| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| con | Exclude protein names matching |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YOR257W | 3 | 8 | 40.4% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_8.16444.16444.3 | 3.2336 | 0.1787 | 100.0% | 2940.0244 | 2940.21 | 356 | 4.999 | 20.7% | 1 | K.QEIYEAFSLFDMNNDGFLDYHELK.V | 3 |
| * | Jamie_04_itms_3.22063.22063.3 | 3.9788 | 0.3493 | 100.0% | 4170.054 | 4170.5425 | 1 | 5.517 | 20.1% | 1 | R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAI.C | 3 |
| * | Jamie_05_itms_4.20943.20943.3 | 3.7047 | 0.3179 | 100.0% | 4633.014 | 4633.953 | 1 | 6.759 | 24.4% | 6 | R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS.- | 3 |
| U | YBR109C | 2 | 6 | 25.2% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_4.23386.23386.4 | 3.2677 | 0.2079 | 100.0% | 4107.9766 | 4109.526 | 37 | 4.158 | 18.1% | 1 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 4 |
| * | Jamie_03_itms_13.20957.20957.3 | 5.3755 | 0.5193 | 100.0% | 4108.494 | 4109.526 | 1 | 8.643 | 27.8% | 5 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
| U | YOR286W | 1 | 1 | 18.8% | 149 | 16697 | 9.6 | YOR286W SGDID:S000005812, Chr XV from 850277-850726, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_8.16226.16226.3 | 2.8655 | 0.2015 | 100.0% | 3026.9043 | 3027.5405 | 334 | 3.914 | 21.3% | 1 | K.HSTGILSRTVSARSPTLVLRTFTTKAPK.I | 3 |
| U | YPL124W | 4 | 5 | 15.0% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_2.10677.10677.4 | 4.5493 | 0.2207 | 100.0% | 4382.0566 | 4382.572 | 48 | 4.227 | 18.0% | 1 | R.SSDNINKEGAREDRSSQIHIENEST*EDILKILSSSFHN.- | 4 |
| * | Jamie_03_itms_2.05408.05408.2 | 3.6077 | 0.3247 | 100.0% | 1923.0521 | 1923.9855 | 1 | 5.518 | 63.3% | 2 | R.SSQIHIENEST*EDILK.I | 2 |
| * | Jamie_03_itms_4.13572.13572.3 | 3.1523 | 0.1963 | 100.0% | 2809.5544 | 2809.9604 | 64 | 4.809 | 26.1% | 1 | R.SSQIHIENES*TEDILKILSSSFHN.- | 3 |
| * | Jamie_03_itms_4.13151.13151.3 | 3.2397 | 0.2378 | 100.0% | 2889.2344 | 2889.9604 | 180 | 4.376 | 25.0% | 1 | R.SSQIHIENEST*EDILKILSS*SFHN.- | 3 |
| U | YIL061C | 1 | 1 | 13.3% | 300 | 34447 | 10.0 | SNP1 SGDID:S000001323, Chr IX from 245556-244654, reverse complement, Verified ORF, "Component of U1 snRNP required for mRNA splicing via spliceosome; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_25.28871.28871.4 | 1.7887 | 0.5369 | 100.0% | 4371.3765 | 4373.6104 | 81 | 2.908 | 10.7% | 1 | S.SS*AYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVY*KS.R | 4 |
| U | YFR028C | 2 | 2 | 12.7% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_17.24023.24023.4 | 4.4694 | 0.4213 | 100.0% | 5196.5366 | 5197.7397 | 1 | 7.545 | 18.2% | 1 | R.VYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYR.F | 4 |
| * | Jamie_03_itms_5.14398.14398.3 | 3.8496 | 0.3398 | 100.0% | 3012.2644 | 3013.3398 | 20 | 5.711 | 26.0% | 1 | K.HFEDIGIQHLDLIFEDGTCPDLSIVK.N | 3 |
| U | YKL060C | 1 | 1 | 12.3% | 359 | 39621 | 5.8 | FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_6.14632.14632.4 | 4.0067 | 0.3206 | 100.0% | 5038.9365 | 5040.5103 | 1 | 5.629 | 18.2% | 1 | R.MAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYK.A | 4 |
| U | YPL131W | 1 | 3 | 10.4% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_05_itms_3.14011.14011.3 | 6.3056 | 0.5109 | 100.0% | 3500.6943 | 3500.7944 | 1 | 8.748 | 30.8% | 3 | K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V | 3 |
