| * | X | 0.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.05 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 2 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YBL050W | 13 | 37 | 44.5% | 292 | 32803 | 5.1 | SEC17 SGDID:S000000146, Chr II from 125128-125157,125274-126122, Verified ORF, "Peripheral membrane protein required for vesicular transport between ER and Golgi and for the 'priming' step in homotypic vacuole fusion, part of the cis-SNARE complex; has similarity to alpha-SNAP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.09235.09235.2 | 2.4895 | 0.1033 | 98.9% | 1038.0922 | 1038.25 | 31 | 4.207 | 61.1% | 1 | K.KGVPSSGFMK.L | 2 |
| * | PARC_hx1_02_itms.11141.11141.1 | 2.2805 | 0.2075 | 100.0% | 1205.99 | 1207.369 | 3 | 4.703 | 65.0% | 3 | K.ELNLAGDSFLK.A | 1 |
| * | PARC_hx1_02_itms.11183.11183.2 | 2.7236 | 0.1558 | 100.0% | 1208.9722 | 1207.369 | 1 | 3.976 | 80.0% | 2 | K.ELNLAGDSFLK.A | 2 |
| * | PARC_hx1_03_itms.07652.07652.2 | 4.2751 | 0.4468 | 100.0% | 1859.7122 | 1859.9438 | 1 | 7.424 | 68.8% | 2 | K.KAGNEDEAGNTYVEAYK.C | 2 |
| * | PARC_hx1_02_itms.07696.07696.2 | 5.4894 | 0.4558 | 100.0% | 1734.2922 | 1731.7698 | 1 | 8.441 | 73.3% | 2 | K.AGNEDEAGNTYVEAYK.C | 2 |
| * | PARC_hx1_04_itms.15634.15634.2 | 2.5964 | 0.0786 | 98.3% | 1907.0721 | 1907.0869 | 1 | 3.893 | 50.0% | 1 | K.FELGEILENDLHDYAK.A | 2 |
| * | PARC_hx1_04_itms.14760.14760.2 | 4.3349 | 0.4004 | 100.0% | 2634.5322 | 2632.809 | 1 | 8.07 | 47.7% | 1 | K.AIDCYELAGEWYAQDQSVALSNK.C | 2 |
| * | PARC_hx1_02_itms.09777.09777.2 | 5.5015 | 0.4398 | 100.0% | 1672.9722 | 1673.8169 | 1 | 7.831 | 78.6% | 3 | K.ALDGQYIEASDIYSK.L | 2 |
| * | PARC_hx1_02_itms.09750.09750.1 | 3.6726 | 0.2794 | 100.0% | 1674.63 | 1673.8169 | 1 | 7.214 | 57.1% | 1 | K.ALDGQYIEASDIYSK.L | 1 |
| * | PARC_hx1_02_itms.09560.09560.2 | 4.8185 | 0.3628 | 100.0% | 1488.1322 | 1488.65 | 1 | 8.394 | 78.6% | 4 | K.GLCQLAATDAVAAAR.T | 2 |
| * | PARC_hx1_02_itms.06689.06689.3 | 3.0247 | 0.3066 | 100.0% | 2691.0244 | 2692.8154 | 3 | 5.193 | 21.0% | 1 | L.AATDAVAAARTLQEGQSEDPNFADSR.E | 3 |
| * | PARC_hx1_02_itms.06020.06020.2 | 5.8443 | 0.499 | 100.0% | 1793.9922 | 1794.829 | 1 | 9.426 | 80.0% | 15 | R.TLQEGQSEDPNFADSR.E | 2 |
| * | PARC_hx1_02_itms.09302.09302.1 | 1.6219 | 0.0897 | 97.4% | 958.43 | 959.0643 | 2 | 3.412 | 75.0% | 1 | K.EFDNFMR.L | 1 |
