% | 1 | Q.SPDANVTVKKLKSM.I | 2 |
| U | YHL024W | 1 | 1 | 1.7% | 713 | 80109 | 5.8 | RIM4 SGDID:S000001016, Chr VIII from 56647-58788, Verified ORF, "Putative RNA-binding protein required for the expression of early and middle sporulation genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_16.10232.10232.2 | 1.708 | 0.1803 | 94.2% | 1167.7074 | 1168.3502 | 179 | 4.306 | 45.5% | 1 | P.PPSGLDGSMIPP.P | 2 |
| U | YML020W | 1 | 1 | 1.7% | 664 | 76138 | 8.1 | YML020W SGDID:S000004482, Chr XIII from 231149-233143, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05242.05242.2 | 2.1799 | 0.2163 | 92.3% | 1189.5491 | 1192.4008 | 1 | 4.208 | 70.0% | 1 | I.ISNNVKITFVG.S | 2 |
| U | YDR049W | 1 | 1 | 1.7% | 632 | 72733 | 8.9 | YDR049W SGDID:S000002456, Chr IV from 553251-555149, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_17.10998.10998.2 | 2.3429 | 0.1506 | 90.7% | 1276.6919 | 1277.4601 | 105 | 4.141 | 55.0% | 1 | E.TLIEQAVNFLE.H | 2 |
| U | YPR036W | 1 | 1 | 1.7% | 478 | 54416 | 6.4 | VMA13 SGDID:S000006240, Chr XVI from 643833-645269, Verified ORF, "Subunit H of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; serves as an activator or a structural stabilizer of the V-ATPase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_26.15955.15955.2 | 1.5665 | 0.0264 | 91.6% | 887.7318 | 885.9927 | 19 | 4.174 | 78.6% | 1 | L.IHLLSTSD.N | 2 |
| U | Reverse_YPL161C | 1 | 2 | 1.6% | 633 | 70993 | 5.0 | BEM4 SGDID:S000006082, Chr XVI from 246219-244318, reverse complement, Verified ORF, "Protein involved in establishment of cell polarity and bud emergence; interacts with the Rho1p small GTP-binding protein and with the Rho-type GTPase Cdc42p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_8.06563.06563.2 | 2.8893 | 0.1066 | 92.3% | 1088.6064 | 1090.3325 | 8 | 4.209 | 77.8% | 2 | S.NCLIMLAAAL.A | 2 |
| U | Reverse_YDL003W | 1 | 1 | 1.6% | 566 | 63290 | 4.6 | MCD1 SGDID:S000002161, Chr IV from 444680-446380, Verified ORF, "Essential protein required for sister chromatid cohesion in mitosis and meiosis; subunit of the cohesin complex; expression is cell cycle regulated and peaks in S phase " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_14.10399.10399.2 | 1.7376 | 0.2033 | 91.8% | 926.68427 | 926.0605 | 267 | 4.187 | 62.5% | 1 | S.AVEGPTPRV.K | 2 |
| U | YBL105C | 1 | 1 | 1.5% | 1151 | 131519 | 7.1 | PKC1 SGDID:S000000201, Chr II from 17696-14241, reverse complement, Verified ORF, "Protein serine/threonine kinase essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05963.05963.2 | 3.2384 | 0.069 | 92.9% | 2097.0261 | 2099.3916 | 1 | 4.231 | 53.1% | 1 | V.EKQYQEANTKLTKLYQI.D | 2 |
| U | YER125W | 1 | 1 | 1.5% | 809 | 91816 | 6.7 | RSP5 SGDID:S000000927, Chr V from 410185-412614, Verified ORF, "Ubiquitin-protein ligase involved in ubiquitin-mediated protein degradation; plays a role in heat shock element (HSE)-mediated gene expression and multivesicular body sorting; contains a hect (homologous to E6-AP carboxyl terminus) domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07835.07835.2 | 2.2165 | 0.194 | 99.1% | 1362.7133 | 1363.5559 | 4 | 4.826 | 68.2% | 1 | R.DVFRSPDPFAVL.T | 2 |
