D parc

DTASelect v2.0.21
/data/6/jamest/xu/jan08/hx21/parc
/scratch/yates/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
--trypstat
Jump to the summary table.

sequest.params modifications:

*	X	0.0
#	X	0.0
@	X	0.0
Static	C	57.0

true	Use criteria
0.0	Minimum peptide confidence
0.05	Peptide false positive rate
0.0	Minimum protein confidence
1.0	Protein false positive rate
1	Minimum charge state
16	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
false	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
1000	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

contaminant_KERATIN02

367

79.9%

622

61987

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.04286.04286.2	5.0725	0.482	100.0%	1233.0521	1233.2833	1	8.679	83.3%	13	T.SGGGGGGGLGSGGSIR.S	2
*	PARC_hx21_02_itms.03924.03924.2	3.3146	0.4484	100.0%	1236.1122	1236.2401	1	7.239	79.2%	2	R.FSSSSGYGGGSSR.V	2
*	PARC_hx21_05_itms.14945.14945.2	5.7207	0.607	100.0%	2706.5723	2706.7605	1	11.583	41.9%	12	R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G	2
*	PARC_hx21_05_itms.14878.14878.3	6.0244	0.4641	100.0%	2706.8943	2706.7605	1	9.058	35.5%	2	R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G	3
*	PARC_hx21_03_itms.07659.07659.2	6.2313	0.5804	100.0%	2026.5122	2024.0703	1	11.255	56.5%	9	Y.SYGGGSGGGFSASSLGGGFGGGSR.G	2
*	PARC_hx21_03_itms.07221.07221.2	3.264	0.4022	99.3%	1717.3121	1716.7642	1	7.204	42.5%	1	G.GGSGGGFSASSLGGGFGGGSR.G	2
*	PARC_hx21_03_itms.07293.07293.2	4.0173	0.4832	100.0%	1602.0322	1602.6604	1	8.423	52.8%	1	G.SGGGFSASSLGGGFGGGSR.G	2
*	PARC_hx21_02_itms.04922.04922.2	4.0139	0.4528	100.0%	1196.8322	1197.2499	1	7.612	80.8%	1	F.SASSLGGGFGGGSR.G	2
*	PARC_hx21_02_itms.05949.05949.2	4.577	0.3128	100.0%	1692.3922	1692.7826	1	5.766	60.5%	1	L.GGFGGGAGGGDGGILTANEK.S	2
*	PARC_hx21_02_itms.03500.03500.2	2.9477	0.2633	100.0%	1066.3121	1066.1742	7	5.912	87.5%	1	K.STMQELNSR.L	2
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx21_03_itms.09660.09660.3	4.7468	0.257	100.0%	2378.7844	2378.5981	1	5.918	38.8%	1	R.LASYLDKVQALEEANNDLENK.I	3
*	PARC_hx21_03_itms.09639.09639.2	4.577	0.4114	100.0%	2379.132	2378.5981	1	7.586	55.0%	1	R.LASYLDKVQALEEANNDLENK.I	2
*	PARC_hx21_02_itms.03675.03675.2	4.5319	0.4745	100.0%	1587.5922	1587.6836	1	7.981	73.1%	3	K.VQALEEANNDLENK.I	2
*	PARC_hx21_02_itms.04370.04370.1	1.9866	0.1281	100.0%	967.42	968.05383	11	4.317	66.7%	5	K.IQDWYDK.K	1
*	PARC_hx21_02_itms.04343.04343.2	2.7611	0.106	99.9%	968.1722	968.05383	115	4.46	83.3%	4	K.IQDWYDK.K	2
*	PARC_hx21_02_itms.04871.04871.1	1.8321	0.1174	100.0%	1095.44	1096.2279	11	3.643	64.3%	1	K.IQDWYDKK.G	1
*	PARC_hx21_02_itms.04868.04868.2	2.5639	0.0134	99.1%	1095.9321	1096.2279	125	3.177	71.4%	2	K.IQDWYDKK.G	2
*	PARC_hx21_04_itms.08628.08628.2	1.9189	0.1218	97.6%	812.7322	812.98773	62	4.293	78.6%	1	K.KGPAAIQK.N	2
*	PARC_hx21_02_itms.07784.07784.2	3.3139	0.2825	100.0%	1606.7922	1606.7289	1	5.852	79.2%	3	K.NYSPYYNTIDDLK.D	2
*	PARC_hx21_03_itms.13521.13521.2	4.8924	0.4432	100.0%	2903.8123	2904.1597	1	8.299	41.7%	19	K.NYSPYYNTIDDLKDQIVDLTVGNNK.T	2
*	PARC_hx21_05_itms.20810.20810.3	5.919	0.4933	100.0%	2904.7444	2904.1597	1	8.752	36.5%	35	K.NYSPYYNTIDDLKDQIVDLTVGNNK.T	3
*	PARC_hx21_03_itms.12918.12918.3	5.1421	0.4595	100.0%	2626.7344	2626.88	1	7.967	36.4%	1	Y.SPYYNTIDDLKDQIVDLTVGNNK.T	3
*	PARC_hx21_03_itms.12008.12008.2	5.6937	0.5041	100.0%	2278.872	2279.509	1	8.862	63.2%	3	Y.YNTIDDLKDQIVDLTVGNNK.T	2
*	PARC_hx21_03_itms.10730.10730.2	4.2928	0.2566	98.7%	2001.7722	2002.2291	1	6.704	52.9%	1	N.TIDDLKDQIVDLTVGNNK.T	2
*	PARC_hx21_02_itms.06056.06056.2	4.8454	0.3587	100.0%	1315.7322	1316.4539	1	7.193	86.4%	4	K.DQIVDLTVGNNK.T	2
*	PARC_hx21_02_itms.06212.06212.2	3.1568	0.187	100.0%	1061.7522	1061.1802	1	4.607	93.8%	3	K.TLLDIDNTR.M	2
*	PARC_hx21_02_itms.06141.06141.1	2.5332	0.1895	100.0%	1062.63	1061.1802	1	4.732	62.5%	2	K.TLLDIDNTR.M	1
*	PARC_hx21_02_itms.06584.06584.1	2.1133	0.0529	100.0%	897.42	898.02155	5	3.997	75.0%	3	R.MTLDDFR.I	1
*	PARC_hx21_02_itms.06705.06705.2	2.2682	0.1346	99.8%	897.77216	898.02155	1	4.541	91.7%	3	R.MTLDDFR.I	2
*	PARC_hx21_03_itms.07329.07329.2	3.0871	0.1749	99.9%	1309.7322	1308.5383	4	4.667	72.2%	15	R.IKFEMEQNLR.Q	2
*	PARC_hx21_02_itms.05121.05121.1	1.8311	0.0408	97.2%	1066.55	1067.2048	37	3.948	57.1%	1	K.FEMEQNLR.Q	1
*	PARC_hx21_02_itms.05168.05168.2	2.5353	0.1907	99.9%	1066.9722	1067.2048	28	4.832	78.6%	3	K.FEMEQNLR.Q	2
*	PARC_hx21_02_itms.04845.04845.2	3.5541	0.3449	100.0%	1158.2722	1158.2566	1	5.885	85.0%	7	R.QGVDADINGLR.Q	2
*	PARC_hx21_02_itms.06158.06158.1	1.8787	0.1386	100.0%	1190.5	1191.385	39	3.485	61.1%	3	R.QVLDNLTMEK.S	1
*	PARC_hx21_02_itms.06140.06140.2	3.0648	0.1929	99.9%	1192.3522	1191.385	13	4.573	72.2%	3	R.QVLDNLTMEK.S	2
*	PARC_hx21_05_itms.19558.19558.2	5.0625	0.2655	100.0%	2302.892	2300.6443	1	6.323	69.4%	3	E.KSDLEMQYETLQEELMALK.K	2
*	PARC_hx21_05_itms.20364.20364.2	5.9978	0.3278	100.0%	2174.8123	2172.4702	1	7.352	70.6%	22	K.SDLEMQYETLQEELMALK.K	2
*	PARC_hx21_04_itms.16545.16545.3	3.277	0.1983	100.0%	2300.4243	2300.6443	1	4.581	36.1%	5	K.SDLEMQYETLQEELMALKK.N	3
*	PARC_hx21_03_itms.12269.12269.2	5.4176	0.428	100.0%	2303.172	2300.6443	1	7.913	69.4%	11	K.SDLEMQYETLQEELMALKK.N	2
*	PARC_hx21_03_itms.07496.07496.3	5.3919	0.2583	100.0%	2898.1143	2897.1462	1	5.661	32.7%	9	K.NHKEEMSQLTGQNSGDVNVEINVAPGK.D	3
*	PARC_hx21_04_itms.04380.04380.2	4.4475	0.4605	100.0%	2518.0122	2517.727	1	8.402	41.3%	3	K.EEMSQLTGQNSGDVNVEINVAPGK.D	2
*	PARC_hx21_03_itms.09638.09638.2	3.1432	0.2455	99.9%	1852.9521	1853.1003	1	4.194	67.9%	2	K.TLNDMRQEYEQLIAK.N	2
*	PARC_hx21_02_itms.05102.05102.1	2.3221	0.0866	100.0%	1121.62	1122.2633	9	3.675	68.8%	1	R.QEYEQLIAK.N	1
*	PARC_hx21_04_itms.15000.15000.3	6.8686	0.4451	100.0%	3393.7444	3394.5872	1	7.287	31.0%	7	R.KDIENQYETQITQIEHEVSSSGQEVQSSAK.E	3
*	PARC_hx21_03_itms.02063.02063.2	5.1116	0.4411	100.0%	3266.112	3266.413	1	7.932	41.1%	2	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E	2
*	PARC_hx21_02_itms.11804.11804.3	6.4441	0.4802	100.0%	3266.3643	3266.413	1	8.829	36.6%	10	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E	3
*	PARC_hx21_05_itms.15860.15860.2	6.7683	0.4848	100.0%	1838.5721	1839.0557	1	8.659	80.0%	29	R.HGVQELEIELQSQLSK.K	2
*	PARC_hx21_04_itms.14840.14840.3	5.1252	0.2573	100.0%	1839.4443	1839.0557	2	5.426	48.3%	4	R.HGVQELEIELQSQLSK.K	3
*	PARC_hx21_03_itms.15485.15485.2	5.8787	0.5105	100.0%	2737.7922	2739.0388	1	9.113	54.5%	10	R.YCGQLQMIQEQISNLEAQITDVR.Q	2
*	PARC_hx21_04_itms.19990.19990.3	5.7828	0.5187	100.0%	2738.6943	2739.0388	1	8.77	44.3%	6	R.YCGQLQMIQEQISNLEAQITDVR.Q	3
*	PARC_hx21_02_itms.09652.09652.2	5.4903	0.4433	100.0%	1859.7922	1858.0587	1	8.482	76.7%	3	M.IQEQISNLEAQITDVR.Q	2
*	PARC_hx21_02_itms.10412.10412.2	5.846	0.4614	100.0%	2095.5522	2096.308	1	8.942	68.8%	17	R.QEIECQNQEYSLLLSIK.M	2
*	PARC_hx21_03_itms.00884.00884.2	5.3736	0.4627	100.0%	2510.9922	2511.6177	1	8.11	59.1%	20	K.EIETYHNLLEGGQEDFESSGAGK.I	2
*	PARC_hx21_03_itms.00860.00860.3	6.4981	0.3258	100.0%	2512.1943	2511.6177	1	7.134	39.8%	16	K.EIETYHNLLEGGQEDFESSGAGK.I	3
*	PARC_hx21_02_itms.06172.06172.2	5.5151	0.4385	100.0%	1875.3722	1875.9463	1	8.772	76.5%	1	Y.HNLLEGGQEDFESSGAGK.I	2
*	PARC_hx21_02_itms.03801.03801.2	4.6993	0.3924	100.0%	1792.4321	1792.7324	1	10.153	45.5%	1	R.GGSGGSYGGGGSGGGYGGGSGSR.G	2
*	PARC_hx21_05_itms.09802.09802.3	5.4438	0.2721	100.0%	4974.9844	4975.706	1	7.473	14.2%	7	R.GGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSR.G	3
*	PARC_hx21_02_itms.04563.04563.2	6.4377	0.6313	100.0%	3223.7722	3225.1118	1	12.735	43.6%	1	R.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S	2
*	PARC_hx21_02_itms.04448.04448.3	8.7673	0.6024	100.0%	3224.8145	3225.1118	1	10.961	28.8%	6	R.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S	3

Similarities: contaminant_KERATIN03(1:59)
contaminant_KERATIN05(1:59)
contaminant_KERATIN08(1:59)
contaminant_KERATIN12(1:59)
contaminant_KERATIN07(1:59)
contaminant_KERATIN10(1:59)