| U | contaminant_KERATIN03 | 23 | 78 | 39.0% | 593 | 59519 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.10653.10653.2 | 2.8837 | 0.3136 | 97.3% | 1450.8522 | 1451.4949 | 2 | 6.211 | 53.3% | 1 | L.GGGFSSGGFSGGSFSR.G | 2 |
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| * | PARC_hx1_02_itms.07760.07760.2 | 4.4567 | 0.4099 | 100.0% | 1382.1522 | 1382.4668 | 1 | 7.555 | 81.8% | 2 | R.ALEESNYELEGK.I | 2 |
| * | PARC_hx1_02_itms.07782.07782.1 | 3.2213 | 0.2684 | 100.0% | 1383.57 | 1382.4668 | 2 | 5.447 | 59.1% | 2 | R.ALEESNYELEGK.I | 1 |
| * | PARC_hx1_04_itms.06120.06120.2 | 3.3368 | 0.4796 | 100.0% | 1119.1122 | 1119.1416 | 1 | 7.793 | 94.4% | 16 | K.HGNSHQGEPR.D | 2 |
| * | PARC_hx1_04_itms.16859.16859.3 | 5.5204 | 0.3353 | 100.0% | 2367.8342 | 2368.6523 | 2 | 6.326 | 41.2% | 4 | K.NQILNLTTDNANILLQIDNAR.L | 3 |
| * | PARC_hx1_04_itms.16811.16811.2 | 5.9053 | 0.3179 | 100.0% | 2370.8523 | 2368.6523 | 1 | 7.04 | 52.5% | 7 | K.NQILNLTTDNANILLQIDNAR.L | 2 |
| PARC_hx1_02_itms.08522.08522.2 | 3.486 | 0.1704 | 100.0% | 1202.0922 | 1202.3097 | 1 | 5.643 | 90.0% | 2 | R.QSVEADINGLR.R | 22 | |
| * | PARC_hx1_02_itms.09380.09380.1 | 2.1444 | 0.091 | 98.3% | 1031.55 | 1032.2224 | 69 | 3.788 | 68.8% | 2 | R.VLDELTLTK.A | 1 |
| * | PARC_hx1_02_itms.09382.09382.2 | 3.4526 | 0.2716 | 100.0% | 1031.6522 | 1032.2224 | 2 | 5.255 | 93.8% | 2 | R.VLDELTLTK.A | 2 |
| * | PARC_hx1_04_itms.20727.20727.2 | 5.9878 | 0.5454 | 100.0% | 2096.2922 | 2097.3853 | 1 | 10.06 | 76.5% | 1 | K.ADLEMQIESLTEELAYLK.K | 2 |
| * | PARC_hx1_04_itms.18077.18077.3 | 5.4443 | 0.3974 | 100.0% | 2874.2344 | 2874.2134 | 1 | 7.796 | 34.6% | 3 | R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S | 3 |
| * | PARC_hx1_04_itms.18038.18038.2 | 5.2985 | 0.408 | 100.0% | 2875.632 | 2874.2134 | 1 | 8.316 | 48.1% | 6 | R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S | 2 |
| * | PARC_hx1_03_itms.07565.07565.2 | 3.5976 | 0.3289 | 100.0% | 1493.7922 | 1494.6041 | 4 | 5.983 | 63.6% | 4 | R.SQYEQLAEQNRK.D | 2 |
| * | PARC_hx1_02_itms.09345.09345.2 | 3.0846 | 0.2584 | 100.0% | 1109.6322 | 1110.1681 | 1 | 5.598 | 81.2% | 2 | K.DAEAWFNEK.S | 2 |
| * | PARC_hx1_02_itms.09388.09388.1 | 2.3665 | 0.0475 | 98.3% | 1111.5 | 1110.1681 | 1 | 4.171 | 75.0% | 3 | K.DAEAWFNEK.S | 1 |
| * | PARC_hx1_04_itms.14219.14219.2 | 5.7514 | 0.3818 | 100.0% | 1997.5521 | 1998.151 | 1 | 8.626 | 71.9% | 4 | K.ELTTEIDNNIEQISSYK.S | 2 |