| U | YPR175W | 1 | 1 | 1.5% | 689 | 78340 | 6.2 | DPB2 SGDID:S000006379, Chr XVI from 888970-891039, Verified ORF, "Second largest subunit of DNA polymerase II (DNA polymerase epsilon), required for normal yeast chromosomal replication; expression peaks at the G1/S phase boundary; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_12.09001.09001.2 | 1.7409 | 0.0338 | 90.6% | 1146.6442 | 1147.3195 | 312 | 4.131 | 61.1% | 1 | N.LLGRDAQNFL.L | 2 |
| U | Reverse_YBR299W | 1 | 1 | 1.5% | 584 | 68142 | 5.7 | MAL32 SGDID:S000000503, Chr II from 805345-807099, Verified ORF, "Maltase (alpha-D-glucosidase), inducible protein involved in maltose catabolism; encoded in the MAL3 complex locus; functional in genomic reference strain S288C" |
| U | Reverse_YGR292W | 1 | 1 | 1.5% | 584 | 68094 | 5.7 | MAL12 SGDID:S000003524, Chr VII from 1076605-1078359, Verified ORF, "Maltase (alpha-D-glucosidase), inducible protein involved in maltose catabolism; encoded in the MAL1 complex locus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-01_itms_14.08778.08778.2 | 1.7035 | 0.1831 | 90.2% | 901.45557 | 901.0252 | 35 | 4.115 | 62.5% | 1 | S.GHAVEGVTM.I | 2 |
| U | Reverse_YKL173W | 1 | 1 | 1.4% | 1008 | 114041 | 5.9 | SNU114 SGDID:S000001656, Chr XI from 122522-125548, Verified ORF, "GTPase component of U5 snRNP involved in mRNA splicing via spliceosome; binds directly to U5 snRNA; proposed to be involved in conformational changes of the spliceosome; similarity to ribosomal translocation factor EF-2" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_6.05184.05184.2 | 3.0297 | 0.1617 | 92.6% | 1504.7482 | 1505.6648 | 94 | 4.222 | 53.8% | 1 | R.LDTEFGASEIVPVQ.G | 2 |
| U | YIL108W | 1 | 10 | 1.4% | 696 | 77414 | 7.5 | YIL108W SGDID:S000001370, Chr IX from 160884-162974, Uncharacterized ORF, "Putative metalloprotease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05554.05554.2 | 3.9276 | 0.2657 | 99.3% | 1219.6621 | 1221.3989 | 1 | 4.917 | 88.9% | 10 | G.SKDIDLFNLR.E | 2 |
| U | Reverse_YNR008W | 1 | 1 | 1.4% | 661 | 75393 | 6.7 | LRO1 SGDID:S000005291, Chr XIV from 640398-642383, Verified ORF, "Acyltransferase that catalyzes diacylglycerol esterification; one of several acyltransferases that contribute to triglyceride synthesis; putative homolog of human lecithin cholesterol acyltransferase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_17.11437.11437.2 | 1.7002 | 0.2229 | 96.1% | 842.51263 | 843.01105 | 310 | 4.472 | 56.2% | 1 | E.IGTSIVGPV.M | 2 |
| U | YEL036C | 1 | 1 | 1.4% | 500 | 58182 | 5.3 | ANP1 SGDID:S000000762, Chr V from 84552-83050, reverse complement, Verified ORF, "Subunit of the alpha-1,6 mannosyltransferase complex; type II membrane protein; has a role in retention of glycosyltransferases in the Golgi; involved in osmotic sensitivity and resistance to aminonitrophenyl propanediol" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_19.12170.12170.2 | 1.2386 | 0.0923 | 91.1% | 810.56726 | 812.76495 | 7 | 4.155 | 66.7% | 1 | I.YEPSSDD.L | 2 |