| U | YNR040W | 1 | 1 | 9.4% | 256 | 28636 | 10.1 | YNR040W SGDID:S000005323, Chr XIV from 699692-700462, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_5.26973.26973.3 | 2.0181 | 0.2119 | 100.0% | 2584.1343 | 2579.9163 | 53 | 4.393 | 19.6% | 1 | K.TFGPVALGVLPVILAAATKHVT*S*R.L | 3 |
| U | Reverse_YBR192W | 1 | 1 | 9.3% | 377 | 42102 | 9.6 | RIM2 SGDID:S000000396, Chr II from 607647-608780, Verified ORF, "Mitochondrial pyrimidine nucleotide transporter; imports pyrimidine nucleoside triphosphates and exports pyrimidine nucleoside monophosphates; member of the mitochondrial carrier family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_5.14433.14433.4 | 3.2225 | 0.1449 | 93.9% | 4097.7363 | 4093.6348 | 15 | 3.51 | 19.6% | 1 | K.FLSRFGEQKYVNGIIGLTEKFHTGAQIVY*NISKPR.T | 4 |
| U | YLR332W | 1 | 1 | 8.2% | 376 | 39146 | 5.7 | MID2 SGDID:S000004324, Chr XII from 790676-791806, Verified ORF, "O-glycosylated plasma membrane protein that acts as a sensor for cell wall integrity signaling and activates the pathway; interacts with Rom2p, a guanine nucleotide exchange factor for Rho1p, and with cell integrity pathway protein Zeo1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_4.13120.13120.3 | 2.1924 | 0.4249 | 100.0% | 3074.2444 | 3076.801 | 3 | 2.605 | 21.7% | 1 | F.SFSSDSSTSSSSSASS*DSSSSSSFSISSTS*A.T | 3 |
| U | YNL064C | 1 | 1 | 8.1% | 409 | 44671 | 6.3 | YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_12.32153.32153.3 | 2.9878 | 0.2078 | 100.0% | 3564.4143 | 3563.8965 | 10 | 5.104 | 18.0% | 1 | R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
| U | Reverse_YKL141W | 1 | 1 | 8.1% | 198 | 22068 | 10.2 | SDH3 SGDID:S000001624, Chr XI from 179672-180268, Verified ORF, "Cytochrome b subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer of electrons to ubiquinone" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_16.22864.22864.2 | 1.5115 | 0.1493 | 94.1% | 1796.9122 | 1795.9921 | 257 | 3.785 | 36.7% | 1 | R.IAGGYHIAFLYAFS*GK.I | 2 |
| U | YGL075C | 1 | 1 | 7.2% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_13.20917.20917.3 | 3.0255 | 0.2455 | 100.0% | 3119.1843 | 3118.4395 | 1 | 4.517 | 26.9% | 1 | R.EILENAFIGVDSIPSDFIVSMNLNSPS*K.F | 3 |
| U | YNL225C | 1 | 2 | 5.9% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_2.09894.09894.4 | 5.9006 | 0.3744 | 100.0% | 4204.4966 | 4205.8145 | 5 | 6.177 | 21.2% | 2 | K.ILCDKFDKLTIDEKEILKGCNEEIKIKLERLNER.L | 4 |
| U | YGR234W | 1 | 1 | 5.3% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_9.29866.29866.2 | 1.2028 | 0.2466 | 100.0% | 2231.372 | 2228.381 | 198 | 4.185 | 17.5% | 1 | R.T*NQKVGAQPNALAT*TVLAAAK.N | 2 |
| U | YJR053W | 3 | 4 | 5.2% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_3.11003.11003.3 | 2.3741 | 0.2648 | 100.0% | 3531.9543 | 3535.8586 | 49 | 4.906 | 19.0% | 1 | K.KLASWFIPRDET*IISVDEETIMDESTVNSK.R | 3 |
| * | Jamie_03_itms_3.11003.11003.2 | 2.0532 | 0.26 | 100.0% | 2354.9722 | 2356.5146 | 1 | 4.297 | 40.0% | 2 | R.DETIISVDEETIMDESTVNSK.R | 3 |
| * | Jamie_03_itms_3.10922.10922.3 | 3.1081 | 0.2402 | 100.0% | 2356.0144 | 2356.5146 | 35 | 4.742 | 30.0% | 1 | R.DETIISVDEETIMDESTVNSK.R | 3 |
| U | Reverse_YBL097W | 1 | 1 | 3.7% | 754 | 86230 | 4.7 | BRN1 SGDID:S000000193, Chr II from 40828-43092, Verified ORF, "Essential protein required for chromosome condensation, likely to function as an intrinsic component of the condensation machinery, may influence multiple aspects of chromosome transmission and dynamics" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_5.14033.14033.4 | 2.8478 | 0.161 | 91.2% | 3528.2966 | 3524.9624 | 9 | 4.179 | 22.8% | 1 | K.FLPDIILEQDLEKMKIT*EFEVLT*TELVR.N | 4 |