| * | PARC_hx1_02_itms.08744.08744.2 | 4.1317 | 0.4001 | 100.0% | 1390.9722 | 1391.4778 | 1 | 7.173 | 83.3% | 5 | K.QSLEASLAETEGR.Y | 2 |
| * | PARC_hx1_05_itms.24940.24940.2 | 4.4768 | 0.4125 | 100.0% | 2748.5723 | 2748.0747 | 1 | 8.596 | 47.7% | 1 | R.YCVQLSQIQAQISALEEQLQQIR.A | 2 |
| * | PARC_hx1_03_itms.11135.11135.2 | 3.3786 | 0.1309 | 95.5% | 1428.1921 | 1428.6285 | 14 | 4.342 | 68.2% | 1 | Q.ISALEEQLQQIR.A | 2 |
| * | PARC_hx1_02_itms.10971.10971.2 | 5.7805 | 0.3421 | 100.0% | 2085.2322 | 2084.2104 | 1 | 7.169 | 68.8% | 5 | R.AETECQNTEYQQLLDIK.I | 2 |
| * | PARC_hx1_02_itms.07503.07503.1 | 2.629 | 0.1575 | 100.0% | 1165.61 | 1166.2761 | 20 | 4.294 | 75.0% | 1 | R.LENEIQTYR.S | 1 |
| * | PARC_hx1_02_itms.07518.07518.2 | 3.6501 | 0.1545 | 100.0% | 1169.2722 | 1166.2761 | 1 | 3.988 | 93.8% | 2 | R.LENEIQTYR.S | 2 |
| U | contaminant_KERATIN13 | 34 | 93 | 35.9% | 643 | 65494 | 6.6 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.15184.15184.2 | 3.2497 | 0.2 | 97.7% | 1964.4321 | 1965.2542 | 1 | 5.339 | 53.1% | 1 | N.QSLLQPLNVEIDPEIQK.V | 2 |
| * | PARC_hx1_04_itms.15183.15183.2 | 5.1395 | 0.3317 | 100.0% | 1835.8922 | 1837.1234 | 1 | 7.407 | 73.3% | 2 | Q.SLLQPLNVEIDPEIQK.V | 2 |
| * | PARC_hx1_02_itms.08012.08012.2 | 3.1779 | 0.2029 | 97.4% | 1185.1522 | 1185.3196 | 20 | 4.029 | 72.2% | 1 | L.NVEIDPEIQK.V | 2 |
| * | PARC_hx1_02_itms.08046.08046.1 | 3.1092 | 0.1211 | 100.0% | 1186.53 | 1185.3196 | 2 | 4.092 | 72.2% | 1 | L.NVEIDPEIQK.V | 1 |
| * | PARC_hx1_04_itms.13473.13473.1 | 3.47 | 0.2164 | 100.0% | 1385.57 | 1384.5315 | 1 | 4.819 | 68.2% | 5 | K.SLNNQFASFIDK.V | 1 |
| * | PARC_hx1_04_itms.13471.13471.2 | 4.3046 | 0.2605 | 100.0% | 1386.4321 | 1384.5315 | 1 | 6.113 | 81.8% | 14 | K.SLNNQFASFIDK.V | 2 |
| PARC_hx1_02_itms.08331.08331.1 | 2.7442 | 0.1253 | 100.0% | 1475.61 | 1476.6726 | 4 | 3.893 | 59.1% | 2 | R.FLEQQNQVLQTK.W | 11 | |
| PARC_hx1_02_itms.08342.08342.2 | 4.834 | 0.0036 | 100.0% | 1476.4122 | 1476.6726 | 1 | 6.23 | 90.9% | 2 | R.FLEQQNQVLQTK.W | 22 | |
| * | PARC_hx1_02_itms.11065.11065.1 | 1.6514 | 0.1313 | 97.3% | 1475.62 | 1476.6293 | 1 | 3.987 | 54.5% | 1 | K.WELLQQVDTSTR.T | 1 |
| * | PARC_hx1_02_itms.11097.11097.2 | 4.7751 | 0.4469 | 100.0% | 1476.2722 | 1476.6293 | 1 | 6.916 | 90.9% | 6 | K.WELLQQVDTSTR.T | 2 |
| * | PARC_hx1_02_itms.08061.08061.2 | 3.8025 | 0.2951 | 100.0% | 1290.1322 | 1290.416 | 1 | 5.504 | 85.0% | 1 | W.ELLQQVDTSTR.T | 2 |