| U | YMR280C | 1 | 2 | 1.3% | 1433 | 160485 | 9.0 | CAT8 SGDID:S000004893, Chr XIII from 831328-827027, reverse complement, Verified ORF, "Zinc cluster transcriptional activator necessary for derepression of a variety of genes under non-fermentative growth conditions, active after diauxic shift, binds carbon source responsive elements" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_8.06386.06386.2 | 2.8266 | 0.1424 | 92.6% | 1762.7714 | 1763.9047 | 63 | 4.22 | 38.2% | 2 | A.SADPGTNKKAVTNAGANF.K | 2 |
| U | YKL215C | 1 | 1 | 1.3% | 1286 | 140427 | 6.8 | YKL215C SGDID:S000001698, Chr XI from 30688-26828, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_11.08337.08337.2 | 2.2646 | 0.1743 | 96.1% | 1779.885 | 1778.842 | 361 | 4.471 | 34.4% | 1 | K.SSPNEQEGILEGNSGEM.V | 2 |
| U | Reverse_YPL160W | 1 | 1 | 1.3% | 1090 | 124141 | 5.8 | CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_13.09355.09355.2 | 2.0257 | 0.0879 | 96.6% | 1501.7227 | 1502.7942 | 232 | 4.512 | 46.2% | 1 | R.LYDLAALVGKDVPK.S | 2 |
| U | Reverse_YNL267W | 1 | 1 | 1.3% | 1066 | 119923 | 6.5 | PIK1 SGDID:S000005211, Chr XIV from 140879-144079, Verified ORF, "Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokineses through the actin cytoskeleton" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_8.06314.06314.2 | 2.4556 | 0.1987 | 93.2% | 1485.0029 | 1484.5626 | 21 | 4.252 | 50.0% | 1 | F.HDNLSAIGGKDDLE.A | 2 |
| U | YLR249W | 1 | 1 | 1.3% | 1044 | 115945 | 6.0 | YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_9.06834.06834.2 | 2.6395 | 0.161 | 98.9% | 1525.8683 | 1526.8162 | 1 | 4.779 | 69.2% | 1 | K.LVEDPQVIAPFLGK.L | 2 |
| U | YDR475C | 1 | 1 | 1.3% | 876 | 98691 | 9.6 | YDR475C SGDID:S000002883, Chr IV from 1410084-1407454, reverse complement, Uncharacterized ORF, "Protein of unknown function; previously annotated as two separate ORFs, YDR474C and YDR475C, which were merged as a result of corrections to the systematic reference sequence" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_7.05527.05527.2 | 3.3706 | 0.1515 | 91.8% | 1207.737 | 1206.3011 | 8 | 4.177 | 75.0% | 1 | V.KSNDSNSGKRI.K | 2 |
| U | Reverse_YLL054C | 1 | 1 | 1.3% | 769 | 89163 | 7.8 | YLL054C SGDID:S000003977, Chr XII from 35203-32894, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_6.05008.05008.2 | 1.573 | 0.1048 | 91.5% | 1095.543 | 1095.1974 | 6 | 4.172 | 50.0% | 1 | T.LNNSKVGFSE.K | 2 |
| U | Reverse_YJL103C | 1 | 1 | 1.3% | 618 | 70382 | 7.9 | YJL103C SGDID:S000003639, Chr X from 230798-228942, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_27.16482.16482.2 | 1.7509 | 0.1789 | 91.3% | 867.57007 | 869.9134 | 33 | 4.165 | 71.4% | 1 | T.IKSSTSSC.A | 2 |
| U | Reverse_YKL204W | 1 | 1 | 1.3% | 632 | 69762 | 9.5 | EAP1 SGDID:S000001687, Chr XI from 53705-55603, Verified ORF, "eIF4E-associated protein, binds eIF4E and inhibits cap-dependent translation, also functions independently of eIF4E to maintain genetic stability; plays a role in cell growth, implicated in the TOR signaling cascade" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_7.04895.04895.1 | 1.0454 | 0.2275 | 97.0% | 815.21497 | 814.87354 | 1 | 4.972 | 50.0% | 1 | S.KHTAAATD.S | 1 |