contaminant_KERATIN22

233

65.0%

645

65865

8.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.10322.10322.2	4.492	0.4468	100.0%	1412.5922	1411.5173	1	8.047	75.0%	1	F.RGFSSGSAVVSGGSR.R	2
*	PARC_hx21_02_itms.04593.04593.1	2.1705	0.3936	100.0%	1254.5	1255.3298	3	5.991	50.0%	1	R.GFSSGSAVVSGGSR.R	1
*	PARC_hx21_02_itms.04583.04583.2	5.1925	0.4635	100.0%	1255.1122	1255.3298	1	8.403	84.6%	4	R.GFSSGSAVVSGGSR.R	2
*	PARC_hx21_03_itms.05488.05488.2	3.101	0.3842	100.0%	1288.4922	1288.369	1	5.97	70.0%	1	R.RSTSSFSCLSR.H	2
*	PARC_hx21_02_itms.05000.05000.2	3.0172	0.3302	100.0%	1131.7122	1132.1816	1	6.321	77.8%	2	R.STSSFSCLSR.H	2
*	PARC_hx21_05_itms.12833.12833.2	2.0071	0.1984	98.6%	2434.4722	2434.5127	1	3.919	32.0%	1	R.STSSFSCLSRHGGGGGGFGGGGFGSR.S	2
*	PARC_hx21_05_itms.12830.12830.3	3.8861	0.2403	100.0%	2436.6843	2434.5127	1	5.734	36.0%	1	R.STSSFSCLSRHGGGGGGFGGGGFGSR.S	3
*	PARC_hx21_05_itms.10895.10895.2	5.0618	0.3098	100.0%	1321.3722	1321.3542	1	9.588	90.0%	8	R.HGGGGGGFGGGGFGSR.S	2
*	PARC_hx21_05_itms.10664.10664.1	4.4368	0.2958	100.0%	1321.63	1321.3542	1	8.121	66.7%	4	R.HGGGGGGFGGGGFGSR.S	1
*	PARC_hx21_02_itms.05240.05240.1	1.7658	0.2202	100.0%	832.55	831.9878	23	4.798	50.0%	3	R.SLVGLGGTK.S	1
*	PARC_hx21_04_itms.06225.06225.2	6.0488	0.629	100.0%	1839.4321	1840.0055	1	11.336	69.0%	27	K.SISISVAGGGGGFGAAGGFGGR.G	2
*	PARC_hx21_03_itms.07335.07335.2	4.6159	0.5267	100.0%	1552.5322	1552.6896	1	10.131	66.7%	1	S.ISVAGGGGGFGAAGGFGGR.G	2
*	PARC_hx21_05_itms.15752.15752.2	4.8247	0.1506	100.0%	2832.9922	2832.8809	1	8.012	35.7%	2	R.GGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F	2
*	PARC_hx21_05_itms.14912.14912.2	5.4214	0.0489	96.5%	2400.0923	2400.4446	1	6.589	50.0%	4	G.GSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F	2
*	PARC_hx21_05_itms.15749.15749.2	2.7712	0.3654	96.3%	2053.1921	2052.0862	4	6.184	28.0%	1	F.GGGSGFGGGSGFSGGGFGGGGFGGGR.F	2
*	PARC_hx21_03_itms.07017.07017.2	2.992	0.3158	96.5%	1475.4521	1475.5198	1	5.961	61.8%	1	G.GSGFSGGGFGGGGFGGGR.F	2
	PARC_hx21_03_itms.07805.07805.2	2.9028	0.3079	100.0%	1398.8722	1398.6017	1	5.903	68.2%	1	K.TLNNKFASFIDK.V	2 2 2 2 2
	PARC_hx21_02_itms.05688.05688.1	2.9372	0.1443	100.0%	1475.57	1476.6726	15	4.843	54.5%	1	R.FLEQQNQVLQTK.W	1 1
	PARC_hx21_02_itms.05750.05750.2	4.6064	0.0377	100.0%	1476.3322	1476.6726	1	6.381	90.9%	3	R.FLEQQNQVLQTK.W	2 2
*	PARC_hx21_02_itms.09662.09662.2	3.3923	0.3111	100.0%	1476.1721	1475.7057	1	6.818	68.2%	1	K.WELLQQMNVGTR.P	2
*	PARC_hx21_04_itms.19832.19832.3	8.0202	0.4812	100.0%	3304.6443	3304.8315	1	8.018	38.9%	10	K.WELLQQMNVGTRPINLEPIFQGYIDSLK.R	3
*	PARC_hx21_05_itms.19942.19942.2	3.9968	0.2946	98.7%	2260.8123	2261.6262	1	5.108	42.1%	1	N.VGTRPINLEPIFQGYIDSLK.R	2
*	PARC_hx21_05_itms.19943.19943.3	5.129	0.3183	100.0%	2261.1543	2261.6262	1	6.421	47.4%	3	N.VGTRPINLEPIFQGYIDSLK.R	3
*	PARC_hx21_05_itms.20825.20825.3	4.5597	0.4676	100.0%	2004.2043	2004.3367	1	6.835	40.6%	1	R.PINLEPIFQGYIDSLKR.Y	3
*	PARC_hx21_02_itms.05576.05576.2	3.6653	0.3303	100.0%	1037.8522	1038.1454	1	6.447	93.8%	2	R.YLDGLTAER.T	2
*	PARC_hx21_02_itms.05543.05543.1	2.0425	0.2426	100.0%	1039.61	1038.1454	85	5.006	50.0%	2	R.YLDGLTAER.T	1
*	PARC_hx21_02_itms.09580.09580.2	6.0055	0.435	100.0%	2132.0723	2129.2598	1	9.093	73.5%	6	R.TSQNSELNNMQDLVEDYK.K	2
*	PARC_hx21_02_itms.08690.08690.3	4.4408	0.2825	100.0%	2257.8542	2257.4338	1	6.636	38.9%	8	R.TSQNSELNNMQDLVEDYKK.K	3
*	PARC_hx21_03_itms.01299.01299.2	4.7548	0.3051	100.0%	2259.872	2257.4338	1	7.088	47.2%	15	R.TSQNSELNNMQDLVEDYKK.K	2
*	PARC_hx21_02_itms.05830.05830.1	2.3907	0.18	100.0%	1208.63	1209.3416	3	4.628	60.0%	1	R.TAAENDFVTLK.K	1
*	PARC_hx21_02_itms.05918.05918.2	3.142	0.3634	100.0%	1209.2522	1209.3416	1	6.135	80.0%	3	R.TAAENDFVTLK.K	2
*	PARC_hx21_02_itms.05285.05285.2	3.6805	0.2339	100.0%	1336.5322	1337.5156	1	5.246	81.8%	1	R.TAAENDFVTLKK.D	2
*	PARC_hx21_02_itms.04466.04466.2	3.5735	0.1561	100.0%	1197.2722	1197.3917	1	5.226	77.8%	2	K.KDVDNAYMIK.V	2
*	PARC_hx21_02_itms.04719.04719.2	3.2308	0.3137	100.0%	1068.9521	1069.2177	1	5.718	81.2%	2	K.DVDNAYMIK.V	2
*	PARC_hx21_02_itms.04697.04697.1	2.5872	0.2682	100.0%	1070.37	1069.2177	1	5.553	75.0%	4	K.DVDNAYMIK.V	1
*	PARC_hx21_02_itms.11564.11564.2	4.7322	0.0568	100.0%	1461.0122	1461.6982	1	5.762	86.4%	23	K.VDLLNQEIEFLK.V	2
*	PARC_hx21_04_itms.15819.15819.3	5.821	0.4688	100.0%	3049.6143	3050.3674	1	8.706	36.5%	7	K.VLYDAEISQIHQSVTDTNVILSMDNSR.N	3
	PARC_hx21_02_itms.11883.11883.1	3.0587	0.283	100.0%	1329.51	1330.5211	1	5.392	68.2%	1	R.NLDLDSIIAEVK.A	1 1 1 1
	PARC_hx21_02_itms.11852.11852.2	4.6752	0.2481	100.0%	1331.4321	1330.5211	1	6.13	86.4%	19	R.NLDLDSIIAEVK.A	2 2 2 2
	PARC_hx21_02_itms.03381.03381.2	3.1391	0.2845	100.0%	1107.6721	1108.196	1	5.801	87.5%	1	K.AQYEEIAQR.S	2 2 2 2
*	PARC_hx21_02_itms.05667.05667.2	4.1595	0.258	100.0%	1194.3722	1194.33	1	6.616	94.4%	8	K.YEELQVTVGR.H	2
*	PARC_hx21_03_itms.07731.07731.2	2.4732	0.1191	99.6%	1344.5922	1344.551	1	3.805	85.0%	2	K.EIKIEISELNR.V	2
	PARC_hx21_02_itms.05332.05332.2	3.1668	0.1237	99.9%	974.1922	974.102	10	4.27	92.9%	3	K.IEISELNR.V	2 2
	PARC_hx21_02_itms.05289.05289.1	2.5227	0.0355	100.0%	975.56	974.102	3	3.374	78.6%	4	K.IEISELNR.V	1 1
*	PARC_hx21_03_itms.05001.05001.2	2.4684	0.2652	99.9%	1123.1522	1123.3408	1	5.341	72.2%	1	R.LQGEIAHVKK.Q	2
*	PARC_hx21_02_itms.05306.05306.2	4.5904	0.3348	100.0%	1329.7122	1330.3971	1	7.871	86.4%	4	K.NVQDAIADAEQR.G	2
*	PARC_hx21_03_itms.08704.08704.3	3.1139	0.1836	98.3%	1965.4744	1966.1179	20	4.257	32.4%	1	K.NVQDAIADAEQRGEHALK.D	3
*	PARC_hx21_05_itms.14298.14298.2	3.6962	0.265	100.0%	1965.6921	1966.1179	1	6.407	52.9%	3	K.NVQDAIADAEQRGEHALK.D	2
*	PARC_hx21_03_itms.01620.01620.2	3.8472	0.3633	100.0%	1613.7522	1614.796	1	6.21	73.1%	2	R.NKLNDLEEALQQAK.E	2
*	PARC_hx21_02_itms.07728.07728.1	2.4101	0.2846	100.0%	1371.63	1372.5181	1	5.445	54.5%	1	K.LNDLEEALQQAK.E	1
*	PARC_hx21_02_itms.07700.07700.2	5.3122	0.2686	100.0%	1372.0521	1372.5181	1	6.573	90.9%	5	K.LNDLEEALQQAK.E	2
	PARC_hx21_03_itms.08238.08238.2	3.3647	0.236	100.0%	1521.8722	1522.8029	1	5.66	72.7%	1	R.LLRDYQELMNVK.L	2 2 2
	PARC_hx21_02_itms.06287.06287.1	3.2827	0.2485	100.0%	1139.38	1140.2965	1	5.516	75.0%	3	R.DYQELMNVK.L	1 1 1
	PARC_hx21_02_itms.06314.06314.2	3.3972	0.2265	100.0%	1140.6122	1140.2965	2	5.555	81.2%	2	R.DYQELMNVK.L	2 2 2
	PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2
	PARC_hx21_02_itms.03338.03338.2	2.6093	0.0401	99.6%	1006.27216	1006.0667	2	4.252	92.9%	1	K.LLEGEECR.M	2 2 2 2 2
*	PARC_hx21_03_itms.02075.02075.2	5.0244	0.4409	100.0%	2459.0122	2459.685	1	7.967	47.9%	5	R.MSGDLSSNVTVSVTSSTISSNVASK.A	2
*	PARC_hx21_02_itms.04702.04702.2	3.081	0.3539	100.0%	2502.2122	2502.4893	1	6.688	28.6%	1	K.AAFGGSGGRGSSSGGGYSSGSSSYGSGGR.Q	2

Similarities: contaminant_KERATIN21(5:53)
contaminant_KERATIN13(4:54)
contaminant_KERATIN18(6:52)
contaminant_KERATIN17(5:53)
contaminant_KERATIN15(5:53)
contaminant_KERATIN14(6:52)
contaminant_KERATIN16(1:57)

contaminant_KERATIN03

450

59.5%

593

59519

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.04247.04247.2	3.6771	0.3925	100.0%	1551.3121	1550.551	1	6.728	60.5%	1	R.SGGGGGGGGCGGGGGVSSLR.I	2
*	PARC_hx21_05_itms.12772.12772.2	4.2869	0.3552	100.0%	2097.652	2098.193	1	7.343	52.3%	1	I.SSSKGSLGGGFSSGGFSGGSFSR.G	2
*	PARC_hx21_03_itms.00974.00974.2	5.9298	0.5631	100.0%	1709.4521	1708.7844	1	10.222	66.7%	60	K.GSLGGGFSSGGFSGGSFSR.G	2
*	PARC_hx21_03_itms.00971.00971.2	2.8067	0.287	96.0%	1765.0322	1765.8363	62	5.546	31.6%	1	K.GSLGGGFSSGGFSGGSFSRG.S	2
*	PARC_hx21_03_itms.07860.07860.2	3.7841	0.5042	100.0%	1652.7322	1651.7324	1	8.572	47.1%	1	G.SLGGGFSSGGFSGGSFSR.G	2
*	PARC_hx21_02_itms.09910.09910.2	4.016	0.4204	100.0%	2117.5723	2116.2107	2	7.607	37.5%	1	F.GGGGFGGGFGGGFGGDGGLLSGNEK.V	2
	PARC_hx21_02_itms.03807.03807.2	2.8778	0.1405	99.9%	1091.0721	1091.2273	5	4.425	87.5%	2	K.VTMQNLNDR.L	2 2 2
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx21_02_itms.03662.03662.2	3.2528	0.3175	100.0%	1382.3322	1382.4668	2	6.493	68.2%	1	R.ALEESNYELEGK.I	2
*	PARC_hx21_03_itms.03422.03422.2	3.4911	0.507	100.0%	1118.8322	1119.1416	1	8.383	94.4%	8	K.HGNSHQGEPR.D	2
*	PARC_hx21_03_itms.15065.15065.3	6.3861	0.4323	100.0%	3053.3643	3054.4277	1	7.365	33.7%	11	K.TIDDLKNQILNLTTDNANILLQIDNAR.L	3
*	PARC_hx21_03_itms.01724.01724.2	6.5252	0.3466	100.0%	2368.4722	2368.6523	1	7.717	65.0%	27	K.NQILNLTTDNANILLQIDNAR.L	2
*	PARC_hx21_02_itms.12426.12426.3	7.0841	0.2994	100.0%	2369.0645	2368.6523	1	6.648	50.0%	5	K.NQILNLTTDNANILLQIDNAR.L	3
*	PARC_hx21_03_itms.05961.05961.2	3.5006	0.2987	100.0%	1234.9321	1235.4258	1	5.506	88.9%	7	R.LKYENEVALR.Q	2
*	PARC_hx21_02_itms.03494.03494.2	3.0555	0.2979	100.0%	994.1122	994.0923	1	6.113	92.9%	1	K.YENEVALR.Q	2
	PARC_hx21_02_itms.05583.05583.2	3.3027	0.2055	100.0%	1202.4321	1202.3097	1	5.2	80.0%	5	R.QSVEADINGLR.R	2 2
*	PARC_hx21_03_itms.07250.07250.2	2.6601	0.1201	99.8%	1188.3922	1188.4099	2	3.98	77.8%	1	R.RVLDELTLTK.A	2
*	PARC_hx21_02_itms.06651.06651.2	3.5074	0.2672	100.0%	1031.9321	1032.2224	2	5.115	87.5%	3	R.VLDELTLTK.A	2
*	PARC_hx21_02_itms.06662.06662.1	2.1229	0.0692	100.0%	1033.65	1032.2224	5	3.741	75.0%	3	R.VLDELTLTK.A	1
*	PARC_hx21_02_itms.15134.15134.2	3.2932	0.3876	98.7%	1856.0922	1856.0516	1	6.919	53.3%	1	K.ADLEMQIESLTEELAY.L	2
*	PARC_hx21_03_itms.01931.01931.2	5.6425	0.4228	100.0%	2098.2922	2097.3853	1	8.532	73.5%	30	K.ADLEMQIESLTEELAYLK.K	2
*	PARC_hx21_05_itms.21800.21800.3	3.5485	0.139	98.3%	2225.7544	2225.5593	3	4.636	34.7%	3	K.ADLEMQIESLTEELAYLKK.N	3
*	PARC_hx21_03_itms.14243.14243.2	3.8913	0.2653	100.0%	2225.872	2225.5593	1	5.908	50.0%	1	K.ADLEMQIESLTEELAYLKK.N	2
*	PARC_hx21_03_itms.01980.01980.3	5.557	0.4025	100.0%	2873.8743	2874.2134	1	7.264	35.6%	1	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S	3
*	PARC_hx21_03_itms.01959.01959.2	6.1736	0.5087	100.0%	2874.0723	2874.2134	1	9.076	48.1%	7	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S	2
*	PARC_hx21_02_itms.12174.12174.2	2.8356	0.3466	96.4%	1614.5122	1613.8724	1	5.612	53.6%	1	N.AAPGVDLTQLLNNMR.S	2
*	PARC_hx21_02_itms.03518.03518.2	4.2479	0.3797	100.0%	1367.4321	1366.43	1	6.999	85.0%	1	R.SQYEQLAEQNR.K	2
*	PARC_hx21_02_itms.04346.04346.2	3.6377	0.269	100.0%	1494.2122	1494.6041	3	5.597	72.7%	7	R.SQYEQLAEQNRK.D	2
*	PARC_hx21_02_itms.06336.06336.1	2.585	0.2901	100.0%	1109.51	1110.1681	3	6.134	68.8%	5	K.DAEAWFNEK.S	1
*	PARC_hx21_02_itms.06452.06452.2	3.3764	0.1882	100.0%	1110.0922	1110.1681	1	6.007	81.2%	5	K.DAEAWFNEK.S	2
*	PARC_hx21_02_itms.10019.10019.2	3.3033	0.2676	96.5%	2084.412	2085.2292	1	5.317	52.9%	1	K.SKELTTEIDNNIEQISSY.K	2
*	PARC_hx21_04_itms.14084.14084.2	6.1959	0.5531	100.0%	2212.872	2213.4033	1	9.987	72.2%	20	K.SKELTTEIDNNIEQISSYK.S	2
*	PARC_hx21_04_itms.14126.14126.3	5.0827	0.3494	100.0%	2213.2444	2213.4033	1	6.183	44.4%	4	K.SKELTTEIDNNIEQISSYK.S	3
*	PARC_hx21_04_itms.14498.14498.2	5.8272	0.4172	100.0%	1996.9122	1998.151	1	9.49	71.9%	38	K.ELTTEIDNNIEQISSYK.S	2
*	PARC_hx21_02_itms.03470.03470.1	1.5117	0.1502	100.0%	847.53	847.94385	3	3.499	75.0%	1	K.SEITELR.R	1
*	PARC_hx21_02_itms.04358.04358.2	2.0978	0.1333	99.3%	1004.2322	1004.1313	5	3.512	85.7%	2	K.SEITELRR.N	2
*	PARC_hx21_03_itms.11684.11684.2	5.6601	0.3943	100.0%	1797.6522	1798.0898	1	7.309	80.0%	57	R.NVQALEIELQSQLALK.Q	2
*	PARC_hx21_03_itms.01678.01678.3	5.1144	0.273	100.0%	1798.1643	1798.0898	1	6.034	50.0%	2	R.NVQALEIELQSQLALK.Q	3
*	PARC_hx21_02_itms.05727.05727.1	1.8917	0.3053	100.0%	1392.56	1391.4778	18	5.286	45.8%	1	K.QSLEASLAETEGR.Y	1
*	PARC_hx21_02_itms.05769.05769.2	4.5112	0.4269	100.0%	1394.1322	1391.4778	1	7.761	83.3%	10	K.QSLEASLAETEGR.Y	2
*	PARC_hx21_04_itms.20175.20175.3	3.3517	0.2496	100.0%	4120.6143	4120.5293	1	4.548	16.4%	8	K.QSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIR.A	3
*	PARC_hx21_04_itms.20175.20175.2	6.7665	0.4887	100.0%	2747.412	2748.0747	1	9.233	61.4%	44	R.YCVQLSQIQAQISALEEQLQQIR.A	3
*	PARC_hx21_05_itms.24569.24569.3	6.2744	0.4383	100.0%	2748.8044	2748.0747	1	7.767	42.0%	22	R.YCVQLSQIQAQISALEEQLQQIR.A	3
*	PARC_hx21_05_itms.19595.19595.2	3.7942	0.2158	96.4%	2083.872	2084.3372	1	5.939	58.8%	2	L.SQIQAQISALEEQLQQIR.A	2
*	PARC_hx21_02_itms.08186.08186.2	4.386	0.2527	99.2%	1428.3922	1428.6285	1	5.266	81.8%	3	Q.ISALEEQLQQIR.A	2
*	PARC_hx21_03_itms.01065.01065.2	5.9245	0.3228	100.0%	2086.5723	2084.2104	1	7.03	65.6%	25	R.AETECQNTEYQQLLDIK.I	2
*	PARC_hx21_03_itms.06692.06692.2	4.1754	0.2976	100.0%	1435.6122	1435.623	1	6.587	85.0%	6	K.IRLENEIQTYR.S	2
*	PARC_hx21_02_itms.03561.03561.2	3.6268	0.2404	100.0%	1166.1721	1166.2761	3	4.461	93.8%	1	R.LENEIQTYR.S	2
*	PARC_hx21_02_itms.03677.03677.2	3.6059	0.4567	100.0%	1264.2722	1263.3066	1	8.147	80.8%	1	R.SLLEGEGSSGGGGR.G	2