| * | PARC_hx1_04_itms.14074.14074.2 | 3.2507 | 0.257 | 97.0% | 1383.6522 | 1384.4875 | 1 | 5.504 | 75.0% | 1 | R.THNLEPYFESF.I | 2 |
| * | PARC_hx1_02_itms.08984.08984.2 | 3.6806 | 0.3312 | 100.0% | 1300.6921 | 1301.4316 | 1 | 6.53 | 83.3% | 3 | K.NMQDMVEDYR.N | 2 |
| * | PARC_hx1_02_itms.08986.08986.1 | 2.5393 | 0.1865 | 100.0% | 1302.51 | 1301.4316 | 5 | 3.874 | 72.2% | 2 | K.NMQDMVEDYR.N | 1 |
| * | PARC_hx1_02_itms.08674.08674.1 | 2.2258 | 0.0341 | 98.6% | 1265.52 | 1266.3934 | 57 | 3.582 | 55.0% | 1 | R.TNAENEFVTIK.K | 1 |
| * | PARC_hx1_02_itms.08678.08678.2 | 3.9282 | 0.3133 | 100.0% | 1266.1522 | 1266.3934 | 1 | 6.292 | 85.0% | 4 | R.TNAENEFVTIK.K | 2 |
| * | PARC_hx1_01_itms.12185.12185.2 | 3.2018 | 0.3512 | 100.0% | 1796.1122 | 1797.0148 | 1 | 6.366 | 57.1% | 1 | K.LDNLQQEIDFLTALY.Q | 2 |
| * | PARC_hx1_03_itms.23087.23087.3 | 6.5486 | 0.4573 | 100.0% | 4532.2744 | 4530.035 | 1 | 8.416 | 23.7% | 2 | K.LDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNR.Q | 3 |
| * | PARC_hx1_03_itms.10494.10494.2 | 3.5486 | 0.2745 | 96.7% | 1606.2122 | 1606.7913 | 1 | 6.417 | 65.4% | 1 | Q.ISETNVILSMDNNR.Q | 2 |
| * | PARC_hx1_02_itms.07011.07011.2 | 4.4741 | 0.3806 | 100.0% | 1341.1921 | 1341.4607 | 1 | 6.841 | 81.8% | 9 | K.SKAEAESLYQSK.Y | 2 |
| * | PARC_hx1_02_itms.06293.06293.2 | 3.9966 | 0.306 | 100.0% | 1125.8722 | 1126.2084 | 1 | 6.417 | 83.3% | 2 | K.AEAESLYQSK.Y | 2 |
| * | PARC_hx1_02_itms.08367.08367.1 | 3.0129 | 0.2089 | 100.0% | 1179.58 | 1180.303 | 10 | 4.827 | 66.7% | 2 | K.YEELQITAGR.H | 1 |
| * | PARC_hx1_02_itms.08426.08426.2 | 3.8483 | 0.2406 | 100.0% | 1180.3522 | 1180.303 | 1 | 6.778 | 94.4% | 3 | K.YEELQITAGR.H | 2 |
| PARC_hx1_02_itms.08312.08312.2 | 3.1798 | 0.1527 | 100.0% | 973.7922 | 974.102 | 6 | 4.302 | 92.9% | 2 | K.IEISELNR.V | 22 | |
| PARC_hx1_02_itms.08252.08252.1 | 2.2867 | 0.1457 | 100.0% | 975.6 | 974.102 | 17 | 3.881 | 64.3% | 2 | K.IEISELNR.V | 11 | |
| * | PARC_hx1_02_itms.07178.07178.2 | 2.7478 | 0.0541 | 98.8% | 1073.8121 | 1074.2223 | 28 | 4.547 | 75.0% | 3 | R.LRSEIDNVK.K | 2 |
| * | PARC_hx1_03_itms.07475.07475.2 | 2.1899 | 0.0899 | 97.9% | 1202.1921 | 1202.3964 | 21 | 3.09 | 66.7% | 1 | R.LRSEIDNVKK.Q | 2 |
| * | PARC_hx1_02_itms.08912.08912.2 | 4.3761 | 0.4369 | 100.0% | 1717.5122 | 1717.8333 | 1 | 8.167 | 71.4% | 3 | K.QISNLQQSISDAEQR.G | 2 |
| * | PARC_hx1_02_itms.08931.08931.3 | 3.3617 | 0.3329 | 100.0% | 1717.7644 | 1717.8333 | 1 | 5.844 | 46.4% | 1 | K.QISNLQQSISDAEQR.G | 3 |