| U | YOL122C | 1 | 1 | 3.3% | 575 | 63264 | 6.6 | SMF1 SGDID:S000005482, Chr XV from 91418-89691, reverse complement, Verified ORF, "Divalent metal ion transporter with a broad specificity for di-valent and tri-valent metals; post-translationally regulated by levels of metal ions; member of the Nramp family of metal transport proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_05_itms_6.30571.30571.2 | 2.8077 | 0.2633 | 100.0% | 2143.872 | 2142.3523 | 3 | 4.81 | 36.1% | 1 | G.T*IFMLALLLSGQSAGVVCT*.M | 2 |
| U | YGL006W | 1 | 1 | 3.0% | 1173 | 130861 | 7.4 | PMC1 SGDID:S000002974, Chr VII from 485925-489446, Verified ORF, "Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_23.27418.27418.4 | 3.3223 | 0.1672 | 100.0% | 4282.7363 | 4280.5713 | 22 | 3.365 | 17.2% | 1 | K.YLKTDKNAGIS*LPEISNYRKTNRYKNY*GDNSLPER.I | 4 |
| U | YLR188W | 1 | 1 | 3.0% | 695 | 75950 | 9.8 | MDL1 SGDID:S000004178, Chr XII from 528302-530389, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane, mediates export of peptides generated upon proteolysis of mitochondrial proteins, plays a role in the regulation of cellular resistance to oxidative stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_12.20087.20087.3 | 2.7889 | 0.1717 | 100.0% | 2370.7444 | 2372.871 | 12 | 4.126 | 30.0% | 1 | K.LT*CVMMILAPPLGAMALIYGR.K | 3 |
| U | Reverse_YOL087C | 1 | 1 | 2.9% | 1116 | 125382 | 6.7 | YOL087C SGDID:S000005447, Chr XV from 158636-155286, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_13.20778.20778.4 | 3.3418 | 0.1423 | 97.0% | 3877.6565 | 3876.2297 | 322 | 4.558 | 18.8% | 1 | K.DKNNKKS*ESNYGTDLTLSNT*LDKKKLSFIKKR.L | 4 |
| U | YBR133C | 1 | 1 | 2.7% | 827 | 95153 | 6.4 | HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_4.13165.13165.2 | 2.9531 | 0.2656 | 100.0% | 2581.3523 | 2581.6624 | 1 | 5.602 | 38.1% | 1 | K.DTVQDEDDFTVEFSQSSLNEFK.I | 2 |
| U | YAL047C | 1 | 1 | 2.7% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_4.13773.13773.2 | 2.8545 | 0.2334 | 100.0% | 1998.4321 | 1999.1761 | 1 | 6.311 | 53.1% | 1 | R.ETLEETLELSSDYVLEK.M | 2 |
| U | YOR048C | 1 | 1 | 2.4% | 1006 | 115934 | 6.8 | RAT1 SGDID:S000005574, Chr XV from 421650-418630, reverse complement, Verified ORF, "Nuclear 5' to 3' single-stranded RNA exonuclease, involved in RNA metabolism, including rRNA and snRNA processing as well as mRNA transcription termination" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_15.22212.22212.3 | 2.627 | 0.1708 | 94.1% | 2862.2944 | 2866.0522 | 1 | 3.368 | 28.3% | 1 | K.TY*MT*CDGVLNLPSVETLLQHLGSR.E | 3 |
| U | YOR373W | 2 | 8 | 2.2% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_2.07026.07026.2 | 3.8731 | 0.3226 | 100.0% | 2142.9521 | 2143.2659 | 1 | 7.153 | 50.0% | 2 | R.VEDITSISEVNTSFNETEK.Q | 2 |
| * | Jamie_03_itms_2.07278.07278.2 | 3.9202 | 0.3824 | 100.0% | 2222.6921 | 2223.2659 | 1 | 6.488 | 58.3% | 6 | R.VEDITSISEVNTS*FNETEK.Q | 2 |
| U | YMR164C | 1 | 1 | 2.2% | 758 | 85050 | 7.8 | MSS11 SGDID:S000004774, Chr XIII from 589549-587273, reverse complement, Verified ORF, "Transcription factor involved in regulation of invasive growth and starch degradation; controls the activation of MUC1 and STA2 in response to nutritional signals" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_05_itms_9.34967.34967.2 | 1.197 | 0.3509 | 100.0% | 2020.9321 | 2023.8491 | 311 | 5.022 | 18.8% | 1 | N.TRNNTAEET*TPT*NDNNA.N | 2 |