Similarities: contaminant_KERATIN02(1:48)
contaminant_KERATIN05(2:47)
contaminant_KERATIN08(2:47)
contaminant_KERATIN12(1:48)
contaminant_KERATIN07(1:48)
contaminant_KERATIN10(1:48)
contaminant_KERATIN04(1:48)

contaminant_KERATIN21

58.5%

357

39219

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_03_itms.12874.12874.2	4.5382	0.3482	100.0%	1891.4521	1892.1216	1	7.375	75.0%	7	-.QNLEPLFEQYINNLR.R	2 2 2
	PARC_hx21_03_itms.12920.12920.3	4.3878	0.3487	100.0%	1891.9143	1892.1216	1	6.125	44.6%	1	-.QNLEPLFEQYINNLR.R	3 3 3
	PARC_hx21_02_itms.04694.04694.2	1.8244	0.135	96.9%	1016.83215	1017.1271	1	4.732	81.2%	2	R.QLDSIVGER.G	2 2 2
*	PARC_hx21_02_itms.08822.08822.2	3.6044	0.3382	100.0%	1182.1322	1182.3337	1	6.591	83.3%	3	R.GMQDLVEDFK.N	2
	PARC_hx21_02_itms.06014.06014.2	3.0645	0.286	100.0%	1223.3322	1223.3684	1	5.505	75.0%	1	R.TAAENEFVTLK.K	2 2
	PARC_hx21_02_itms.05523.05523.2	3.5576	0.3297	100.0%	1352.4321	1351.5425	1	5.705	72.7%	2	R.TAAENEFVTLKK.D	2 2
	PARC_hx21_02_itms.10292.10292.2	3.7273	0.2722	100.0%	1409.7522	1408.551	1	5.344	81.8%	3	K.ADTLTDEINFLR.A	2 2
	PARC_hx21_02_itms.07187.07187.2	3.4056	0.3613	99.3%	1506.4122	1507.6581	1	6.904	70.8%	1	R.ALYDAELSQMQTH.I	2 2
	PARC_hx21_02_itms.06472.06472.2	3.2878	0.3453	95.7%	1551.4722	1551.7118	1	6.742	57.7%	1	H.ISDTSVVLSMDNNR.N	2 2 2
	PARC_hx21_02_itms.11883.11883.1	3.0587	0.283	100.0%	1329.51	1330.5211	1	5.392	68.2%	1	R.NLDLDSIIAEVK.A	1 1 1 1
	PARC_hx21_02_itms.11852.11852.2	4.6752	0.2481	100.0%	1331.4321	1330.5211	1	6.13	86.4%	19	R.NLDLDSIIAEVK.A	2 2 2 2
	PARC_hx21_02_itms.03381.03381.2	3.1391	0.2845	100.0%	1107.6721	1108.196	1	5.801	87.5%	1	K.AQYEEIAQR.S	2 2 2 2
	PARC_hx21_02_itms.04392.04392.2	3.7087	0.3614	100.0%	1212.6122	1213.2891	1	7.002	83.3%	3	R.AEAESWYQTK.Y	2 2
	PARC_hx21_02_itms.07246.07246.2	4.6406	0.4876	100.0%	1659.3922	1659.7625	1	7.906	75.0%	2	K.QCANLQAAIADAEQR.G	2 2
	PARC_hx21_02_itms.06783.06783.2	4.2645	0.2972	100.0%	1358.1322	1358.5345	1	5.753	86.4%	3	K.NKLEGLEDALQK.A	2 2
	PARC_hx21_02_itms.06330.06330.2	3.1425	0.328	100.0%	1115.9321	1116.2566	1	5.608	88.9%	1	K.LEGLEDALQK.A	2 2
	PARC_hx21_04_itms.13433.13433.2	3.8257	0.3687	100.0%	1508.3722	1508.8163	1	7.012	77.3%	2	R.LLKEYQELMNVK.L	2 2
	PARC_hx21_02_itms.05595.05595.2	2.6616	0.149	99.9%	1153.8522	1154.3234	4	4.191	81.2%	2	K.EYQELMNVK.L	2 2
	PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2
	PARC_hx21_02_itms.03338.03338.2	2.6093	0.0401	99.6%	1006.27216	1006.0667	2	4.252	92.9%	1	K.LLEGEECR.L	2 2 2 2 2
	PARC_hx21_02_itms.06058.06058.2	3.5123	0.4766	100.0%	1618.5721	1619.6879	1	8.177	44.1%	1	Y.SYGSGLGVGGGFSSSSGR.A	2 2
*	PARC_hx21_02_itms.05613.05613.2	4.5589	0.4431	100.0%	1447.8722	1448.6163	1	8.367	68.8%	2	R.AIGGGLSSVGGGSSTIK.Y	2

Similarities: contaminant_KERATIN22(5:17)
contaminant_KERATIN18(20:2)
contaminant_KERATIN17(7:15)
contaminant_KERATIN15(2:20)
contaminant_KERATIN14(2:20)
contaminant_KERATIN16(1:21)

YOR106W

56.9%

283

32498

7.0

VAM3 SGDID:S000005632, Chr XV from 519121-519972, Verified ORF, "Syntaxin-related protein required for vacuolar assembly; functions with Vam7p in vacuolar protein trafficking; member of the syntaxin family of proteins"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.11516.11516.2	4.7923	0.4651	100.0%	1637.3322	1637.7869	1	8.217	80.8%	6	K.ELSNLIETFAEQSR.V	2
*	PARC_hx21_03_itms.07760.07760.2	5.1091	0.4094	100.0%	1825.7922	1824.0503	1	7.005	82.1%	5	R.YKIETELIPNCTSVR.D	2
*	PARC_hx21_02_itms.06663.06663.2	3.8106	0.2563	100.0%	1531.8722	1532.7002	3	5.247	79.2%	3	K.IETELIPNCTSVR.D	2
*	PARC_hx21_03_itms.06040.06040.2	3.0303	0.1711	99.9%	1609.5322	1609.8229	1	4.745	65.4%	2	R.DKIESNILIHQNGK.L	2
*	PARC_hx21_02_itms.04544.04544.2	3.8446	0.371	100.0%	1415.3121	1415.5051	1	6.583	85.0%	2	K.YQSLQQSYNQR.K	2
*	PARC_hx21_04_itms.11913.11913.2	2.7209	0.1214	99.9%	833.3522	833.0617	13	4.245	100.0%	5	R.KSLFPLK.T	2
*	PARC_hx21_02_itms.03968.03968.2	2.3613	0.0444	98.0%	888.5722	888.0086	9	3.513	75.0%	1	K.TPISPGTSK.E	2
*	PARC_hx21_02_itms.05536.05536.2	2.1417	0.0849	97.1%	1270.2722	1267.3782	1	3.266	65.0%	3	R.QDPESSYISIK.V	2
*	PARC_hx21_04_itms.15082.15082.3	3.4782	0.3134	100.0%	5266.2544	5266.62	27	5.321	12.2%	1	K.VNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQER.S	3
*	PARC_hx21_05_itms.13780.13780.2	3.0897	0.2017	95.9%	1213.6921	1213.4655	1	5.109	80.0%	1	N.AIFHQLGSLVK.E	2
*	PARC_hx21_03_itms.07848.07848.2	3.4371	0.37	100.0%	2866.3523	2867.0332	1	6.985	33.3%	1	K.EQGEQVTTIDENISHLHDNMQNANK.Q	2
*	PARC_hx21_03_itms.07850.07850.3	3.5894	0.3601	100.0%	2867.5144	2867.0332	1	6.021	29.2%	3	K.EQGEQVTTIDENISHLHDNMQNANK.Q	3

YLR093C

56.5%

253

28964

5.7

NYV1 SGDID:S000004083, Chr XII from 327416-327401,327259-326514, reverse complement, Verified ORF, "v-SNARE component of the vacuolar SNARE complex involved in vesicle fusion; inhibits ATP-dependent Ca(2+) transport activity of Pmc1p in the vacuolar membrane"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.13010.13010.2	3.4737	0.1254	99.9%	1354.1721	1354.5919	1	5.079	80.0%	6	K.RFNVSYVEVIK.N	2
*	PARC_hx21_03_itms.00927.00927.2	3.3043	0.2597	100.0%	1198.0521	1198.4044	1	5.34	83.3%	6	R.FNVSYVEVIK.N	2
*	PARC_hx21_02_itms.07514.07514.2	4.3049	0.4106	100.0%	1643.1122	1643.7595	1	7.716	69.2%	5	K.NGETISSCFQPFQK.N	2
*	PARC_hx21_04_itms.20330.20330.3	6.2884	0.4339	100.0%	3406.0745	3404.921	1	8.08	29.3%	10	K.NENYGTITSANEQITPVIFHNLIMDMVLPK.V	3
*	PARC_hx21_05_itms.24792.24792.3	3.566	0.2846	100.0%	4120.1045	4122.491	1	5.89	20.7%	1	R.ILSGLQEYESNATNELLSSHVGQILDSFHEELVEYR.N	3
*	PARC_hx21_03_itms.02031.02031.3	3.9092	0.3534	100.0%	4768.974	4765.989	1	5.473	17.0%	1	R.NQTLNSSGNGQSSNGNGQNTISDIGDATEDQIKDVIQIMNDNIDK.F	3
*	PARC_hx21_02_itms.08164.08164.2	4.2337	0.236	100.0%	1417.7722	1418.605	1	6.222	81.8%	2	K.DVIQIMNDNIDK.F	2
*	PARC_hx21_02_itms.05243.05243.1	2.2132	0.0667	100.0%	773.4	773.9481	2	3.663	75.0%	1	R.VSLLVDK.T	1

contaminant_KERATIN13

265

51.5%

643

65494

6.6

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.10814.10814.2	5.4903	0.421	100.0%	1965.7722	1965.2542	1	8.281	65.6%	2	N.QSLLQPLNVEIDPEIQK.V	2
*	PARC_hx21_02_itms.10791.10791.2	4.6985	0.3356	100.0%	1836.6721	1837.1234	1	7.204	76.7%	2	Q.SLLQPLNVEIDPEIQK.V	2
*	PARC_hx21_02_itms.09893.09893.2	3.6966	0.3147	96.8%	1750.7322	1750.0453	1	5.884	67.9%	1	S.LLQPLNVEIDPEIQK.V	2
*	PARC_hx21_02_itms.08853.08853.1	3.2927	0.1838	100.0%	1383.5	1384.5315	1	4.513	63.6%	4	K.SLNNQFASFIDK.V	1
*	PARC_hx21_02_itms.08978.08978.2	4.3266	0.2792	100.0%	1384.1921	1384.5315	1	6.098	81.8%	15	K.SLNNQFASFIDK.V	2
*	PARC_hx21_05_itms.15922.15922.2	4.0501	0.4459	100.0%	1639.5122	1639.8516	1	7.455	73.1%	5	K.SLNNQFASFIDKVR.F	2
*	PARC_hx21_05_itms.15966.15966.3	2.2629	0.1961	95.4%	1640.3944	1639.8516	4	3.987	44.2%	1	K.SLNNQFASFIDKVR.F	3
	PARC_hx21_02_itms.05688.05688.1	2.9372	0.1443	100.0%	1475.57	1476.6726	15	4.843	54.5%	1	R.FLEQQNQVLQTK.W	1 1
	PARC_hx21_02_itms.05750.05750.2	4.6064	0.0377	100.0%	1476.3322	1476.6726	1	6.381	90.9%	3	R.FLEQQNQVLQTK.W	2 2
*	PARC_hx21_05_itms.16492.16492.3	4.7336	0.3525	100.0%	2933.7544	2934.2786	1	6.203	29.3%	1	R.FLEQQNQVLQTKWELLQQVDTSTR.T	3
*	PARC_hx21_02_itms.08366.08366.1	1.9661	0.172	100.0%	1476.69	1476.6293	5	3.625	50.0%	1	K.WELLQQVDTSTR.T	1
*	PARC_hx21_03_itms.01178.01178.2	4.8796	0.4305	100.0%	1479.4521	1476.6293	1	6.956	90.9%	29	K.WELLQQVDTSTR.T	2
*	PARC_hx21_02_itms.04886.04886.2	3.5327	0.2603	95.7%	1290.4922	1290.416	1	5.381	85.0%	1	W.ELLQQVDTSTR.T	2
*	PARC_hx21_02_itms.09452.09452.2	2.8449	0.2156	95.7%	1384.7522	1384.4875	1	5.179	65.0%	1	R.THNLEPYFESF.I	2
*	PARC_hx21_05_itms.19124.19124.2	4.8075	0.5079	100.0%	1994.6921	1995.2017	1	8.371	76.7%	21	R.THNLEPYFESFINNLR.R	2
*	PARC_hx21_04_itms.17063.17063.3	5.2302	0.3677	100.0%	1995.6543	1995.2017	1	6.372	51.7%	11	R.THNLEPYFESFINNLR.R	3
*	PARC_hx21_02_itms.06350.06350.2	3.6864	0.3302	100.0%	1301.1522	1301.4316	2	6.466	83.3%	7	K.NMQDMVEDYR.N	2
*	PARC_hx21_02_itms.06303.06303.1	2.8254	0.3546	100.0%	1302.44	1301.4316	47	5.386	66.7%	2	K.NMQDMVEDYR.N	1
*	PARC_hx21_02_itms.05708.05708.2	3.9336	0.3229	100.0%	1265.9521	1266.3934	1	6.426	85.0%	7	R.TNAENEFVTIK.K	2
*	PARC_hx21_02_itms.05718.05718.1	2.1901	0.0568	98.9%	1267.63	1266.3934	25	3.62	60.0%	2	R.TNAENEFVTIK.K	1
*	PARC_hx21_02_itms.05133.05133.2	3.8313	0.2623	100.0%	1394.5922	1394.5675	1	5.544	81.8%	5	R.TNAENEFVTIKK.D	2
*	PARC_hx21_02_itms.03327.03327.1	2.1361	0.2797	100.0%	999.48	1000.1114	7	5.823	56.2%	1	K.DVDGAYMTK.V	1
*	PARC_hx21_02_itms.03328.03328.2	2.6805	0.2117	99.9%	1000.3522	1000.1114	1	4.836	87.5%	1	K.DVDGAYMTK.V	2
*	PARC_hx21_02_itms.11583.11583.2	3.4313	0.2322	96.1%	1348.2722	1348.4955	1	5.34	85.0%	2	K.LDNLQQEIDFL.T	2
*	PARC_hx21_02_itms.12588.12588.2	3.0776	0.3979	99.3%	1520.5721	1520.6793	1	6.678	66.7%	1	K.LDNLQQEIDFLTA.L	2
*	PARC_hx21_02_itms.15644.15644.2	3.2837	0.4405	100.0%	1633.3121	1633.8389	1	6.904	69.2%	4	K.LDNLQQEIDFLTAL.Y	2
*	PARC_hx21_02_itms.16220.16220.2	3.3089	0.2678	96.5%	1799.3121	1797.0148	1	5.587	60.7%	3	K.LDNLQQEIDFLTALY.Q	2
*	PARC_hx21_02_itms.17700.17700.2	4.174	0.445	100.0%	2238.912	2238.4993	1	7.633	61.1%	1	K.LDNLQQEIDFLTALYQAEL.S	2
*	PARC_hx21_02_itms.19143.19143.3	4.911	0.4303	100.0%	3811.0444	3812.2808	1	6.895	32.8%	1	K.LDNLQQEIDFLTALYQAELSQMQTQISETNVIL.S	3
*	PARC_hx21_02_itms.03998.03998.2	4.4503	0.4141	100.0%	1341.0922	1341.4607	1	6.848	86.4%	3	K.SKAEAESLYQSK.Y	2
*	PARC_hx21_02_itms.03380.03380.2	4.0249	0.3476	100.0%	1125.6921	1126.2084	1	6.719	88.9%	1	K.AEAESLYQSK.Y	2
*	PARC_hx21_02_itms.03370.03370.1	2.4712	0.3255	100.0%	1125.74	1126.2084	1	6.086	66.7%	1	K.AEAESLYQSK.Y	1
*	PARC_hx21_03_itms.05889.05889.2	4.1338	0.2505	100.0%	1179.9321	1180.303	1	6.156	94.4%	21	K.YEELQITAGR.H	2
*	PARC_hx21_02_itms.05423.05423.1	2.9776	0.2418	100.0%	1181.6	1180.303	4	4.985	72.2%	6	K.YEELQITAGR.H	1
*	PARC_hx21_02_itms.05447.05447.2	2.3266	0.1518	99.6%	1303.1122	1303.4581	1	3.492	75.0%	1	R.NSKIEISELNR.V	2
	PARC_hx21_02_itms.05332.05332.2	3.1668	0.1237	99.9%	974.1922	974.102	10	4.27	92.9%	3	K.IEISELNR.V	2 2
	PARC_hx21_02_itms.05289.05289.1	2.5227	0.0355	100.0%	975.56	974.102	3	3.374	78.6%	4	K.IEISELNR.V	1 1
*	PARC_hx21_02_itms.03446.03446.2	2.5466	0.043	99.6%	932.8122	933.0495	33	3.539	85.7%	1	R.SEIDNVKK.Q	2
*	PARC_hx21_03_itms.06344.06344.2	2.2733	0.234	99.7%	1847.6322	1846.0073	26	4.408	46.7%	1	K.KQISNLQQSISDAEQR.G	2
*	PARC_hx21_02_itms.06362.06362.2	4.9334	0.4432	100.0%	1717.5521	1717.8333	1	8.619	75.0%	11	K.QISNLQQSISDAEQR.G	2
*	PARC_hx21_02_itms.06300.06300.3	3.6992	0.1576	100.0%	1718.1543	1717.8333	12	4.653	42.9%	1	K.QISNLQQSISDAEQR.G	3
*	PARC_hx21_03_itms.09752.09752.3	2.9575	0.1831	98.4%	2330.3643	2330.5168	159	4.513	26.2%	1	K.QISNLQQSISDAEQRGENALK.D	3
*	PARC_hx21_03_itms.09758.09758.2	2.7769	0.1928	99.8%	2330.672	2330.5168	71	5.086	30.0%	1	K.QISNLQQSISDAEQRGENALK.D	2
*	PARC_hx21_04_itms.14745.14745.3	3.5819	0.3398	100.0%	2644.7944	2644.8582	15	6.026	26.1%	3	K.QISNLQQSISDAEQRGENALKDAK.N	3
*	PARC_hx21_03_itms.08558.08558.2	5.2274	0.2436	100.0%	1601.6721	1600.769	1	6.661	84.6%	10	K.NKLNDLEDALQQAK.E	2
*	PARC_hx21_02_itms.07142.07142.1	3.0509	0.2922	100.0%	1357.67	1358.4912	1	6.492	63.6%	3	K.LNDLEDALQQAK.E	1
*	PARC_hx21_02_itms.07130.07130.2	5.5638	0.2548	100.0%	1360.0521	1358.4912	1	6.611	90.9%	8	K.LNDLEDALQQAK.E	2
*	PARC_hx21_03_itms.07574.07574.2	3.0585	0.2084	99.9%	1525.4922	1524.7754	1	5.028	72.7%	2	R.LLRDYQELMNTK.L	2
*	PARC_hx21_02_itms.05276.05276.2	3.3559	0.2257	100.0%	1141.6921	1142.2689	1	5.221	81.2%	4	R.DYQELMNTK.L	2
*	PARC_hx21_02_itms.05244.05244.1	3.3242	0.2145	100.0%	1143.53	1142.2689	1	5.504	75.0%	4	R.DYQELMNTK.L	1
*	PARC_hx21_02_itms.03567.03567.1	2.4527	0.2628	100.0%	1033.49	1034.1112	1	6.054	68.8%	1	R.TLLEGEESR.M	1
*	PARC_hx21_02_itms.03548.03548.2	2.7784	0.2015	99.9%	1033.9122	1034.1112	2	4.642	81.2%	1	R.TLLEGEESR.M	2
*	PARC_hx21_04_itms.11972.11972.3	3.4255	0.1456	98.4%	2565.9243	2566.7253	1	4.57	26.0%	11	R.MSGECAPNVSVTVSTSHTSISGGGSR.G	3
*	PARC_hx21_05_itms.11516.11516.2	3.3893	0.1241	99.9%	2568.8323	2566.7253	11	4.625	30.0%	19	R.MSGECAPNVSVTVSTSHTSISGGGSR.G	2
*	PARC_hx21_02_itms.04122.04122.2	6.0823	0.3371	100.0%	2387.372	2385.298	1	10.535	46.7%	6	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G	2
*	PARC_hx21_03_itms.00002.00002.3	4.2546	0.1618	100.0%	3314.7544	3314.2085	1	5.663	23.0%	1	R.GSYGSGGGSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYR.G	3