| * | PARC_hx1_02_itms.09710.09710.2 | 5.3146 | 0.2871 | 100.0% | 1358.2722 | 1358.4912 | 1 | 6.382 | 90.9% | 4 | K.LNDLEDALQQAK.E | 2 |
| * | PARC_hx1_02_itms.09742.09742.1 | 3.1079 | 0.2963 | 100.0% | 1359.65 | 1358.4912 | 1 | 5.504 | 63.6% | 3 | K.LNDLEDALQQAK.E | 1 |
| * | PARC_hx1_02_itms.08201.08201.2 | 2.9821 | 0.2335 | 100.0% | 1142.2722 | 1142.2689 | 2 | 5.077 | 81.2% | 1 | R.DYQELMNTK.L | 2 |
| * | PARC_hx1_02_itms.08222.08222.1 | 3.344 | 0.1635 | 100.0% | 1143.51 | 1142.2689 | 1 | 4.709 | 75.0% | 2 | R.DYQELMNTK.L | 1 |
| * | PARC_hx1_03_itms.07347.07347.2 | 5.5809 | 0.3286 | 100.0% | 2384.0723 | 2385.298 | 1 | 10.773 | 41.7% | 4 | R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G | 2 |
| U | contaminant_KERATIN05 | 19 | 28 | 35.7% | 471 | 51531 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_03_itms.07882.07882.2 | 2.9825 | 0.3009 | 100.0% | 1108.9722 | 1107.2181 | 1 | 5.964 | 80.0% | 1 | R.ISSVLAGGSCR.A | 2 |
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| PARC_hx1_02_itms.08000.08000.1 | 3.0102 | 0.2872 | 100.0% | 1301.65 | 1302.4241 | 1 | 6.355 | 63.6% | 2 | R.ALEEANADLEVK.I | 1111 | |
| PARC_hx1_02_itms.08004.08004.2 | 4.5595 | 0.325 | 100.0% | 1305.2122 | 1302.4241 | 1 | 6.344 | 81.8% | 4 | R.ALEEANADLEVK.I | 2222 | |
| PARC_hx1_04_itms.09762.09762.2 | 2.0344 | 0.0974 | 98.3% | 1036.5521 | 1037.1661 | 25 | 3.383 | 83.3% | 1 | K.IRDWYQR.Q | 222 | |
| PARC_hx1_02_itms.08505.08505.1 | 1.9086 | 0.0793 | 98.4% | 919.51 | 920.0093 | 3 | 3.31 | 83.3% | 1 | K.DYSPYFK.T | 11 | |
| * | PARC_hx1_04_itms.14896.14896.2 | 4.8538 | 0.3157 | 100.0% | 2054.5322 | 2055.339 | 1 | 6.26 | 58.3% | 4 | K.ILTATVDNANVLLQIDNAR.L | 2 |
| * | PARC_hx1_02_itms.08250.08250.2 | 2.5064 | 0.1419 | 100.0% | 1038.3522 | 1038.1454 | 7 | 4.797 | 85.7% | 1 | K.YETELNLR.M | 2 |
| PARC_hx1_02_itms.09429.09429.2 | 2.6813 | 0.2812 | 100.0% | 1205.0521 | 1205.3716 | 1 | 5.269 | 75.0% | 1 | R.MSVEADINGLR.R | 22 | |
| PARC_hx1_02_itms.09734.09734.2 | 3.731 | 0.1607 | 100.0% | 1029.5721 | 1030.2096 | 1 | 5.48 | 93.8% | 1 | R.VLDELTLAR.A | 22222 | |
| PARC_hx1_02_itms.09736.09736.1 | 2.0179 | 0.0782 | 98.6% | 1029.75 | 1030.2096 | 6 | 4.111 | 68.8% | 1 | R.VLDELTLAR.A | 11111 | |
| * | PARC_hx1_03_itms.10426.10426.2 | 3.7692 | 0.1997 | 100.0% | 2088.7922 | 2087.269 | 1 | 6.721 | 52.5% | 1 | R.GQVGGDVNVEMDAAPGVDLSR.I | 2 |