| U | YKR095W | 1 | 1 | 1.2% | 1875 | 218454 | 5.2 | MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07492.07492.2 | 3.4127 | 0.3172 | 99.7% | 2369.2441 | 2370.6218 | 1 | 5.377 | 40.9% | 1 | Y.TAADKEVNNSTNGPGLNNILITL.R | 2 |
| U | Reverse_YDR159W | 1 | 1 | 1.2% | 1301 | 149568 | 8.9 | SAC3 SGDID:S000002566, Chr IV from 771872-775777, Verified ORF, "Nuclear pore-associated protein, forms a complex with Thp1p that is involved in transcription and in mRNA export from the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_10.07794.07794.2 | 2.6798 | 0.2464 | 97.9% | 1689.8328 | 1690.9086 | 16 | 4.578 | 42.9% | 1 | S.FILNKDSSSLMFSSN.V | 2 |
| U | YDR017C | 1 | 1 | 1.2% | 1050 | 119550 | 6.8 | KCS1 SGDID:S000002424, Chr IV from 482263-479111, reverse complement, Verified ORF, "Inositol hexaphosphate kinase, phosphorylates inositol hexakisphosphate (InsP6) to diphosphoinositol polyphosphates, required for proper vacuole morphology and involved in salt stress response, contains two leucine heptad repeats" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_10.07737.07737.2 | 3.4237 | 0.1042 | 90.4% | 1563.8369 | 1565.776 | 6 | 4.117 | 62.5% | 1 | K.VNLIDFARCVTKE.D | 2 |
| U | YNL278W | 1 | 1 | 1.2% | 1060 | 118280 | 8.9 | CAF120 SGDID:S000005222, Chr XIV from 113271-116453, Verified ORF, "Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07358.07358.2 | 2.4913 | 0.1755 | 91.1% | 1348.7443 | 1350.4711 | 27 | 4.155 | 54.2% | 1 | L.GSADLFERADGVL.S | 2 |
| U | YFR029W | 1 | 1 | 1.2% | 678 | 76286 | 7.5 | PTR3 SGDID:S000001925, Chr VI from 210925-212961, Verified ORF, "Component of the SPS plasma membrane amino acid sensor system (Ssy1p-Ptr3p-Ssy5p), which senses external amino acid concentration and transmits intracellular signals that result in regulation of expression of amino acid permease genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_7.05720.05720.2 | 1.4515 | 0.0999 | 98.2% | 955.5288 | 953.0422 | 387 | 4.67 | 57.1% | 1 | E.YGPNFNQL.T | 2 |
| U | YNL299W | 1 | 1 | 1.2% | 642 | 74179 | 7.0 | TRF5 SGDID:S000005243, Chr XIV from 66517-68445, Verified ORF, "Poly (A) polymerase involved in nuclear RNA quality control based on: homology with Trf4p, genetic interactions with TRF4 mutants, physical interaction with Mtr4p (TRAMP subunit), and by direct assay; disputed role as a sigma DNA polymerase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.06261.06261.2 | 2.2261 | 0.1298 | 92.0% | 926.54425 | 926.19055 | 270 | 4.188 | 78.6% | 1 | V.IVKTRVPI.I | 2 |
| U | YPL242C | 1 | 1 | 1.1% | 1495 | 172830 | 8.9 | IQG1 SGDID:S000006163, Chr XVI from 95109-90622, reverse complement, Verified ORF, "Essential protein required for determination of budding pattern, promotes localization of axial markers Bud4p and Cdc12p and functionally interacts with Sec3p, localizes to the contractile ring during anaphase, member of the IQGAP family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_5.04381.04381.2 | 2.7795 | 0.1226 | 96.1% | 1822.787 | 1824.0488 | 46 | 4.467 | 43.3% | 1 | K.DFSPVHKSKFGNFKNA.V | 2 |