Similarities: contaminant_KERATIN22(4:52)

contaminant_KERATIN05

51.0%

471

51531

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.04784.04784.2	4.1743	0.3588	100.0%	1106.8722	1107.2181	1	6.48	95.0%	2	R.ISSVLAGGSCR.A	2
	PARC_hx21_02_itms.03807.03807.2	2.8778	0.1405	99.9%	1091.0721	1091.2273	5	4.425	87.5%	2	K.VTMQNLNDR.L	2 2 2
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
	PARC_hx21_02_itms.05618.05618.1	2.1083	0.1311	100.0%	919.46	920.0093	4	3.893	83.3%	3	K.DYSPYFK.T	1 1
*	PARC_hx21_03_itms.10378.10378.2	4.7715	0.1965	100.0%	2055.8323	2055.339	2	6.523	61.1%	3	K.ILTATVDNANVLLQIDNAR.L	2
*	PARC_hx21_02_itms.05445.05445.2	2.7632	0.2739	100.0%	1267.2122	1267.4246	1	5.008	77.8%	2	R.TKYETELNLR.M	2
*	PARC_hx21_02_itms.05206.05206.2	2.3962	0.2003	99.9%	1037.9321	1038.1454	21	4.8	85.7%	1	K.YETELNLR.M	2
	PARC_hx21_02_itms.06741.06741.2	4.1061	0.3656	100.0%	1204.8922	1205.3716	1	7.204	95.0%	1	R.MSVEADINGLR.R	2 2
	PARC_hx21_02_itms.07010.07010.2	3.9983	0.2582	100.0%	1030.5521	1030.2096	1	5.902	93.8%	3	R.VLDELTLAR.A	2 2 2 2 2
	PARC_hx21_02_itms.06945.06945.1	2.5928	0.2704	100.0%	1031.7	1030.2096	126	4.955	56.2%	3	R.VLDELTLAR.A	1 1 1 1 1
*	PARC_hx21_03_itms.00645.00645.2	2.3584	0.0548	97.5%	1277.4321	1277.4755	20	3.595	60.0%	1	R.ADLEMQIESLK.E	2
*	PARC_hx21_05_itms.20654.20654.2	5.3946	0.3897	100.0%	2124.7522	2124.454	1	7.752	73.5%	6	R.ADLEMQIESLKEELAYLK.K	2
*	PARC_hx21_02_itms.07647.07647.2	3.5649	0.2421	100.0%	2086.5723	2087.269	1	7.264	45.0%	1	R.GQVGGDVNVEMDAAPGVDLSR.I	2
*	PARC_hx21_03_itms.00732.00732.2	3.2085	0.2325	100.0%	1301.5922	1301.4412	1	5.594	77.8%	2	R.KDAEEWFFTK.T	2
*	PARC_hx21_02_itms.09360.09360.1	2.7901	0.2156	100.0%	1172.47	1173.2671	1	6.092	68.8%	3	K.DAEEWFFTK.T	1
*	PARC_hx21_02_itms.09479.09479.2	3.8009	0.3333	100.0%	1173.3322	1173.2671	1	6.316	81.2%	3	K.DAEEWFFTK.T	2
	PARC_hx21_02_itms.03345.03345.2	3.5213	0.4357	100.0%	1363.4321	1362.4796	1	7.835	66.7%	1	R.EVATNSELVQSGK.S	2 2
*	PARC_hx21_04_itms.15702.15702.2	5.2947	0.3791	100.0%	1894.5122	1894.2086	1	7.964	70.0%	6	R.TMQNLEIELQSQLSMK.A	2
	PARC_hx21_02_itms.03610.03610.2	3.1345	0.2329	100.0%	1220.9122	1221.3068	1	6.618	80.0%	1	K.ASLENSLEETK.G	2 2 2
*	PARC_hx21_03_itms.18077.18077.2	5.6495	0.5051	100.0%	2739.8323	2740.1282	1	8.781	56.8%	8	R.YCMQLAQIQEMIGSVEEQLAQLR.C	2
*	PARC_hx21_03_itms.18005.18005.3	5.1584	0.4247	100.0%	2740.2544	2740.1282	1	6.968	39.8%	4	R.YCMQLAQIQEMIGSVEEQLAQLR.C	3
	PARC_hx21_02_itms.03213.03213.2	4.3293	0.1198	100.0%	1486.9321	1487.5471	2	6.435	85.0%	1	R.CEMEQQNQEYK.I	2 2
	PARC_hx21_03_itms.06608.06608.2	3.6774	0.0932	99.9%	1380.2722	1380.5437	1	5.976	85.0%	1	K.TRLEQEIATYR.R	2 2 2 2 2
*	PARC_hx21_03_itms.06632.06632.3	4.7452	0.3655	100.0%	2466.9844	2466.5835	1	6.589	33.0%	2	R.RLLEGEDAHLSSSQFSSGSQSSR.D	3
*	PARC_hx21_02_itms.06952.06952.2	3.9956	0.3955	100.0%	1534.5122	1533.6348	1	7.383	80.8%	2	R.LLEGEDAHLSSSQF.S	2
*	PARC_hx21_02_itms.06184.06184.2	3.7085	0.4041	100.0%	1980.3322	1980.052	1	7.365	52.8%	1	R.LLEGEDAHLSSSQFSSGSQ.S	2
*	PARC_hx21_02_itms.05973.05973.2	6.0694	0.5668	100.0%	2309.4722	2310.396	1	9.522	52.4%	5	R.LLEGEDAHLSSSQFSSGSQSSR.D	2
*	PARC_hx21_02_itms.05914.05914.3	5.5854	0.4716	100.0%	2310.1143	2310.396	1	8.335	45.2%	3	R.LLEGEDAHLSSSQFSSGSQSSR.D	3

Similarities: contaminant_KERATIN02(1:27)
contaminant_KERATIN03(2:26)
contaminant_KERATIN08(7:21)
contaminant_KERATIN12(6:22)
contaminant_KERATIN07(5:23)
contaminant_KERATIN10(4:24)
contaminant_KERATIN04(1:27)

contaminant_KERATIN18

49.3%

562

59822

8.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_05_itms.09142.09142.2	1.9011	0.1154	96.9%	939.2322	939.01886	134	3.785	68.8%	1	R.RGFSASSAR.L	2
*	PARC_hx21_02_itms.05446.05446.2	3.3734	0.4368	100.0%	1027.1322	1027.1222	1	6.946	83.3%	1	R.SGFSSISVSR.S	2
*	PARC_hx21_02_itms.05456.05456.1	1.8643	0.0634	98.1%	881.47	882.0043	2	3.835	62.5%	1	R.SLYGLGGSK.R	1
*	PARC_hx21_03_itms.05778.05778.2	2.4011	0.2645	99.9%	1038.3121	1038.1918	2	6.041	72.2%	1	R.SLYGLGGSKR.I	2
*	PARC_hx21_02_itms.06050.06050.2	4.8753	0.4929	100.0%	1599.5521	1599.7069	1	9.015	53.1%	3	R.ISIGGGSCAISGGYGSR.A	2
	PARC_hx21_03_itms.07805.07805.2	2.9028	0.3079	100.0%	1398.8722	1398.6017	1	5.903	68.2%	1	K.TLNNKFASFIDK.V	2 2 2 2 2
	PARC_hx21_02_itms.06872.06872.2	3.9779	0.1547	100.0%	1203.9922	1204.3684	1	5.694	94.4%	3	K.WTLLQEQGTK.T	2 2
	PARC_hx21_03_itms.12874.12874.2	4.5382	0.3482	100.0%	1891.4521	1892.1216	1	7.375	75.0%	7	R.QNLEPLFEQYINNLR.R	2 2 2
	PARC_hx21_03_itms.12920.12920.3	4.3878	0.3487	100.0%	1891.9143	1892.1216	1	6.125	44.6%	1	R.QNLEPLFEQYINNLR.R	3 3 3
	PARC_hx21_02_itms.04694.04694.2	1.8244	0.135	96.9%	1016.83215	1017.1271	1	4.732	81.2%	2	R.QLDSIVGER.G	2 2 2
*	PARC_hx21_02_itms.08388.08388.2	3.311	0.1374	99.9%	1205.2522	1205.3685	42	4.261	72.2%	2	R.NMQDLVEDLK.N	2
	PARC_hx21_02_itms.06014.06014.2	3.0645	0.286	100.0%	1223.3322	1223.3684	1	5.505	75.0%	1	R.TAAENEFVTLK.K	2 2
	PARC_hx21_02_itms.05523.05523.2	3.5576	0.3297	100.0%	1352.4321	1351.5425	1	5.705	72.7%	2	R.TAAENEFVTLKK.D	2 2
	PARC_hx21_02_itms.10292.10292.2	3.7273	0.2722	100.0%	1409.7522	1408.551	1	5.344	81.8%	3	K.ADTLTDEINFLR.A	2 2
	PARC_hx21_02_itms.07187.07187.2	3.4056	0.3613	99.3%	1506.4122	1507.6581	1	6.904	70.8%	1	R.ALYDAELSQMQTH.I	2 2
	PARC_hx21_02_itms.06472.06472.2	3.2878	0.3453	95.7%	1551.4722	1551.7118	1	6.742	57.7%	1	H.ISDTSVVLSMDNNR.N	2 2 2
	PARC_hx21_02_itms.11883.11883.1	3.0587	0.283	100.0%	1329.51	1330.5211	1	5.392	68.2%	1	R.NLDLDSIIAEVK.A	1 1 1 1
	PARC_hx21_02_itms.11852.11852.2	4.6752	0.2481	100.0%	1331.4321	1330.5211	1	6.13	86.4%	19	R.NLDLDSIIAEVK.A	2 2 2 2
	PARC_hx21_02_itms.03381.03381.2	3.1391	0.2845	100.0%	1107.6721	1108.196	1	5.801	87.5%	1	K.AQYEEIAQR.S	2 2 2 2
	PARC_hx21_02_itms.04392.04392.2	3.7087	0.3614	100.0%	1212.6122	1213.2891	1	7.002	83.3%	3	R.AEAESWYQTK.Y	2 2
	PARC_hx21_02_itms.07246.07246.2	4.6406	0.4876	100.0%	1659.3922	1659.7625	1	7.906	75.0%	2	K.QCANLQAAIADAEQR.G	2 2
	PARC_hx21_02_itms.06783.06783.2	4.2645	0.2972	100.0%	1358.1322	1358.5345	1	5.753	86.4%	3	K.NKLEGLEDALQK.A	2 2
	PARC_hx21_02_itms.06330.06330.2	3.1425	0.328	100.0%	1115.9321	1116.2566	1	5.608	88.9%	1	K.LEGLEDALQK.A	2 2
	PARC_hx21_04_itms.13433.13433.2	3.8257	0.3687	100.0%	1508.3722	1508.8163	1	7.012	77.3%	2	R.LLKEYQELMNVK.L	2 2
	PARC_hx21_02_itms.05595.05595.2	2.6616	0.149	99.9%	1153.8522	1154.3234	4	4.191	81.2%	2	K.EYQELMNVK.L	2 2
	PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2
	PARC_hx21_02_itms.03338.03338.2	2.6093	0.0401	99.6%	1006.27216	1006.0667	2	4.252	92.9%	1	K.LLEGEECR.L	2 2 2 2 2
	PARC_hx21_02_itms.06058.06058.2	3.5123	0.4766	100.0%	1618.5721	1619.6879	1	8.177	44.1%	1	Y.SYGSGLGVGGGFSSSSGR.A	2 2
*	PARC_hx21_02_itms.04668.04668.2	4.2665	0.489	100.0%	1437.5322	1436.562	1	8.479	71.9%	2	R.ATGGGLSSVGGGSSTIK.Y	2