| * | PARC_hx1_02_itms.11912.11912.2 | 3.6259 | 0.3257 | 100.0% | 1172.7722 | 1173.2671 | 2 | 6.548 | 81.2% | 1 | K.DAEEWFFTK.T | 2 |
| * | PARC_hx1_02_itms.11874.11874.1 | 2.7658 | 0.2091 | 100.0% | 1174.37 | 1173.2671 | 1 | 6.129 | 68.8% | 1 | K.DAEEWFFTK.T | 1 |
| PARC_hx1_02_itms.06658.06658.2 | 3.8523 | 0.4354 | 100.0% | 1362.3722 | 1362.4796 | 1 | 7.47 | 75.0% | 2 | R.EVATNSELVQSGK.S | 22 | |
| PARC_hx1_02_itms.07731.07731.1 | 2.282 | 0.2071 | 100.0% | 1220.53 | 1221.3068 | 8 | 4.415 | 55.0% | 1 | K.ASLENSLEETK.G | 111 | |
| PARC_hx1_02_itms.07755.07755.2 | 3.0742 | 0.2333 | 100.0% | 1221.8922 | 1221.3068 | 1 | 5.351 | 75.0% | 1 | K.ASLENSLEETK.G | 222 | |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.R | 222222 | |
| * | PARC_hx1_02_itms.09497.09497.2 | 2.994 | 0.2364 | 97.5% | 1534.2922 | 1533.6348 | 1 | 5.264 | 57.7% | 1 | R.LLEGEDAHLSSSQF.S | 2 |
| U | contaminant_KERATIN18 | 23 | 52 | 33.3% | 562 | 59822 | 8.0 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.11523.11523.2 | 1.9111 | 0.1538 | 97.1% | 1398.7122 | 1398.6017 | 2 | 3.63 | 54.5% | 1 | K.TLNNKFASFIDK.V | 2222 | |
| PARC_hx1_03_itms.10101.10101.2 | 3.5006 | 0.0935 | 100.0% | 1203.6721 | 1204.3684 | 1 | 5.206 | 83.3% | 3 | K.WTLLQEQGTK.T | 22 | |
| PARC_hx1_04_itms.17747.17747.2 | 3.6776 | 0.3766 | 100.0% | 1890.9521 | 1892.1216 | 1 | 6.986 | 67.9% | 2 | R.QNLEPLFEQYINNLR.R | 22 | |
| PARC_hx1_02_itms.07992.07992.1 | 1.7854 | 0.2974 | 100.0% | 1016.52 | 1017.1271 | 1 | 4.878 | 75.0% | 1 | R.QLDSIVGER.G | 11 | |
| PARC_hx1_02_itms.07982.07982.2 | 1.697 | 0.1109 | 95.4% | 1017.09216 | 1017.1271 | 9 | 4.456 | 75.0% | 1 | R.QLDSIVGER.G | 22 | |
| * | PARC_hx1_02_itms.11187.11187.2 | 2.4621 | 0.0356 | 97.9% | 1205.1322 | 1205.3685 | 54 | 3.097 | 66.7% | 1 | R.NMQDLVEDLK.N | 2 |
| PARC_hx1_02_itms.08882.08882.2 | 3.3261 | 0.2767 | 100.0% | 1223.2522 | 1223.3684 | 1 | 6.085 | 80.0% | 1 | R.TAAENEFVTLK.K | 2 | |
| PARC_hx1_02_itms.12552.12552.2 | 3.4934 | 0.2806 | 100.0% | 1408.4122 | 1408.551 | 1 | 5.435 | 72.7% | 3 | K.ADTLTDEINFLR.A | 2 | |
| PARC_hx1_03_itms.14960.14960.3 | 3.6404 | 0.1737 | 100.0% | 1959.2644 | 1961.1975 | 5 | 4.271 | 39.1% | 1 | S.MDNNRNLDLDSIIAEVK.A | 33 | |
| PARC_hx1_04_itms.16573.16573.1 | 3.0439 | 0.3354 | 100.0% | 1329.53 | 1330.5211 | 6 | 6.025 | 59.1% | 4 | R.NLDLDSIIAEVK.A | 111 | |
| PARC_hx1_04_itms.16559.16559.2 | 4.5585 | 0.2401 | 100.0% | 1330.4922 | 1330.5211 | 1 | 6.262 | 77.3% | 4 | R.NLDLDSIIAEVK.A | 222 | |