| U | Reverse_YMR129W | 1 | 1 | 1.1% | 1337 | 151652 | 6.7 | POM152 SGDID:S000004736, Chr XIII from 527803-531816, Verified ORF, "Nuclear pore membrane glycoprotein; may be involved in duplication of nuclear pores and nuclear pore complexes during S-phase;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_7.06185.06185.2 | 3.1559 | 0.1072 | 90.5% | 1781.8633 | 1783.9817 | 435 | 4.14 | 46.4% | 1 | E.KSFLNETVKTIHHND.Q | 2 |
| U | YKL197C | 1 | 1 | 1.1% | 1043 | 117276 | 7.0 | PEX1 SGDID:S000001680, Chr XI from 73870-70739, reverse complement, Verified ORF, "AAA-family ATPase peroxin required for peroxisome biogenesis, contains two 230 amino acid ATP-binding AAA cassettes, upregulated in anaerobiosis; Pex1p and Pex6p interact via their N-terminal AAA-cassettes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_5.04634.04634.2 | 2.6744 | 0.2349 | 99.2% | 1195.5776 | 1198.2804 | 1 | 5.064 | 70.0% | 1 | Q.EFGIAVHSHNS.D | 2 |
| U | Reverse_YLR014C | 1 | 1 | 1.1% | 904 | 102724 | 7.4 | PPR1 SGDID:S000004004, Chr XII from 174981-172267, reverse complement, Verified ORF, "Zinc finger transcription factor containing a Zn(2)-Cys(6) binuclear cluster domain, positively regulates transcription of genes involved in uracil biosynthesis; activity may be modulated by interaction with Tup1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_6.05313.05313.2 | 1.8894 | 0.1379 | 92.8% | 1196.6329 | 1197.463 | 9 | 4.229 | 66.7% | 1 | P.IHFKTPLEVI.P | 2 |
| U | YLR219W | 1 | 1 | 1.1% | 728 | 80530 | 9.1 | MSC3 SGDID:S000004209, Chr XII from 574153-576339, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; msc3 mutants are defective in directing meiotic recombination events to homologous chromatids; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_12.08812.08812.2 | 1.4258 | 0.2636 | 93.9% | 828.51276 | 830.7862 | 75 | 4.278 | 57.1% | 1 | Y.HTDAASDN.A | 2 |
| U | Reverse_YKL213C | 1 | 1 | 1.1% | 715 | 79506 | 5.0 | DOA1 SGDID:S000001696, Chr XI from 34108-31961, reverse complement, Verified ORF, "WD repeat protein required for ubiquitin-mediated protein degradation, forms complex with Cdc48p, plays a role in controlling cellular ubiquitin concentration; also promotes efficient NHEJ in postdiauxic/stationary phase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_28.17167.17167.1 | 1.4359 | 0.2598 | 91.2% | 733.35406 | 733.7563 | 8 | 4.925 | 57.1% | 1 | K.KDNGTAGA.G | 1 |
| U | Reverse_YMR280C | 1 | 1 | 1.0% | 1433 | 160485 | 9.0 | CAT8 SGDID:S000004893, Chr XIII from 831328-827027, reverse complement, Verified ORF, "Zinc cluster transcriptional activator necessary for derepression of a variety of genes under non-fermentative growth conditions, active after diauxic shift, binds carbon source responsive elements" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_7.05632.05632.2 | 3.336 | 0.2479 | 96.9% | 1679.792 | 1680.8855 | 12 | 4.522 | 50.0% | 1 | K.SDMNDKMLDLNSPLS.F | 2 |
| U | YPL217C | 1 | 1 | 1.0% | 1183 | 135571 | 6.8 | BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_11.08077.08077.2 | 1.9043 | 0.0949 | 93.4% | 1303.5824 | 1305.2108 | 395 | 4.255 | 50.0% | 1 | L.EDGNPSEQAEDN.S | 2 |