Similarities: contaminant_KERATIN22(6:23)
contaminant_KERATIN21(20:9)
contaminant_KERATIN17(9:20)
contaminant_KERATIN15(3:26)
contaminant_KERATIN14(3:26)
contaminant_KERATIN16(1:28)

contaminant_KERATIN08

46.1%

469

50499

5.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_02_itms.03807.03807.2	2.8778	0.1405	99.9%	1091.0721	1091.2273	5	4.425	87.5%	2	K.VTMQNLNDR.L	2 2 2
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx21_04_itms.12080.12080.2	3.1685	0.3514	100.0%	1758.5521	1758.9713	2	5.921	53.8%	1	R.QRPSEIKDYSPYFK.T	2
	PARC_hx21_02_itms.05618.05618.1	2.1083	0.1311	100.0%	919.46	920.0093	4	3.893	83.3%	3	K.DYSPYFK.T	1 1
	PARC_hx21_02_itms.07010.07010.2	3.9983	0.2582	100.0%	1030.5521	1030.2096	1	5.902	93.8%	3	R.VLDELTLAR.T	2 2 2 2 2
	PARC_hx21_02_itms.06945.06945.1	2.5928	0.2704	100.0%	1031.7	1030.2096	126	4.955	56.2%	3	R.VLDELTLAR.T	1 1 1 1 1
	PARC_hx21_02_itms.08136.08136.2	3.7319	0.255	100.0%	1279.5122	1277.4755	1	5.357	85.0%	1	R.TDLEMQIEGLK.E	2 2
*	PARC_hx21_05_itms.20697.20697.2	5.146	0.4949	100.0%	2152.0923	2152.4675	1	7.79	73.5%	5	R.TDLEMQIEGLKEELAYLR.K	2
*	PARC_hx21_05_itms.20673.20673.3	5.1856	0.4754	100.0%	2152.2544	2152.4675	1	8.35	45.6%	1	R.TDLEMQIEGLKEELAYLR.K	3
	PARC_hx21_02_itms.05772.05772.2	2.1422	0.0657	96.9%	1242.4521	1242.3923	443	3.441	61.1%	1	K.NHEEEMLALR.G	2 2
*	PARC_hx21_02_itms.07107.07107.2	5.0683	0.3902	100.0%	2089.872	2089.2415	1	8.205	57.5%	4	R.GQTGGDVNVEMDAAPGVDLSR.I	2
*	PARC_hx21_02_itms.08375.08375.1	2.5503	0.3749	100.0%	1096.64	1097.2126	1	6.555	68.8%	1	R.DAETWFLSK.T	1
*	PARC_hx21_02_itms.05559.05559.2	4.4436	0.4362	100.0%	2120.5322	2121.2659	1	7.632	55.6%	1	K.TEELNKEVASNSELVQSSR.S	2
*	PARC_hx21_02_itms.05586.05586.3	3.2585	0.1478	98.4%	2121.6243	2121.2659	7	4.087	31.9%	1	K.TEELNKEVASNSELVQSSR.S	3
*	PARC_hx21_03_itms.01667.01667.2	5.0562	0.3957	100.0%	1816.3922	1817.151	1	7.45	66.7%	4	R.VLQGLEIELQSQLSMK.A	2
	PARC_hx21_02_itms.03610.03610.2	3.1345	0.2329	100.0%	1220.9122	1221.3068	1	6.618	80.0%	1	K.ASLENSLEETK.G	2 2 2
*	PARC_hx21_03_itms.17645.17645.2	4.896	0.4675	100.0%	2665.7922	2666.0308	1	8.634	47.7%	4	R.YCMQLSQIQGLIGSVEEQLAQLR.C	2
*	PARC_hx21_02_itms.09723.09723.2	5.722	0.4001	100.0%	2143.5122	2142.3516	1	7.995	71.9%	3	R.CEMEQQSQEYQILLDVK.T	2
	PARC_hx21_03_itms.06608.06608.2	3.6774	0.0932	99.9%	1380.2722	1380.5437	1	5.976	85.0%	1	K.TRLEQEIATYR.R	2 2 2 2 2
*	PARC_hx21_02_itms.05537.05537.2	4.6131	0.3418	100.0%	2022.1522	2021.1045	1	6.782	69.4%	1	R.LLEGEDAHLSSQQASGQSY.S	2
*	PARC_hx21_02_itms.05223.05223.2	6.3029	0.5433	100.0%	2352.5923	2351.4485	1	9.398	61.9%	1	R.LLEGEDAHLSSQQASGQSYSSR.E	2

Similarities: contaminant_KERATIN02(1:20)
contaminant_KERATIN03(2:19)
contaminant_KERATIN05(7:14)
contaminant_KERATIN12(4:17)
contaminant_KERATIN07(6:15)
contaminant_KERATIN10(4:17)
contaminant_KERATIN04(1:20)

contaminant_UBIQUITIN08

44.7%

8565

7.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.00443.00443.2	3.8096	0.2429	100.0%	1788.1122	1788.9897	1	6.363	63.3%	4	K.TITLEVEPSDTIENVK.A	2
	PARC_hx21_02_itms.04664.04664.2	1.9728	0.1152	97.3%	1084.3922	1082.1986	5	4.122	81.2%	1	R.TLSDYNIQK.E	2
	PARC_hx21_03_itms.07070.07070.2	2.9047	0.3011	100.0%	1068.2922	1068.2615	1	5.529	93.8%	2	K.ESTLHLVLR.L	2

contaminant_SPA1_STAAU

173

43.5%

524

57320

5.7

owl|P02976| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS...

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_04_itms.15292.15292.3	6.0735	0.4313	100.0%	3101.0645	3102.3245	1	7.438	32.7%	4	A.NAAQHDEAQQNAFYQVLNMPNLNADQR.N	3
	PARC_hx21_04_itms.15274.15274.2	6.2645	0.5868	100.0%	2915.0923	2917.1418	1	11.251	56.2%	6	A.AQHDEAQQNAFYQVLNMPNLNADQR.N	2
	PARC_hx21_04_itms.15369.15369.3	7.4406	0.3086	100.0%	2916.8943	2917.1418	1	6.403	42.7%	15	A.AQHDEAQQNAFYQVLNMPNLNADQR.N	3
	PARC_hx21_05_itms.16413.16413.3	6.7827	0.4166	100.0%	2715.3542	2717.9324	1	8.726	48.9%	13	Q.HDEAQQNAFYQVLNMPNLNADQR.N	3
	PARC_hx21_04_itms.15393.15393.2	5.6574	0.5707	100.0%	2715.9521	2717.9324	1	10.407	54.5%	8	Q.HDEAQQNAFYQVLNMPNLNADQR.N	2
	PARC_hx21_02_itms.10256.10256.2	3.5523	0.1872	96.0%	1894.2122	1895.1431	1	5.188	60.0%	1	N.AFYQVLNMPNLNADQR.N	2
	PARC_hx21_02_itms.08091.08091.2	5.4264	0.3721	100.0%	1679.3722	1676.8877	1	7.13	84.6%	4	F.YQVLNMPNLNADQR.N	2
	PARC_hx21_02_itms.07011.07011.2	3.8912	0.2701	97.4%	1514.7322	1513.7118	1	5.971	83.3%	2	Y.QVLNMPNLNADQR.N	2
	PARC_hx21_02_itms.04208.04208.2	2.936	0.2169	95.8%	1173.3522	1173.2891	4	4.813	83.3%	2	L.NMPNLNADQR.N	2
	PARC_hx21_04_itms.14614.14614.3	4.6245	0.2864	100.0%	2601.5044	2603.8516	4	5.752	30.4%	1	Q.RNGFIQSLKDDPSQSANVLGEAQK.L	3
	PARC_hx21_02_itms.06093.06093.1	2.3214	0.03	98.9%	906.65	907.05743	67	4.388	64.3%	2	R.NGFIQSLK.D	1
	PARC_hx21_02_itms.06042.06042.2	2.869	0.1248	99.9%	906.7522	907.05743	3	4.908	92.9%	2	R.NGFIQSLK.D	2
	PARC_hx21_03_itms.06671.06671.2	2.8214	0.2018	95.3%	1137.0322	1137.2346	5	5.255	72.2%	1	R.NGFIQSLKDD.P	2
	PARC_hx21_03_itms.08445.08445.2	4.1083	0.2114	100.0%	2446.9922	2447.664	1	5.916	45.5%	2	R.NGFIQSLKDDPSQSANVLGEAQK.L	2
	PARC_hx21_03_itms.08447.08447.3	5.441	0.4706	100.0%	2447.0344	2447.664	1	8.025	39.8%	3	R.NGFIQSLKDDPSQSANVLGEAQK.L	3
	PARC_hx21_04_itms.10168.10168.2	3.9219	0.3349	100.0%	1329.4321	1329.4526	1	7.053	75.0%	1	D.PSQSANVLGEAQK.L	2
*	PARC_hx21_04_itms.16245.16245.3	5.0374	0.3415	100.0%	3514.2844	3513.7795	1	6.122	25.0%	4	K.ADAQQNNFNKDQQSAFYEILNMPNLNEAQR.N	3
*	PARC_hx21_02_itms.12338.12338.2	4.5961	0.4251	100.0%	2382.4521	2382.6099	1	6.395	52.6%	2	K.DQQSAFYEILNMPNLNEAQR.N	2
*	PARC_hx21_02_itms.07845.07845.2	4.3775	0.2416	99.3%	1545.3522	1542.7502	1	5.96	83.3%	3	Y.EILNMPNLNEAQR.N	2
	PARC_hx21_03_itms.10017.10017.2	3.3112	0.2197	95.9%	2503.152	2505.747	1	4.821	38.6%	2	Q.RNGFIQSLKDDPSQSTNVLGEAK.K	2
	PARC_hx21_03_itms.00633.00633.3	4.6161	0.2277	100.0%	2351.2144	2349.5596	1	5.277	39.3%	4	R.NGFIQSLKDDPSQSTNVLGEAK.K	3
	PARC_hx21_02_itms.08832.08832.2	3.8752	0.202	100.0%	2352.3523	2349.5596	8	4.252	42.9%	6	R.NGFIQSLKDDPSQSTNVLGEAK.K	2
	PARC_hx21_04_itms.10056.10056.2	3.6589	0.2573	95.8%	1231.3522	1231.3483	13	6.522	68.2%	1	D.PSQSTNVLGEAK.K	2
	PARC_hx21_05_itms.17441.17441.3	4.9391	0.2671	100.0%	3283.2544	3285.5286	1	5.975	30.8%	4	K.ADNNFNKEQQNAFYEILNMPNLNEEQR.N	3
	PARC_hx21_02_itms.12248.12248.2	4.7927	0.4258	100.0%	2481.5122	2481.699	1	7.325	52.6%	4	K.EQQNAFYEILNMPNLNEEQR.N	2
	PARC_hx21_02_itms.07773.07773.2	3.5346	0.2244	96.4%	1601.7122	1600.787	1	5.904	75.0%	2	Y.EILNMPNLNEEQR.N	2
*	PARC_hx21_04_itms.15219.15219.2	4.1641	0.3471	100.0%	2518.7122	2519.774	1	5.569	40.9%	2	Q.RNGFIQSLKDDPSQSANLLSEAK.K	2
*	PARC_hx21_03_itms.09280.09280.2	5.0266	0.3623	100.0%	2362.872	2363.5864	1	6.479	47.6%	3	R.NGFIQSLKDDPSQSANLLSEAK.K	2
*	PARC_hx21_02_itms.09906.09906.3	3.4235	0.1605	98.3%	2364.6243	2363.5864	1	4.559	33.3%	1	R.NGFIQSLKDDPSQSANLLSEAK.K	3
*	PARC_hx21_02_itms.04950.04950.2	2.5692	0.2056	99.8%	1472.7722	1475.5522	13	4.815	53.8%	1	K.DDPSQSANLLSEAK.K	2
*	PARC_hx21_04_itms.10684.10684.2	3.9638	0.3602	100.0%	1246.5721	1245.3751	1	6.9	90.9%	3	D.PSQSANLLSEAK.K	2
	PARC_hx21_04_itms.16778.16778.2	4.7166	0.4231	100.0%	2485.8123	2486.7031	1	7.231	50.0%	9	K.EQQNAFYEILHLPNLNEEQR.N	2
	PARC_hx21_04_itms.16977.16977.3	4.5119	0.2866	100.0%	2488.6743	2486.7031	1	6.177	31.6%	15	K.EQQNAFYEILHLPNLNEEQR.N	3
	PARC_hx21_05_itms.16865.16865.2	3.2305	0.2913	96.4%	1985.9722	1987.2224	1	5.982	50.0%	1	N.AFYEILHLPNLNEEQR.N	2
	PARC_hx21_03_itms.00434.00434.2	3.1993	0.3031	96.0%	1605.1921	1605.791	1	5.656	75.0%	2	Y.EILHLPNLNEEQR.N	2
	PARC_hx21_04_itms.15366.15366.2	3.9506	0.2077	96.2%	2502.392	2503.7747	1	5.149	40.9%	3	Q.RNGFIQSLKDDPSQSANLLAEAK.K	2
	PARC_hx21_03_itms.09506.09506.2	4.9664	0.2722	100.0%	2347.2922	2347.5872	1	5.72	50.0%	3	R.NGFIQSLKDDPSQSANLLAEAK.K	2
	PARC_hx21_03_itms.09453.09453.3	5.0082	0.2402	100.0%	2348.1543	2347.5872	1	6.645	39.3%	3	R.NGFIQSLKDDPSQSANLLAEAK.K	3
	PARC_hx21_02_itms.05352.05352.2	4.1555	0.4928	100.0%	1458.9521	1459.5529	1	7.981	84.6%	3	K.DDPSQSANLLAEAK.K	2
	PARC_hx21_03_itms.05504.05504.2	3.8254	0.3958	100.0%	1228.6122	1229.3757	1	7.164	90.9%	4	D.PSQSANLLAEAK.K	2
	PARC_hx21_05_itms.19168.19168.2	4.518	0.3989	100.0%	2472.912	2473.7043	1	7.245	47.4%	9	K.EQQNAFYEILHLPNLTEEQR.N	2
	PARC_hx21_05_itms.19154.19154.3	3.9553	0.2962	100.0%	2474.6643	2473.7043	1	6.319	31.6%	9	K.EQQNAFYEILHLPNLTEEQR.N	3
	PARC_hx21_03_itms.00975.00975.2	2.8668	0.244	95.7%	1592.0122	1592.7924	1	4.855	58.3%	1	Y.EILHLPNLTEEQR.N	2
	PARC_hx21_02_itms.06378.06378.2	4.0054	0.2637	100.0%	1635.6522	1635.8143	1	6.95	67.9%	2	R.NGFIQSLKDDPSVSK.E	2

YGL212W

42.4%

316

36711

8.4

VAM7 SGDID:S000003180, Chr VII from 91436-92386, Verified ORF, "Component of the vacuole SNARE complex involved in vacuolar morphogenesis; SNAP-25 homolog; functions with a syntaxin homolog Vam3p in vacuolar protein trafficking"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.06417.06417.2	3.2533	0.286	100.0%	1241.2522	1241.4294	1	6.474	85.0%	1	K.YVLYGVSTPNK.R	2
*	PARC_hx21_03_itms.06482.06482.2	2.6566	0.2832	99.9%	1398.5922	1397.617	4	4.58	63.6%	2	K.YVLYGVSTPNKR.L	2
*	PARC_hx21_02_itms.09266.09266.2	4.2061	0.4339	100.0%	2105.0122	2106.3398	1	6.823	50.0%	5	R.DVGSTIPYDFPEKPGVLDR.R	2
*	PARC_hx21_02_itms.06920.06920.2	3.2307	0.2231	100.0%	1184.3121	1184.2938	1	4.953	93.8%	3	R.FLNELYNDR.F	2
*	PARC_hx21_02_itms.07679.07679.2	3.2972	0.1937	100.0%	1164.4122	1163.3593	1	5.311	83.3%	2	K.IAQDFLQLSK.P	2
*	PARC_hx21_03_itms.07886.07886.2	5.4356	0.3529	100.0%	1945.7322	1946.2108	1	6.96	78.1%	10	K.IAQDFLQLSKPNVSQEK.S	2
*	PARC_hx21_03_itms.07841.07841.3	3.5514	0.0832	98.1%	1946.6943	1946.2108	1	3.794	45.3%	2	K.IAQDFLQLSKPNVSQEK.S	3
*	PARC_hx21_04_itms.13653.13653.2	6.5554	0.5398	100.0%	2144.5322	2145.308	1	10.246	76.5%	10	K.SQQHLETADEVGWDEMIR.D	2
*	PARC_hx21_03_itms.08662.08662.3	4.2781	0.3692	100.0%	2145.6843	2145.308	1	6.061	41.2%	1	K.SQQHLETADEVGWDEMIR.D	3
*	PARC_hx21_05_itms.11231.11231.2	5.309	0.5514	100.0%	1836.2722	1835.9658	1	11.01	61.8%	8	R.LLGVATSDNSSTTEVQGR.T	2
*	PARC_hx21_02_itms.05355.05355.2	4.082	0.3499	100.0%	1340.4722	1338.463	1	7.184	80.0%	3	R.DQEQELVALHR.I	2
*	PARC_hx21_05_itms.22469.22469.3	3.9212	0.237	100.0%	3391.1343	3389.6729	205	4.633	19.0%	2	R.GLALEMNEELQTQNELLTALEDDVDNTGRR.L	3