| U | YDR135C | 1 | 1 | 2.0% | 1515 | 171120 | 8.4 | YCF1 SGDID:S000002542, Chr IV from 727546-722999, reverse complement, Verified ORF, "Vacuolar glutathione S-conjugate transporter of the ATP-binding cassette family, has a role in detoxifying metals such as cadmium, mercury, and arsenite; also transports unconjugated bilirubin; similar to human cystic fibrosis protein CFTR" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_10.18762.18762.4 | 3.7419 | 0.1428 | 100.0% | 3472.6165 | 3474.8064 | 1 | 4.723 | 23.3% | 1 | R.ESSIPVEGELEQLQKLNDLDFGNSDAISLRR.A | 4 |
| U | YOR069W | 1 | 1 | 1.9% | 675 | 76484 | 5.2 | VPS5 SGDID:S000005595, Chr XV from 453769-455796, Verified ORF, "Nexin-1 homolog required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to the late Golgi apparatus; structural component of the retromer membrane coat complex; forms a retromer subcomplex with Vps17p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_03_itms_16.23249.23249.2 | 1.6998 | 0.1407 | 100.0% | 1778.2922 | 1778.9193 | 23 | 4.379 | 50.0% | 1 | K.EFQT*LERRYNLTK.K | 2 |
| U | YLR413W | 1 | 1 | 1.8% | 675 | 72698 | 5.1 | YLR413W SGDID:S000004405, Chr XII from 951152-953179, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_18.38175.38175.1 | 1.2389 | 0.255 | 100.0% | 1329.0 | 1329.6294 | 30 | 3.91 | 31.8% | 1 | I.LLPICALLTLTT.F | 1 |
| U | YMR092C | 1 | 1 | 1.5% | 615 | 67326 | 5.6 | AIP1 SGDID:S000004698, Chr XIII from 453478-451631, reverse complement, Verified ORF, "Actin cortical patch component, interacts with the actin depolymerizing factor cofilin; required to restrict cofilin localization to cortical patches; contains WD repeats" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_18.38208.38208.1 | 1.2228 | 0.2408 | 100.0% | 979.04 | 978.9023 | 42 | 4.404 | 37.5% | 1 | T.PSTLVS*S*GA.D | 1 |
| U | YPL058C | 1 | 1 | 1.1% | 1511 | 171064 | 6.8 | PDR12 SGDID:S000005979, Chr XVI from 450374-445839, reverse complement, Verified ORF, "Plasma membrane weak-acid-inducible ATP-binding cassette (ABC) transporter, required for weak organic acid resistance, strongly induced by sorbate and benzoate, regulated by War1p, mutants exhibit sorbate hypersensitivity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_7.28590.28590.2 | 1.6759 | 0.3138 | 100.0% | 1909.8121 | 1911.9427 | 21 | 5.692 | 37.5% | 1 | M.DNNTGYLVNPTATENCQ.Y | 2 |
| U | YDL112W | 1 | 1 | 1.1% | 1436 | 165047 | 6.1 | TRM3 SGDID:S000002270, Chr IV from 258915-263225, Verified ORF, "2'-O-ribose methyltransferase, catalyzes the ribose methylation of the guanosine nucleotide at position 18 of tRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_05_itms_5.27717.27717.2 | 1.2038 | 0.2356 | 100.0% | 2065.7322 | 2064.133 | 233 | 3.797 | 23.3% | 1 | K.LEEHAQT*IISLSY*SRR.S | 2 |
| U | YMR176W | 1 | 1 | 0.6% | 1411 | 162700 | 6.8 | ECM5 SGDID:S000004788, Chr XIII from 611739-615974, Verified ORF, "Non-essential protein of unknown function, contains ATP/GTP-binding site motif A; null mutant exhibits cellular volume up to four times greater than wild-type, also large drooping buds with elongated necks" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_04_itms_19.38487.38487.1 | 1.1011 | 0.248 | 100.0% | 1004.89 | 1006.2328 | 165 | 4.178 | 35.7% | 1 | T.IPLKVSYW.T | 1 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 10593 | 54665 | 67160 |
| Filtered | 34 | 44 | 64 |
| Forward matches | 30 | 40 | 60 |
| Decoy matches | 4 | 4 | 4 |
| Forward FP rate | 13.33% | 10.0% | 6.67% |