| U | Reverse_YGL049C | 1 | 1 | 1.0% | 914 | 103899 | 7.6 | TIF4632 SGDID:S000003017, Chr VII from 409607-406863, reverse complement, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4631p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_5.04620.04620.2 | 1.7985 | 0.0601 | 96.4% | 1028.5641 | 1029.011 | 250 | 4.493 | 68.8% | 1 | R.NSSYRNSNS.Q | 2 |
| U | Reverse_YIL169C | 1 | 1 | 1.0% | 995 | 99736 | 4.6 | YIL169C SGDID:S000001431, Chr IX from 26106-23119, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_17.11201.11201.2 | 1.476 | 0.111 | 97.3% | 1077.7306 | 1075.1174 | 393 | 4.537 | 55.6% | 1 | T.YSQSSVTTTT.T | 2 |
| U | YKL073W | 1 | 1 | 1.0% | 881 | 99572 | 5.3 | LHS1 SGDID:S000001556, Chr XI from 296074-298719, Verified ORF, "Molecular chaperone of the endoplasmic reticulum lumen, involved in polypeptide translocation and folding; member of the Hsp70 family; localizes to the lumen of the ER; regulated by the unfolded protein response pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_6.05041.05041.2 | 2.4506 | 0.1662 | 95.8% | 955.5271 | 957.0306 | 39 | 4.417 | 75.0% | 1 | K.QFGGYGTNL.P | 2 |
| U | YBR098W | 1 | 2 | 1.0% | 691 | 78764 | 7.5 | MMS4 SGDID:S000000302, Chr II from 441509-443584, Verified ORF, "Subunit of the structure-specific Mms4p-Mus81p endonuclease that cleaves branched DNA; involved in recombination and DNA repair" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_6.05316.05316.2 | 2.4481 | 0.0784 | 90.6% | 807.4647 | 807.9219 | 38 | 4.134 | 83.3% | 2 | M.SQIVDFV.E | 2 |
| U | YHL035C | 1 | 1 | 0.9% | 1592 | 180925 | 8.5 | YHL035C SGDID:S000001027, Chr VIII from 32754-27976, reverse complement, Uncharacterized ORF, "Protein of unknown function, member of the ATP-binding cassette (ABC) family, potential Cdc28p substrate" |
| U | YLL048C | 1 | 1 | 0.8% | 1661 | 189161 | 8.1 | YBT1 SGDID:S000003971, Chr XII from 46264-41279, reverse complement, Verified ORF, "Transporter of the ATP-binding cassette (ABC) family involved in bile acid transport; similar to mammalian bile transporters" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-01_itms_17.10894.10894.2 | 1.8439 | 0.2374 | 93.6% | 1387.8408 | 1390.5333 | 15 | 4.272 | 42.3% | 1 | L.TEIGEKGITLSGGQ.K | 2 |
| U | Reverse_YDR301W | 1 | 1 | 0.9% | 1357 | 153404 | 5.9 | CFT1 SGDID:S000002709, Chr IV from 1063346-1067419, Verified ORF, "RNA-binding subunit of the mRNA cleavage and polyadenylation factor; involved in poly(A) site recognition and required for both pre-mRNA cleavage and polyadenylation, 51% sequence similarity with mammalian AAUAA-binding subunit of CPSF" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_17.11736.11736.2 | 2.1575 | 0.2341 | 98.7% | 1300.1857 | 1297.4045 | 86 | 4.761 | 50.0% | 1 | V.TSVTGSVEEQFI.E | 2 |
| U | YPR049C | 1 | 1 | 0.9% | 1178 | 135025 | 5.7 | ATG11 SGDID:S000006253, Chr XVI from 664670-661134, reverse complement, Verified ORF, "Peripheral membrane protein required for delivery of aminopeptidase I (Lap4p) to the vacuole in the cytoplasm-to-vacuole targeting pathway; also required for peroxisomal degradation (pexophagy)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_6.05150.05150.2 | 2.3151 | 0.1476 | 90.5% | 1256.595 | 1257.4473 | 2 | 4.139 | 65.0% | 1 | Q.MLDAHDNSLIK.S | 2 |