contaminant_KERATIN17

38.3%

590

62461

8.1

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.05848.05848.2	4.3347	0.4373	100.0%	1411.9521	1411.5547	1	7.459	80.8%	2	R.SFSTASAITPSVSR.T	2
*	PARC_hx21_03_itms.05084.05084.2	2.4037	0.279	95.6%	1041.0322	1041.1521	1	4.598	87.5%	1	S.RTSFTSVSR.S	2
*	PARC_hx21_02_itms.05584.05584.2	2.6734	0.0875	99.0%	1732.9321	1731.8221	2	4.327	50.0%	1	R.TSFTSVSRSGGGGGGGFGR.V	2
*	PARC_hx21_02_itms.05645.05645.2	4.2434	0.4738	100.0%	1411.1921	1411.5236	1	8.357	78.6%	2	R.VSLAGACGVGGYGSR.S	2
*	PARC_hx21_02_itms.05374.05374.1	2.0856	0.2054	100.0%	938.54	939.0562	37	4.462	56.2%	1	R.SLYNLGGSK.R	1
	PARC_hx21_03_itms.07805.07805.2	2.9028	0.3079	100.0%	1398.8722	1398.6017	1	5.903	68.2%	1	K.TLNNKFASFIDK.V	2 2 2 2 2
	PARC_hx21_02_itms.06872.06872.2	3.9779	0.1547	100.0%	1203.9922	1204.3684	1	5.694	94.4%	3	K.WTLLQEQGTK.T	2 2
	PARC_hx21_03_itms.12874.12874.2	4.5382	0.3482	100.0%	1891.4521	1892.1216	1	7.375	75.0%	7	R.QNLEPLFEQYINNLR.R	2 2 2
	PARC_hx21_03_itms.12920.12920.3	4.3878	0.3487	100.0%	1891.9143	1892.1216	1	6.125	44.6%	1	R.QNLEPLFEQYINNLR.R	3 3 3
	PARC_hx21_02_itms.04694.04694.2	1.8244	0.135	96.9%	1016.83215	1017.1271	1	4.732	81.2%	2	R.QLDSIVGER.G	2 2 2
*	PARC_hx21_02_itms.08972.08972.2	4.2076	0.0515	100.0%	1238.9321	1239.3856	4	5.89	83.3%	3	R.NMQDLVEDFK.N	2
*	PARC_hx21_02_itms.07299.07299.2	3.2551	0.2225	100.0%	1284.4521	1283.4822	1	5.656	75.0%	2	R.TTAENEFVMLK.K	2
*	PARC_hx21_02_itms.06258.06258.2	2.8209	0.2081	99.9%	1412.0322	1411.6562	2	4.303	68.2%	1	R.TTAENEFVMLKK.D	2
*	PARC_hx21_02_itms.10904.10904.2	4.9425	0.4345	100.0%	1425.9922	1426.6858	1	8.519	86.4%	2	K.VDALMDEINFMK.M	2
	PARC_hx21_02_itms.11883.11883.1	3.0587	0.283	100.0%	1329.51	1330.5211	1	5.392	68.2%	1	R.NLDLDSIIAEVK.A	1 1 1 1
	PARC_hx21_02_itms.11852.11852.2	4.6752	0.2481	100.0%	1331.4321	1330.5211	1	6.13	86.4%	19	R.NLDLDSIIAEVK.A	2 2 2 2
*	PARC_hx21_02_itms.05084.05084.2	2.3867	0.1168	99.1%	1485.9922	1486.5809	1	3.614	59.1%	1	R.SRTEAESWYQTK.Y	2
*	PARC_hx21_02_itms.04689.04689.2	3.8226	0.3668	100.0%	1245.8322	1243.3153	1	6.249	83.3%	4	R.TEAESWYQTK.Y	2
*	PARC_hx21_02_itms.03278.03278.2	3.6485	0.296	100.0%	1195.2522	1195.2743	1	6.076	94.4%	3	K.YEELQQTAGR.H	2
*	PARC_hx21_02_itms.06728.06728.2	4.7519	0.4383	100.0%	1703.8522	1702.7875	1	7.369	82.1%	3	K.QCANLQNAIADAEQR.G	2
*	PARC_hx21_03_itms.08566.08566.2	3.1947	0.0275	99.7%	1386.5322	1386.5883	2	3.759	81.8%	1	R.NKLAELEEALQK.A	2
*	PARC_hx21_02_itms.06428.06428.2	4.3632	0.2699	100.0%	1144.0922	1144.3104	1	5.3	88.9%	2	K.LAELEEALQK.A	2
*	PARC_hx21_02_itms.04257.04257.2	2.4768	0.2116	99.9%	1156.4321	1156.2959	3	4.35	81.2%	3	R.EYQELMNTK.L	2
	PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2
	PARC_hx21_02_itms.03338.03338.2	2.6093	0.0401	99.6%	1006.27216	1006.0667	2	4.252	92.9%	1	K.LLEGEECR.L	2 2 2 2 2

Similarities: contaminant_KERATIN22(5:20)
contaminant_KERATIN21(7:18)
contaminant_KERATIN18(9:16)
contaminant_KERATIN15(2:23)
contaminant_KERATIN14(3:22)

YDR481C

37.6%

566

63004

5.6

PHO8 SGDID:S000002889, Chr IV from 1420240-1418540, reverse complement, Verified ORF, "Repressible alkaline phosphatase, a glycoprotein localized to the vacuole; regulated by levels of inorganic phosphate and by a system consisting of Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.12876.12876.2	2.6102	0.1919	99.8%	2014.8322	2014.365	1	4.298	47.2%	1	K.NVIFFVTDGMGPASLSMAR.S	2
*	PARC_hx21_05_itms.21270.21270.3	7.7772	0.5218	100.0%	2984.3044	2984.2517	1	9.431	42.0%	2	R.SFNQHVNDLPIDDILTLDEHFIGSSR.T	3
*	PARC_hx21_02_itms.10658.10658.2	5.5769	0.5483	100.0%	2044.7922	2044.189	1	9.764	70.0%	5	R.SSDSLVTDSAAGATAFACALK.S	2
*	PARC_hx21_03_itms.09380.09380.2	4.3718	0.4721	100.0%	1365.4722	1364.6279	1	7.878	79.2%	2	K.LAGYLTGLVVTTR.I	2
*	PARC_hx21_02_itms.06074.06074.2	3.7372	0.4904	100.0%	1767.2722	1767.8926	1	8.42	73.3%	3	R.ITDATPASFSSHVDYR.W	2
*	PARC_hx21_03_itms.09722.09722.2	5.7092	0.4917	100.0%	2126.872	2127.364	1	9.424	73.5%	7	R.WQEDLIATHQLGEYPLGR.V	2
*	PARC_hx21_03_itms.09728.09728.3	4.4593	0.373	100.0%	2127.7444	2127.364	1	7.083	54.4%	3	R.WQEDLIATHQLGEYPLGR.V	3
*	PARC_hx21_02_itms.07096.07096.1	2.2044	0.1283	100.0%	1016.47	1017.2316	14	4.056	72.2%	2	R.VVDLLMGGGR.S	1
*	PARC_hx21_02_itms.07041.07041.2	3.5383	0.4172	100.0%	1017.1322	1017.2316	1	6.834	94.4%	1	R.VVDLLMGGGR.S	2
*	PARC_hx21_02_itms.09530.09530.2	5.144	0.4805	100.0%	1967.2522	1967.0587	1	8.881	68.8%	6	R.DLIDEAQSNGWQYVGDR.K	2
*	PARC_hx21_02_itms.06800.06800.1	2.1692	0.0191	99.0%	836.58	836.9634	12	2.913	83.3%	2	K.NFDSLLK.S	1
*	PARC_hx21_05_itms.15316.15316.2	4.7871	0.464	100.0%	2103.2322	2104.2556	1	8.534	58.3%	3	K.ASNEDKDSNGFFLMVEGSR.I	2
*	PARC_hx21_02_itms.06044.06044.2	3.2581	0.3216	100.0%	982.15216	982.14246	2	6.132	92.9%	1	K.LNDMVSFR.A	2
*	PARC_hx21_04_itms.22910.22910.3	5.8315	0.4462	100.0%	4549.1045	4549.9976	1	7.207	23.7%	2	K.ATWSYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIR.D	3
*	PARC_hx21_05_itms.26252.26252.3	4.8707	0.3544	100.0%	4190.094	4191.6006	1	5.883	22.9%	2	W.SYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIR.D	3
*	PARC_hx21_04_itms.22882.22882.3	3.9557	0.3859	100.0%	3613.0444	3614.9507	2	6.268	20.8%	1	N.NLQGNHENTEVGQFLENFLELNLNEVTDLIR.D	3

YMR197C

35.5%

217

24668

6.6

VTI1 SGDID:S000004810, Chr XIII from 659197-658544, reverse complement, Verified ORF, "Protein involved in cis-Golgi membrane traffic; v-SNARE that interacts with two t-SNARES, Sed5p and Pep12p; required for multiple vacuolar sorting pathways"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.05114.05114.2	3.4797	0.3604	100.0%	1455.2322	1455.6108	1	6.271	65.4%	2	K.ASLAEAPSQPLSQR.N	2
*	PARC_hx21_02_itms.07412.07412.2	5.419	0.4562	100.0%	1693.4122	1693.7673	1	8.718	82.1%	4	R.LFGDLNASNIDDDQR.Q	2
*	PARC_hx21_03_itms.06320.06320.2	3.1376	0.1242	99.9%	1393.1322	1393.6292	1	4.858	86.4%	4	R.QQLLSNHAILQK.S	2
*	PARC_hx21_02_itms.10806.10806.2	4.5809	0.4646	100.0%	1877.8522	1879.1536	1	8.783	59.4%	2	R.IANETEGIGSQIMMDLR.S	2
*	PARC_hx21_02_itms.03212.03212.1	2.3156	0.0070	99.0%	832.51	832.8888	28	3.541	75.0%	1	R.ETLENAR.Q	1
*	PARC_hx21_02_itms.06842.06842.2	3.9047	0.2828	100.0%	1415.3722	1415.5425	1	5.902	86.4%	3	R.QTLFQADSYVDK.S	2

contaminant_KERATIN12

34.8%

431

47974

5.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.04332.04332.2	2.7393	0.2934	100.0%	1034.2722	1035.1112	1	5.775	80.0%	1	R.LSGGLGAGSCR.L	2
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx21_03_itms.12100.12100.2	2.0073	0.1476	97.2%	1601.2522	1601.7972	73	4.088	42.3%	1	K.VRALEEANTELEVK.I	2
*	PARC_hx21_02_itms.07152.07152.2	3.4428	0.2647	100.0%	1187.4722	1187.3384	1	6.458	95.0%	1	R.LSVEADINGLR.R	2
	PARC_hx21_02_itms.07010.07010.2	3.9983	0.2582	100.0%	1030.5521	1030.2096	1	5.902	93.8%	3	R.VLDELTLAR.A	2 2 2 2 2
	PARC_hx21_02_itms.06945.06945.1	2.5928	0.2704	100.0%	1031.7	1030.2096	126	4.955	56.2%	3	R.VLDELTLAR.A	1 1 1 1 1
*	PARC_hx21_05_itms.20302.20302.2	4.2166	0.2462	100.0%	2151.0923	2151.4797	1	6.163	58.8%	3	R.ADLEMQIENLKEELAYLK.K	2
*	PARC_hx21_02_itms.09552.09552.2	3.5885	0.2941	100.0%	1145.5322	1145.2133	1	6.173	87.5%	1	K.DAEDWFFSK.T	2
	PARC_hx21_02_itms.03345.03345.2	3.5213	0.4357	100.0%	1363.4321	1362.4796	1	7.835	66.7%	1	R.EVATNSELVQSGK.S	2 2
*	PARC_hx21_03_itms.17678.17678.2	3.9547	0.4043	100.0%	2633.8523	2633.9707	1	6.721	43.2%	4	R.YCVQLSQIQGLIGSVEEQLAQLR.C	2
	PARC_hx21_02_itms.03213.03213.2	4.3293	0.1198	100.0%	1486.9321	1487.5471	2	6.435	85.0%	1	R.CEMEQQNQEYK.I	2 2
	PARC_hx21_03_itms.06608.06608.2	3.6774	0.0932	99.9%	1380.2722	1380.5437	1	5.976	85.0%	1	K.TRLEQEIATYR.R	2 2 2 2 2
*	PARC_hx21_02_itms.05752.05752.2	2.8297	0.3323	100.0%	1517.2122	1517.6787	2	6.0	54.2%	1	R.LLEGEDAHLTQYK.K	2

U	YFR031C-A	4	11	23.2%	254	27408	11.1	RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins"
U	YIL018W	4	11	23.2%	254	27408	11.1	RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures"

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_03_itms.05661.05661.2	3.1243	0.25	100.0%	1135.2122	1134.2369	9	5.582	70.0%	1	K.GAGSIFTSHTR.L	2
PARC_hx21_05_itms.15982.15982.3	5.4852	0.3852	100.0%	3178.4043	3177.5823	1	6.975	30.0%	2	K.KASLNVGNVLPLGSVPEGTIVSNVEEKPGDR.G	3 2
PARC_hx21_04_itms.15584.15584.3	4.8282	0.4296	100.0%	3048.1743	3049.4082	2	7.46	25.0%	5	K.ASLNVGNVLPLGSVPEGTIVSNVEEKPGDR.G	3
PARC_hx21_02_itms.06508.06508.2	4.055	0.3332	100.0%	1841.2322	1842.0183	1	5.912	53.1%	3	R.ASGNYVIIIGHNPDENK.T	2

U	YBR048W	3	3	23.1%	156	17749	10.8	RPS11B SGDID:S000000252, Chr II from 332829-332873,333385-333810, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Ap and has similarity to E. coli S17 and rat S11 ribosomal proteins"
U	YDR025W	3	3	23.1%	156	17749	10.8	RPS11A SGDID:S000002432, Chr IV from 491511-491555,491895-492320, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins"

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_03_itms.06128.06128.2	2.9972	0.1401	99.9%	1004.65216	1005.20465	3	3.777	92.9%	1	R.AYLHYIPK.Y	2
PARC_hx21_05_itms.11583.11583.2	2.077	0.1343	98.0%	1223.3322	1223.4202	4	3.982	70.0%	1	K.NVPVHVSPAFR.V	2
PARC_hx21_03_itms.07404.07404.2	2.303	0.2116	99.7%	1857.3922	1857.1266	1	4.535	43.8%	1	R.VQVGDIVTVGQCRPISK.T	2

U	YJL177W	3	5	22.8%	184	20551	10.9	RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins"
U	YKL180W	3	5	22.8%	184	20549	10.9	RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex"

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_02_itms.07014.07014.2	3.0309	0.1993	99.9%	1460.7722	1461.6146	4	4.472	58.3%	1	R.ETAQAINGWELTK.A	2
PARC_hx21_02_itms.07677.07677.2	4.9946	0.4263	100.0%	1645.5122	1645.8558	1	7.806	80.0%	2	K.FVQGLLQNAAANAEAK.G	2
PARC_hx21_03_itms.06140.06140.2	3.5862	0.3724	100.0%	1497.5322	1497.7373	1	6.323	75.0%	2	K.LYVSHIQVNQAPK.Q	2

YGL103W

22.1%

149

16722

10.6

RPL28 SGDID:S000003071, Chr VII from 310970-311018,311530-311930, Verified ORF, "Ribosomal protein L29 of the large (60S) ribosomal subunit, has similarity to E. coli L15 and rat L27a ribosomal proteins; may have peptidyl transferase activity; can mutate to cycloheximide resistance"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.05614.05614.1	1.7841	0.141	100.0%	968.6	969.0874	25	3.657	64.3%	1	K.YHPGYFGK.V	1
*	PARC_hx21_03_itms.00580.00580.2	2.9631	0.1608	99.9%	1270.7922	1271.5022	9	4.4	72.2%	4	K.LWTLIPEDKR.D	2
*	PARC_hx21_02_itms.08078.08078.2	4.1526	0.4999	100.0%	1506.6522	1506.6958	1	8.547	75.0%	3	K.ETAPVIDTLAAGYGK.I	2

U	YMR242C	2	2	18.0%	178	21236	10.3	RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein"
U	YOR312C	2	2	18.4%	174	20713	10.3	RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_02_itms.06179.06179.2	3.2325	0.1599	99.9%	1908.4122	1909.1063	1	5.855	52.9%	1	K.ASGEIVSINQINEAHPTK.V	2
	PARC_hx21_02_itms.09390.09390.2	4.2515	0.3409	100.0%	1541.6721	1538.7589	1	6.988	69.2%	1	R.VAAVETLYQDMAAR.H	2

U	YDL075W	2	2	15.9%	113	12953	10.0	RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p"
U	YLR406C	2	2	15.9%	113	12967	10.0	RPL31B SGDID:S000004398, Chr XII from 931753-931697,931347-931063, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Ap and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_03_itms.05532.05532.1	2.3145	0.2005	100.0%	787.56	787.9371	1	4.469	83.3%	1	R.LHGVSFK.K	1
	PARC_hx21_02_itms.08198.08198.2	2.4089	0.2779	99.9%	1283.3522	1283.5132	23	4.449	60.0%	1	R.LAPELNQAIWK.R	2

YKL100C

15.2%

587

67525

5.6

YKL100C SGDID:S000001583, Chr XI from 255104-253341, reverse complement, Uncharacterized ORF, "Hypothetical protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.15172.15172.2	5.1437	0.4578	100.0%	1842.7122	1840.9896	1	7.876	67.9%	3	K.YLNSFVDHLSEWSSR.A	2
*	PARC_hx21_05_itms.19880.19880.2	2.2282	0.0666	96.1%	2268.872	2269.4758	6	3.588	33.3%	1	K.ELEQVFEQINAIVENHNNK.L	2
*	PARC_hx21_04_itms.14403.14403.3	3.6435	0.3057	100.0%	2619.2043	2618.7441	2	6.319	28.8%	2	R.EHSLFDPTDFDVDHDCHVIYR.E	3
*	PARC_hx21_02_itms.07404.07404.2	3.3005	0.2333	100.0%	1227.7522	1226.4178	1	6.342	80.0%	1	K.IGGFVTNLNYK.D	2
*	PARC_hx21_03_itms.07164.07164.2	3.3359	0.3147	100.0%	1545.0922	1545.7504	1	6.063	77.3%	1	K.TLDEIEKDHWMK.H	2
*	PARC_hx21_02_itms.06390.06390.2	3.315	0.1737	95.8%	1373.7522	1372.4741	1	4.142	80.0%	1	W.NFQYDTIEVDK.S	2

U	YBL027W	2	2	14.8%	189	21704	11.4	RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"
U	YBR084C-A	2	2	14.8%	189	21704	11.4	RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_04_itms.10886.10886.2	2.7843	0.1944	99.9%	1057.7122	1057.2815	1	5.362	70.0%	1	K.RLAASVVGVGK.R	2
	PARC_hx21_02_itms.07764.07764.2	2.8883	0.2666	99.9%	1930.2322	1931.0691	1	5.124	46.9%	1	K.VWLDPNETSEIAQANSR.N	2

contaminant_KERATIN07

14.2%

473

50915

5.5

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx21_02_itms.09869.09869.3	5.0451	0.4326	100.0%	2065.6443	2065.3774	1	8.111	45.8%	1	K.IIAATIENAQPILQIDNAR.L	3
*	PARC_hx21_02_itms.09908.09908.2	5.3295	0.4357	100.0%	2065.9521	2065.3774	1	7.834	61.1%	13	K.IIAATIENAQPILQIDNAR.L	2
	PARC_hx21_02_itms.07010.07010.2	3.9983	0.2582	100.0%	1030.5521	1030.2096	1	5.902	93.8%	3	R.VLDELTLAR.T	2 2 2 2 2
	PARC_hx21_02_itms.06945.06945.1	2.5928	0.2704	100.0%	1031.7	1030.2096	126	4.955	56.2%	3	R.VLDELTLAR.T	1 1 1 1 1
	PARC_hx21_02_itms.05772.05772.2	2.1422	0.0657	96.9%	1242.4521	1242.3923	443	3.441	61.1%	1	K.NHEEEMLALR.G	2 2
	PARC_hx21_02_itms.03610.03610.2	3.1345	0.2329	100.0%	1220.9122	1221.3068	1	6.618	80.0%	1	K.ASLENSLEETK.G	2 2 2
	PARC_hx21_03_itms.06608.06608.2	3.6774	0.0932	99.9%	1380.2722	1380.5437	1	5.976	85.0%	1	K.TRLEQEIATYR.R	2 2 2 2 2

YBL092W

13.8%

130

14771

11.2

RPL32 SGDID:S000000188, Chr II from 45975-46367, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L32 ribosomal protein; overexpression disrupts telomeric silencing"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.10166.10166.2	2.386	0.0194	98.0%	873.15216	872.9994	67	2.73	71.4%	1	K.FLSPSGHK.T	2
*	PARC_hx21_02_itms.05820.05820.2	2.8276	0.2509	100.0%	1188.8522	1189.3691	1	4.868	77.8%	1	K.DLETLTMHTK.T	2

YFR032C-A

13.6%

6669

11.3

RPL29 SGDID:S000006437, Chr VI from 223425-223246, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L29 ribosomal protein; not essential for translation, but required for proper joining of the large and small ribosomal subunits and for normal translation rate"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_05_itms.09586.09586.1	1.6128	0.2	100.0%	834.15	834.9535	10	4.523	57.1%	1	K.HALHGTAK.A	1
*	PARC_hx21_05_itms.09536.09536.2	2.8347	0.2219	100.0%	835.1922	834.9535	1	6.066	100.0%	3	K.HALHGTAK.A	2

YLL029W

13.5%

749

84924

6.9

YLL029W SGDID:S000003952, Chr XII from 81460-83709, Uncharacterized ORF, "Hypothetical protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.06801.06801.2	3.4462	0.2759	100.0%	1500.5721	1500.5645	1	5.569	75.0%	1	R.DLLNFNDDHPDGK.S	2
*	PARC_hx21_02_itms.10180.10180.2	2.3883	0.2407	99.9%	1450.6322	1451.622	23	4.423	50.0%	1	R.QELDYNWTLLR.Q	2
*	PARC_hx21_02_itms.09772.09772.2	2.643	0.2273	99.9%	1861.4122	1861.9745	1	5.235	50.0%	1	R.QNEDPITWQEWCVR.E	2
*	PARC_hx21_05_itms.16468.16468.2	4.1446	0.3033	100.0%	1900.3722	1899.2585	1	6.468	56.2%	1	K.MTAQNFAIIHSPIDVLK.S	2
*	PARC_hx21_04_itms.14499.14499.2	2.5872	0.1711	99.7%	2177.132	2177.3386	2	3.966	38.9%	1	K.IYLCDSGSQFLEGTTDITR.T	2
*	PARC_hx21_02_itms.05565.05565.2	2.8941	0.2527	99.9%	1426.3922	1426.5687	8	4.71	58.3%	1	R.AGNIISNEPGYYK.D	2
*	PARC_hx21_05_itms.14222.14222.2	3.5106	0.3732	100.0%	1661.8922	1661.9414	1	6.386	69.2%	1	R.TIVHFLQPQSISYK.W	2

contaminant_NRL_1MCOH

12.9%

428

46852

8.9

owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain H...

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.04398.04398.1	2.0855	0.1859	100.0%	835.59	835.994	112	4.221	66.7%	2	K.DTLMISR.T	1
*	PARC_hx21_03_itms.00474.00474.2	2.5297	0.1956	99.8%	1678.6322	1677.8595	1	4.447	53.8%	1	K.FNWYVDGVQVHNAK.T	2
*	PARC_hx21_05_itms.18428.18428.2	3.2686	0.1357	99.9%	1810.9122	1809.1185	1	5.622	53.3%	2	R.VVSVLTVLHQNWLDGK.E	2
*	PARC_hx21_02_itms.04745.04745.1	1.8401	0.2352	100.0%	838.45	839.02264	1	4.866	71.4%	3	K.ALPAPIEK.T	1
*	PARC_hx21_02_itms.06884.06884.2	2.4044	0.1795	99.8%	1162.3522	1162.3379	20	4.423	61.1%	1	K.NQVSLTCLVK.G	2

contaminant_KERATIN15

115

12.6%

629

64511

6.5

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_03_itms.07805.07805.2	2.9028	0.3079	100.0%	1398.8722	1398.6017	1	5.903	68.2%	1	K.TLNNKFASFIDK.V	2 2 2 2 2
	PARC_hx21_02_itms.05822.05822.2	5.081	0.2736	100.0%	1476.6921	1477.7007	1	6.557	90.9%	7	R.FLEQQNKVLETK.W	2 2 2
	PARC_hx21_02_itms.05699.05699.1	3.4278	0.0383	100.0%	1477.59	1477.7007	8	5.131	54.5%	1	R.FLEQQNKVLETK.W	1 1 1
	PARC_hx21_02_itms.06472.06472.2	3.2878	0.3453	95.7%	1551.4722	1551.7118	1	6.742	57.7%	1	H.ISDTSVVLSMDNNR.S	2 2 2
*	PARC_hx21_02_itms.11990.11990.2	5.0367	0.291	100.0%	1303.3322	1303.4521	1	6.849	79.2%	83	R.SLDLDSIIAEVGA.Q	2
*	PARC_hx21_02_itms.11835.11835.1	3.2213	0.2792	100.0%	1304.56	1303.4521	9	5.369	54.2%	7	R.SLDLDSIIAEVGA.Q	1
*	PARC_hx21_02_itms.22500.22500.3	3.3761	0.2969	100.0%	1954.4343	1952.1223	7	5.721	35.3%	3	R.SLDLDSIIAEVGAQYEDI.A	3
	PARC_hx21_03_itms.08238.08238.2	3.3647	0.236	100.0%	1521.8722	1522.8029	1	5.66	72.7%	1	R.LLRDYQELMNVK.L	2 2 2
	PARC_hx21_02_itms.06287.06287.1	3.2827	0.2485	100.0%	1139.38	1140.2965	1	5.516	75.0%	3	R.DYQELMNVK.L	1 1 1
	PARC_hx21_02_itms.06314.06314.2	3.3972	0.2265	100.0%	1140.6122	1140.2965	2	5.555	81.2%	2	R.DYQELMNVK.L	2 2 2
	PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2

U	YHR203C	2	2	11.5%	261	29410	10.1	RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"
U	YJR145C	2	2	11.5%	261	29410	10.1	RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx21_03_itms.07425.07425.2	2.2647	0.1904	99.7%	1238.7122	1238.3885	1	5.151	65.0%	1	R.HDGGFDLVHIK.D	2
	PARC_hx21_05_itms.15982.15982.2	2.8233	0.1693	99.8%	2119.2722	2117.496	7	4.152	41.7%	1	R.LNNVFVIGEQGKPYISLPK.G	3 2

YOL060C

11.3%

706

77712

6.7

MAM3 SGDID:S000005421, Chr XV from 216136-214016, reverse complement, Verified ORF, "Protein required for normal mitochondrial morphology, has similarity to hemolysins"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.05376.05376.3	5.1897	0.4385	100.0%	3329.0942	3329.4343	1	7.201	28.3%	1	K.AADQADESSPLLSPSNSNHPSEHPQQDLNNK.S	3
*	PARC_hx21_04_itms.14295.14295.3	4.1436	0.2249	100.0%	3214.9443	3214.603	1	3.945	26.7%	3	R.SNAVLSPTPQVTEHGTIIPSNLASNPLNVNK.S	3
*	PARC_hx21_04_itms.12996.12996.2	5.2434	0.4526	100.0%	2014.0721	2014.1564	1	8.512	55.9%	3	K.SLSAEEQQLLSDHAELSR.Q	2

YOR291W

10.7%

1472

166749

6.1

YOR291W SGDID:S000005817, Chr XV from 861172-865590, Uncharacterized ORF, "Hypothetical protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.06560.06560.2	4.6157	0.4192	100.0%	1746.4922	1746.9121	1	7.819	60.0%	1	R.LTESEPLVLSSAEQSR.S	2
*	PARC_hx21_03_itms.06476.06476.3	3.6932	0.3103	100.0%	2440.5544	2440.545	3	5.503	27.3%	1	R.LGENSDTGFVYHSATHSSSSLSR.Y	3
*	PARC_hx21_05_itms.12758.12758.2	3.2999	0.3477	100.0%	1697.3522	1697.8931	1	7.105	54.2%	2	K.FYPQYAPNLHYQR.F	2
*	PARC_hx21_02_itms.09276.09276.2	3.2736	0.1901	99.9%	1531.2722	1530.6404	1	5.5	66.7%	1	K.FSLNDCSSPLDFK.S	2
*	PARC_hx21_02_itms.10368.10368.2	3.559	0.3788	100.0%	1490.2922	1490.6531	1	6.362	69.2%	2	R.SVDGNLLGDPLDFK.M	2
*	PARC_hx21_03_itms.09065.09065.3	5.8987	0.4053	100.0%	2732.7244	2731.895	1	7.646	40.2%	2	R.HEDDVFPENSEIIPAVVHPDSNNR.E	3
*	PARC_hx21_02_itms.10584.10584.2	3.5218	0.2277	100.0%	1128.3322	1128.27	1	6.217	87.5%	1	R.SFEFLSELR.R	2
*	PARC_hx21_02_itms.07954.07954.2	3.4881	0.3886	100.0%	1490.2522	1490.5688	1	7.459	63.6%	1	K.TNNDDVYWSFTK.G	2
*	PARC_hx21_02_itms.06394.06394.2	2.9186	0.2331	99.9%	1317.1522	1317.448	4	5.472	59.1%	1	K.GAPEVISEICNK.S	2
*	PARC_hx21_02_itms.09994.09994.2	2.7133	0.4359	100.0%	1378.4922	1377.537	1	6.882	72.7%	1	K.STLPADFEEVLR.C	2
*	PARC_hx21_03_itms.06642.06642.2	2.4974	0.3184	100.0%	1140.4321	1140.3862	1	5.114	81.2%	1	K.HELMIQLQK.L	2

YKL064W

10.2%

969

109736

7.5

MNR2 SGDID:S000001547, Chr XI from 317408-320317, Verified ORF, "Putative magnesium transporter; has similarity to Alr1p and Alr2p, which mediate influx of Mg2+ and other divalent cations"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.09150.09150.2	2.9735	0.2636	99.9%	1845.6721	1846.0471	2	5.039	43.8%	1	K.DEGVPLLSPYSSSPQLR.K	2
*	PARC_hx21_02_itms.05639.05639.2	4.5773	0.4797	100.0%	1814.3722	1814.0637	1	8.69	62.5%	1	R.EGPQSVSSTVQPQPIMK.F	2
*	PARC_hx21_02_itms.07198.07198.2	4.2894	0.3308	100.0%	1413.0521	1413.617	1	7.185	79.2%	2	R.IQSGLQDNLLVGR.N	2
*	PARC_hx21_03_itms.09372.09372.2	2.5166	0.196	99.8%	2192.2322	2193.462	4	4.214	32.5%	1	R.VDLDSTVHSPTISGLLQPGQK.F	2
*	PARC_hx21_02_itms.05856.05856.2	4.4953	0.4049	100.0%	1346.0922	1346.5236	1	7.953	83.3%	1	K.AETVSQLQGLTAK.N	2
*	PARC_hx21_05_itms.17530.17530.2	4.2359	0.3755	100.0%	2016.4922	2016.3042	1	7.549	58.8%	2	K.AFGIHPLTTEDIFLGEVR.E	2