| U | Reverse_YMR287C | 1 | 1 | 0.9% | 969 | 110822 | 9.0 | MSU1 SGDID:S000004900, Chr XIII from 845344-842435, reverse complement, Verified ORF, "RNase, component of the mitochondrial degradosome along with the ATP-dependent RNA helicase Suv3p; the degradosome associates with the ribosome and mediates turnover of aberrant or unprocessed RNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_18.12199.12199.2 | 1.3195 | 0.0711 | 95.4% | 978.9877 | 980.10876 | 30 | 4.359 | 56.2% | 1 | K.LTGRAFSLD.P | 2 |
| U | Reverse_YPR164W | 1 | 1 | 0.8% | 1407 | 161237 | 5.9 | MMS1 SGDID:S000006368, Chr XVI from 870699-874922, Verified ORF, "Protein likely involved in protection against replication-dependent DNA damage; mutants are sensitive to methyl methanesulfonate (MMS); implicated in regulation of Ty1 transposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_8.06319.06319.2 | 2.0793 | 0.1255 | 92.0% | 1207.6156 | 1206.2144 | 121 | 4.194 | 50.0% | 1 | V.QSNRTDNINSG.T | 2 |
| U | Reverse_YDR310C | 1 | 7 | 0.8% | 1062 | 118201 | 6.2 | SUM1 SGDID:S000002718, Chr IV from 1084310-1081122, reverse complement, Verified ORF, "Transcriptional repressor required for repression of middle sporulation-specific genes during mitosis; regulated by the pachytene checkpoint; a dominant mutation acts as a suppressor of silencing defects of SIR2 mutations" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_15.10721.10721.2 | 1.9432 | 0.3392 | 98.2% | 960.5913 | 961.1241 | 130 | 4.673 | 50.0% | 7 | I.SASRPKPSM.S | 2 |
| U | YKL210W | 1 | 1 | 0.8% | 1024 | 114266 | 5.1 | UBA1 SGDID:S000001693, Chr XI from 39164-42238, Verified ORF, "Ubiquitin activating enzyme, involved in ubiquitin-mediated protein degradation and essential for viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-02_itms_7.05688.05688.1 | 2.1114 | 0.2225 | 100.0% | 850.4812 | 850.90356 | 16 | 5.005 | 64.3% | 1 | H.GLEDGNFV.R | 1 |
| U | YCR057C | 1 | 1 | 0.8% | 923 | 103983 | 5.1 | PWP2 SGDID:S000000653, Chr III from 223223-220452, reverse complement, Verified ORF, "Conserved 90S pre-ribosomal component essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_14.10105.10105.1 | 1.7572 | 0.123 | 91.4% | 766.5347 | 767.85956 | 250 | 4.916 | 50.0% | 1 | E.WLAFGSS.K | 1 |
| U | Reverse_YBL088C | 1 | 1 | 0.7% | 2787 | 321567 | 6.9 | TEL1 SGDID:S000000184, Chr II from 59379-51016, reverse complement, Verified ORF, "Protein kinase, primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_10.07350.07350.2 | 3.4213 | 0.1771 | 94.9% | 2150.0361 | 2151.5571 | 2 | 4.336 | 41.7% | 1 | I.ALQVYNALQIISGLRLYKS.C | 2 |
| U | YGR109W-B | 1 | 1 | 0.7% | 1547 | 178419 | 8.8 | YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YIL082W-A | 1 | 1 | 0.7% | 1498 | 172454 | 9.2 | YIL082W-A SGDID:S000003537, Chr IX from 205632-206482,206484-210129, transposable_element_gene, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-04_itms_8.06662.06662.2 | 2.2967 | 0.1761 | 91.2% | 1243.6528 | 1244.4302 | 103 | 4.16 | 65.0% | 1 | A.QFPIPEEASIL.E | 2 |
| U | YIL159W | 1 | 2 | 0.7% | 1375 | 156851 | 7.9 | BNR1 SGDID:S000001421, Chr IX from 41825-45952, Verified ORF, "Formin, nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables, functionally redundant with BNI1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 02142006-Holinger-05_itms_15.10440.10440.2 | 1.2866 | 0.0081 | 91.2% | 1004.6176 | 1006.2328 | 36 | 4.157 | 50.0% | 2 | P.PPPPPPPPLP.Q | 2 |
| U | Reverse_YPR026W | 1 | 1 | 0.7% | 1211 | 136920 | 5.4 | ATH1 SGDID:S000006230, Chr XVI from 615376-619011, Verified ORF, "Acid trehalase required for utilization of extracellular trehalose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-03_itms_19.12394.12394.2 | 1.387 | 0.1706 | 93.9% | 966.5175 | 966.9395 | 2 | 4.287 | 62.5% | 1 | L.YSQSSSGHN.L | 2 |
| U | YNL163C | 1 | 1 | 0.7% | 1110 | 124464 | 5.1 | RIA1 SGDID:S000005107, Chr XIV from 330075-326743, reverse complement, Verified ORF, "Cytoplasmic GTPase involved in biogenesis of the 60S ribosome; has similarity to translation elongation factor 2 (Eft1p and Eft2p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_18.12310.12310.2 | 1.9446 | 0.1407 | 93.6% | 876.5226 | 877.0311 | 41 | 4.272 | 71.4% | 1 | I.KNGFQLAV.S | 2 |
| U | YJL005W | 1 | 2 | 0.6% | 2026 | 227832 | 7.3 | CYR1 SGDID:S000003542, Chr X from 425072-431152, Verified ORF, "Adenylate cyclase, required for cAMP production and cAMP-dependent protein kinase signaling; involved in cell cycle control and glucose and nitrogen repression of sporulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-06_itms_11.07941.07941.2 | 3.18 | 0.1179 | 92.9% | 1303.5834 | 1304.4827 | 2 | 4.242 | 63.6% | 2 | N.ELESLPAGFVEL.K | 2 |
| U | YML103C | 1 | 1 | 0.6% | 1655 | 188576 | 5.6 | NUP188 SGDID:S000004571, Chr XIII from 67549-62582, reverse complement, Verified ORF, "Subunit of the nuclear pore complex (NPC), involved in the structural organization of the complex and of the nuclear envelope, also involved in nuclear envelope permeability, interacts with Pom152p and Nic96p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-05_itms_5.04802.04802.2 | 2.3279 | 0.104 | 92.1% | 1057.5614 | 1059.2914 | 227 | 4.197 | 61.1% | 1 | I.TTILILGLNT.S | 2 |
| U | YDR150W | 1 | 1 | 0.4% | 2748 | 313032 | 5.4 | NUM1 SGDID:S000002557, Chr IV from 755623-763869, Verified ORF, "Protein required for nuclear migration, localizes to the mother cell cortex and the bud tip; may mediate interactions of dynein and cytoplasmic microtubules with the cell cortex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-01_itms_26.15846.15846.2 | 1.5533 | 0.0379 | 92.2% | 999.64825 | 1001.1021 | 286 | 4.203 | 61.1% | 1 | A.SFMSRAGSAS.R | 2 |
| U | YPR117W | 1 | 1 | 0.4% | 2489 | 285902 | 8.3 | YPR117W SGDID:S000006321, Chr XVI from 760023-767492, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | 02142006-Holinger-04_itms_18.12127.12127.2 | 1.2833 | 0.2596 | 95.8% | 969.69073 | 970.0239 | 209 | 4.406 | 43.8% | 1 | L.SFGSSLDEK.V | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 10154 | 34401 | 51016 |
| Filtered | 167 | 351 | 562 |
| Forward matches | 118 | 302 | 501 |
| Decoy matches | 49 | 49 | 61 |
| Forward FP rate | 41.53% | 16.23% | 12.18% |