YMR243C

9.7%

442

48345

6.4

ZRC1 SGDID:S000004856, Chr XIII from 756165-754837, reverse complement, Verified ORF, "Vacuolar membrane zinc transporter, transports zinc from the cytosol into the vacuole for storage; also has a role in resistance to zinc shock resulting from a sudden influx of zinc into the cytoplasm"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.07664.07664.2	4.9536	0.4245	100.0%	1855.6522	1856.1295	1	7.645	71.9%	2	R.ILLQATPSTISADQIQR.E	2
*	PARC_hx21_03_itms.07148.07148.3	4.5444	0.4265	100.0%	2675.3044	2676.7751	1	6.59	30.0%	2	R.FSIIAGGSPSSSQEAFDSHGNTEHGR.K	3
*	PARC_hx21_03_itms.07152.07152.2	3.4407	0.2955	100.0%	2676.612	2676.7751	1	5.945	34.0%	1	R.FSIIAGGSPSSSQEAFDSHGNTEHGR.K	2

contaminant_KERATIN10

9.5%

400

44106

5.1

no description

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_02_itms.04052.04052.1	2.2486	0.1324	100.0%	809.56	809.93774	23	4.58	75.0%	1	R.LASYLDK.V	1 1 1 1 1 1 1
PARC_hx21_02_itms.06741.06741.2	4.1061	0.3656	100.0%	1204.8922	1205.3716	1	7.204	95.0%	1	R.MSVEADINGLR.R	2 2
PARC_hx21_02_itms.07010.07010.2	3.9983	0.2582	100.0%	1030.5521	1030.2096	1	5.902	93.8%	3	R.VLDELTLAR.T	2 2 2 2 2
PARC_hx21_02_itms.06945.06945.1	2.5928	0.2704	100.0%	1031.7	1030.2096	126	4.955	56.2%	3	R.VLDELTLAR.T	1 1 1 1 1
PARC_hx21_02_itms.08136.08136.2	3.7319	0.255	100.0%	1279.5122	1277.4755	1	5.357	85.0%	1	R.TDLEMQIEGLK.E	2 2

contaminant_KERATIN04

9.4%

458

49644

4.9

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.14070.14070.2	3.1473	0.0593	99.7%	2410.672	2412.7488	96	3.417	32.5%	1	R.DKILTATIENNRVILEIDNAR.L	2
*	PARC_hx21_02_itms.14121.14121.3	3.9786	0.0439	97.0%	2412.8044	2412.7488	30	3.263	31.2%	1	R.DKILTATIENNRVILEIDNAR.L	3
	PARC_hx21_02_itms.05583.05583.2	3.3027	0.2055	100.0%	1202.4321	1202.3097	1	5.2	80.0%	5	R.QSVEADINGLR.R	2 2
	PARC_hx21_03_itms.06608.06608.2	3.6774	0.0932	99.9%	1380.2722	1380.5437	1	5.976	85.0%	1	K.TRLEQEIATYR.S	2 2 2 2 2

contaminant_KERATIN14

8.6%

638

65871

8.1

no description

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_03_itms.07805.07805.2	2.9028	0.3079	100.0%	1398.8722	1398.6017	1	5.903	68.2%	1	K.TLNNKFASFIDK.V	2 2 2 2 2
PARC_hx21_02_itms.05822.05822.2	5.081	0.2736	100.0%	1476.6921	1477.7007	1	6.557	90.9%	7	R.FLEQQNKVLETK.W	2 2 2
PARC_hx21_02_itms.05699.05699.1	3.4278	0.0383	100.0%	1477.59	1477.7007	8	5.131	54.5%	1	R.FLEQQNKVLETK.W	1 1 1
PARC_hx21_03_itms.08238.08238.2	3.3647	0.236	100.0%	1521.8722	1522.8029	1	5.66	72.7%	1	R.LLRDYQELMNVK.L	2 2 2
PARC_hx21_02_itms.06287.06287.1	3.2827	0.2485	100.0%	1139.38	1140.2965	1	5.516	75.0%	3	R.DYQELMNVK.L	1 1 1
PARC_hx21_02_itms.06314.06314.2	3.3972	0.2265	100.0%	1140.6122	1140.2965	2	5.555	81.2%	2	R.DYQELMNVK.L	2 2 2
PARC_hx21_02_itms.22593.22593.2	4.059	0.3826	100.0%	1264.0122	1264.4644	1	7.764	90.0%	6	K.LALDVEIATYR.K	2 2 2 2 2 2
PARC_hx21_02_itms.03338.03338.2	2.6093	0.0401	99.6%	1006.27216	1006.0667	2	4.252	92.9%	1	K.LLEGEECR.M	2 2 2 2 2

YNL217W

8.6%

326

37151

8.3

YNL217W SGDID:S000005161, Chr XIV from 240332-241312, Uncharacterized ORF, "Hypothetical protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.07767.07767.2	3.2373	0.4328	100.0%	1581.6721	1580.8016	1	7.473	65.4%	2	K.VFYGHDASMGLNLR.R	2
*	PARC_hx21_02_itms.07431.07431.2	3.19	0.204	99.9%	1733.5721	1731.8658	1	4.477	57.7%	1	K.KGQYDYELIQVQCS.-	2

contaminant_TRYPSIN

8.3%

229

23993

7.9

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.01275.01275.2	4.9545	0.4215	100.0%	1686.3722	1686.8309	1	7.769	70.0%	4	F.CGGSLINSQWVVSAAH.C	2
*	PARC_hx21_03_itms.10293.10293.2	5.1148	0.489	100.0%	2010.3722	2010.1456	1	8.217	58.8%	4	F.CGGSLINSQWVVSAAHCY.K	2
*	PARC_hx21_03_itms.01100.01100.2	4.5874	0.4384	100.0%	1469.3121	1469.6401	1	7.889	76.9%	5	G.GSLINSQWVVSAAH.C	2
*	PARC_hx21_03_itms.10198.10198.2	4.0687	0.378	100.0%	1794.2722	1792.955	1	7.719	56.7%	1	G.GSLINSQWVVSAAHCY.K	2
*	PARC_hx21_02_itms.06448.06448.2	4.0027	0.3828	100.0%	1309.2122	1308.4021	1	7.742	85.0%	2	N.SQWVVSAAHCY.K	2
*	PARC_hx21_03_itms.06244.06244.2	3.6812	0.3809	100.0%	1435.7522	1436.5762	1	6.703	81.8%	1	N.SQWVVSAAHCYK.S	2

YNL321W

7.4%

908

102499

7.1

YNL321W SGDID:S000005265, Chr XIV from 34695-37421, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.06389.06389.2	1.9234	0.1325	96.4%	1499.4521	1498.6383	13	4.072	54.2%	1	R.QDAINETHPFGIR.I	2
*	PARC_hx21_03_itms.05130.05130.2	2.521	0.2176	99.9%	1057.9521	1058.2253	1	5.02	81.2%	1	R.LVFHQSQAK.F	2
*	PARC_hx21_03_itms.07780.07780.3	3.2714	0.2084	99.3%	3706.4944	3706.9795	1	4.552	22.8%	1	R.EDHPAPATESSSLMPPANTTATPLNSNHPSYNSIR.H	3
*	PARC_hx21_03_itms.04833.04833.2	2.3142	0.2665	99.9%	1131.4122	1130.2516	1	4.683	83.3%	2	R.HEIPHAAAQR.R	2

YGR019W

7.4%

471

52946

6.8

UGA1 SGDID:S000003251, Chr VII from 525233-526648, Verified ORF, "Gamma-aminobutyrate (GABA) transaminase (4-aminobutyrate aminotransferase) involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_05_itms.22678.22678.2	2.5845	0.1004	99.0%	2795.9922	2794.1206	2	3.753	29.2%	2	R.QFNTWCGEPARMIIAGAIGQEISDK.K	2
*	PARC_hx21_03_itms.07197.07197.2	2.8903	0.0245	99.6%	1310.3722	1309.4673	44	3.714	66.7%	1	K.KYPENFQNLR.G	2

YLL043W

7.2%

669

73877

6.9

FPS1 SGDID:S000003966, Chr XII from 49937-51946, Verified ORF, "Plasma membrane glycerol channel, member of the major intrinsic protein (MIP) family of channel proteins; involved in efflux of glycerol and in uptake of the trivalent metalloids arsenite and antimonite"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.07332.07332.3	2.7597	0.2654	100.0%	2003.0944	2003.0923	4	4.533	33.8%	1	K.ALNDFLSSESVHTHDSSR.K	3
*	PARC_hx21_04_itms.10779.10779.2	2.1412	0.0648	97.2%	1026.1721	1026.3257	25	4.119	68.8%	1	R.NVPIMVKPK.T	2
*	PARC_hx21_05_itms.13058.13058.3	3.8865	0.2315	100.0%	2413.6743	2413.7356	1	4.967	36.2%	1	K.TLYQNPQTPTVLPSTYHPINK.W	3
*	PARC_hx21_04_itms.12425.12425.2	3.0492	0.3336	100.0%	2414.6921	2413.7356	1	5.863	40.0%	1	K.TLYQNPQTPTVLPSTYHPINK.W	2

YKL146W

6.8%

692

75459

8.5

AVT3 SGDID:S000001629, Chr XI from 171788-173866, Verified ORF, "Vacuolar transporter, exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.13227.13227.3	3.9051	0.2669	100.0%	3763.4043	3765.0032	1	5.474	20.5%	1	K.WTNDHPSSPSQYQYPSQPALSTSIPSQAPSFSNR.K	3
*	PARC_hx21_04_itms.14256.14256.2	2.8727	0.3703	100.0%	1527.2122	1528.7104	2	5.928	54.2%	2	K.HNVDAPIPNFFTR.N	2

YKL175W

5.6%

503

55403

6.6

ZRT3 SGDID:S000001658, Chr XI from 118798-120309, Verified ORF, "Vacuolar membrane zinc transporter, transports zinc from storage in the vacuole to the cytoplasm when needed; transcription is induced under conditions of zinc deficiency"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.10505.10505.2	3.8447	0.375	100.0%	2442.8123	2443.775	1	7.121	47.5%	2	K.CTPLLQSEQPEYIACVPPVIK.S	2
*	PARC_hx21_04_itms.10590.10590.2	2.3918	0.0803	99.7%	852.1722	851.981	25	4.168	83.3%	2	R.KNFLSSR.H	2

YOR063W

5.4%

387

43758

10.3

RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_05_itms.15119.15119.2	2.2961	0.1922	99.7%	1411.2522	1411.6842	1	4.746	62.5%	2	R.SKPVALTSFLGYK.A	2
*	PARC_hx21_03_itms.05915.05915.2	2.475	0.1225	99.8%	905.15216	905.1027	38	3.801	78.6%	1	K.HAFMGTLK.K	2

contaminant_INT-STD1

4.6%

607

69271

6.1

BSA

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.09450.09450.2	3.0845	0.4343	100.0%	1480.7922	1480.7068	1	6.823	75.0%	1	K.LGEYGFQNALIVR.Y	2
*	PARC_hx21_03_itms.07125.07125.2	3.1158	0.369	100.0%	1640.0922	1640.9205	1	5.755	53.6%	5	R.KVPQVSTPTLVEVSR.S	2

YJL172W

4.5%

576

64597

5.5

CPS1 SGDID:S000003708, Chr X from 97731-99461, Verified ORF, "Vacuolar carboxypeptidase yscS; expression is induced under low-nitrogen conditions"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.12353.12353.2	3.5528	0.2996	100.0%	1508.9521	1508.6769	1	7.48	70.8%	1	K.HSVDTILHDPAFR.N	2
*	PARC_hx21_04_itms.13492.13492.2	2.8411	0.2782	100.0%	1501.6721	1501.6824	3	5.36	54.2%	2	R.INLHSSVAEVFER.N	2

YAL038W

4.4%

500

54545

7.7

CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.07043.07043.2	2.8323	0.453	100.0%	1343.2122	1345.5388	1	7.587	66.7%	1	R.LTSLNVVAGSDLR.R	2
*	PARC_hx21_02_itms.05324.05324.2	1.8658	0.1207	96.9%	1003.5522	1003.14355	92	3.682	75.0%	1	R.TANDVLTIR.E	2

YER123W

4.2%

524

60261

8.8

YCK3 SGDID:S000000925, Chr V from 404809-406383, Verified ORF, "Palmitoylated, vacuolar membrane-localized casein kinase I isoform; negatively regulates vacuole fusion during hypertonic stress via phosphorylation of the HOPS complex subunit, Vps41p; shares overlapping essential functions with Hrr25p"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.11702.11702.2	1.9132	0.2621	99.7%	1226.2722	1226.3954	16	4.587	55.6%	1	R.YMSINTHFGR.E	2
*	PARC_hx21_04_itms.10102.10102.2	2.8333	0.3102	100.0%	1310.1721	1310.4147	1	6.395	68.2%	1	R.ANLHGYGNPNPR.V	2

contaminant_KERATIN16

3.9%

534

57265

6.6

no description

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx21_02_itms.05822.05822.2	5.081	0.2736	100.0%	1476.6921	1477.7007	1	6.557	90.9%	7	Q.FLEQQNKVLETK.W	2 2 2
PARC_hx21_02_itms.05699.05699.1	3.4278	0.0383	100.0%	1477.59	1477.7007	8	5.131	54.5%	1	Q.FLEQQNKVLETK.W	1 1 1
PARC_hx21_02_itms.03381.03381.2	3.1391	0.2845	100.0%	1107.6721	1108.196	1	5.801	87.5%	1	R.AQYEEIAQR.S	2 2 2 2

YNR013C

3.8%

894

99490

8.0

PHO91 SGDID:S000005296, Chr XIV from 651714-649030, reverse complement, Verified ORF, "Low-affinity phosphate transporter; deletion of pho84, pho87, pho89, pho90, and pho91 causes synthetic lethality; transcription independent of Pi and Pho4p activity; overexpression results in vigorous growth"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_04_itms.13484.13484.2	4.1432	0.3681	100.0%	1895.1721	1895.0813	1	7.549	56.7%	2	K.FSHSLQFNSVPEWSTK.Y	2
*	PARC_hx21_03_itms.06674.06674.2	4.9612	0.3612	100.0%	2125.8523	2126.3396	1	6.559	64.7%	1	K.ATQLFNQQQQHQLQSVAR.N	2
*	PARC_hx21_03_itms.06676.06676.3	2.8094	0.2455	99.6%	2126.4243	2126.3396	1	5.548	36.8%	1	K.ATQLFNQQQQHQLQSVAR.N	3

YML123C

3.4%

587

64382

6.4

PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_05_itms.16631.16631.2	5.5663	0.6021	100.0%	2094.7922	2095.3728	1	10.182	65.8%	4	K.VGAIIAQTALGTLIDHNCAR.D	2
*	PARC_hx21_05_itms.16692.16692.3	3.9451	0.267	100.0%	2095.3145	2095.3728	2	5.104	38.2%	2	K.VGAIIAQTALGTLIDHNCAR.D	3

Reverse_YKR086W

3.1%

1071

121652

8.2

PRP16 SGDID:S000001794, Chr XI from 599499-602714, Verified ORF, "RNA helicase in the DEAH-box family involved in the second catalytic step of splicing, exhibits ATP-dependent RNA unwinding activity"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.21199.21199.2	2.01	0.1546	97.2%	1635.3121	1636.7214	5	4.006	42.9%	1	K.SGRKANASFESDPNR.F	2
*	PARC_hx21_02_itms.09021.09021.2	3.0513	0.1028	99.7%	1970.3722	1968.9884	55	3.837	38.2%	1	K.TEAHGNQTQQESNPSPDK.V	2

YDR089W

3.1%

869

98712

5.5

YDR089W SGDID:S000002496, Chr IV from 622107-624716, Uncharacterized ORF, "Hypothetical protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.08091.08091.2	3.1128	0.2287	100.0%	1253.2122	1253.4465	1	5.627	77.8%	1	K.IALEWIQSHR.L	2
*	PARC_hx21_02_itms.11150.11150.2	3.7229	0.234	100.0%	1911.5922	1913.0477	1	5.799	53.1%	1	K.LNSDDSLSPDEFFQLGK.D	2

YDR135C

2.5%

1515

171120

8.4

YCF1 SGDID:S000002542, Chr IV from 727546-722999, reverse complement, Verified ORF, "Vacuolar glutathione S-conjugate transporter of the ATP-binding cassette family, has a role in detoxifying metals such as cadmium, mercury, and arsenite; also transports unconjugated bilirubin; similar to human cystic fibrosis protein CFTR"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_03_itms.05860.05860.2	2.5678	0.1888	99.8%	1530.4521	1530.7672	1	4.102	50.0%	1	K.SEAPLIVEGHRPPK.E	2
*	PARC_hx21_02_itms.10296.10296.2	4.3081	0.4563	100.0%	1978.4922	1978.1252	1	7.568	70.0%	1	R.ENIDPINQYTDEAIWR.A	2
	PARC_hx21_03_itms.05956.05956.2	2.2268	0.3317	100.0%	924.9122	925.1191	1	5.343	78.6%	1	R.TILTIAHR.L	2

contaminant_UBIQUITIN11

2.2%

1118

127523

8.5

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_01_itms.02817.02817.1	1.7369	0.0081	95.7%	895.77	895.94446	2	3.249	83.3%	1	R.YEEAEVR.K	1
*	PARC_hx21_05_itms.17700.17700.2	2.519	0.0865	98.3%	2159.152	2160.3892	61	3.171	35.3%	1	K.KKQEAEENEITEKQQKAK.E	2

Reverse_YPL084W

1.3%

844

97276

5.4

BRO1 SGDID:S000006005, Chr XVI from 394035-396569, Verified ORF, "Cytoplasmic class E vacuolar protein sorting (VPS) factor that coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx21_02_itms.08298.08298.2	2.5323	0.0664	99.2%	1204.4521	1205.2236	2	4.045	77.8%	1	K.TIDDNNIEDR.L	2
*	PARC_hx21_02_itms.11762.11762.2	2.9824	0.204	95.6%	1318.4521	1318.383	16	4.117	65.0%	1	K.TIDDNNIEDRL.E	2

	Proteins	Peptide IDs	Spectra
Unfiltered	10178	48751	52348
Filtered	59	530	2142
Forward matches	57	526	2138
Decoy matches	2	4	4
Forward FP rate	3.51%	0.76%	0.19%

/data/6/jamest/xu/jan08/hx21/parc