| PARC_hx1_02_itms.06951.06951.2 | 2.8576 | 0.2444 | 100.0% | 1107.7322 | 1108.196 | 1 | 5.256 | 81.2% | 3 | K.AQYEEIAQR.S | 222 | |
| PARC_hx1_03_itms.08164.08164.2 | 2.7106 | 0.3097 | 100.0% | 1455.5122 | 1456.5547 | 1 | 5.344 | 68.2% | 1 | R.SRAEAESWYQTK.Y | 2 | |
| PARC_hx1_02_itms.07844.07844.2 | 3.1227 | 0.3157 | 100.0% | 1213.3522 | 1213.2891 | 1 | 6.452 | 83.3% | 1 | R.AEAESWYQTK.Y | 2 | |
| PARC_hx1_02_itms.07797.07797.1 | 2.3449 | 0.2938 | 100.0% | 1165.47 | 1166.2761 | 1 | 4.499 | 72.2% | 1 | K.YEELQVTAGR.H | 1 | |
| PARC_hx1_02_itms.07790.07790.2 | 3.6991 | 0.3826 | 100.0% | 1165.9321 | 1166.2761 | 1 | 7.154 | 94.4% | 2 | K.YEELQVTAGR.H | 2 | |
| PARC_hx1_02_itms.09203.09203.2 | 3.3208 | 0.3102 | 100.0% | 1371.3322 | 1371.4929 | 1 | 6.047 | 62.5% | 1 | C.ANLQAAIADAEQR.G | 2 | |
| PARC_hx1_02_itms.09158.09158.1 | 2.49 | 0.2181 | 100.0% | 1115.59 | 1116.2566 | 1 | 4.781 | 66.7% | 1 | K.LEGLEDALQK.A | 1 | |
| PARC_hx1_02_itms.09184.09184.2 | 3.76 | 0.3389 | 100.0% | 1118.9922 | 1116.2566 | 1 | 5.246 | 88.9% | 3 | K.LEGLEDALQK.A | 2 | |
| PARC_hx1_02_itms.08477.08477.1 | 2.63 | 0.2356 | 100.0% | 1153.41 | 1154.3234 | 2 | 4.903 | 68.8% | 1 | K.EYQELMNVK.L | 1 | |
| PARC_hx1_02_itms.08469.08469.2 | 2.831 | 0.2535 | 100.0% | 1153.8722 | 1154.3234 | 6 | 4.816 | 81.2% | 1 | K.EYQELMNVK.L | 2 | |
| PARC_hx1_04_itms.14429.14429.2 | 4.0094 | 0.3816 | 100.0% | 1264.0922 | 1264.4644 | 1 | 6.704 | 90.0% | 13 | K.LALDVEIATYR.K | 2222 | |
| * | PARC_hx1_03_itms.07839.07839.2 | 3.9739 | 0.3879 | 100.0% | 1437.4521 | 1436.562 | 1 | 7.933 | 68.8% | 2 | R.ATGGGLSSVGGGSSTIK.Y | 2 |
| U | contaminant_KERATIN02 | 26 | 68 | 32.5% | 622 | 61987 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.07048.07048.2 | 3.9184 | 0.4374 | 100.0% | 1233.1721 | 1233.2833 | 1 | 8.448 | 73.3% | 7 | T.SGGGGGGGLGSGGSIR.S | 2 |
| * | PARC_hx1_02_itms.08693.08693.2 | 4.3936 | 0.4073 | 100.0% | 1691.6721 | 1692.7826 | 1 | 7.148 | 60.5% | 1 | L.GGFGGGAGGGDGGILTANEK.S | 2 |
| * | PARC_hx1_02_itms.06806.06806.2 | 2.8427 | 0.2237 | 100.0% | 1066.1322 | 1066.1742 | 2 | 5.382 | 87.5% | 2 | K.STMQELNSR.L | 2 |
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| * | PARC_hx1_02_itms.07899.07899.1 | 3.2525 | 0.2999 | 100.0% | 1586.63 | 1587.6836 | 1 | 5.673 | 61.5% | 2 | K.VQALEEANNDLENK.I | 1 |
| * | PARC_hx1_02_itms.07910.07910.2 | 5.8291 | 0.4549 | 100.0% | 1587.2322 | 1587.6836 | 1 | 8.444 | 88.5% | 9 | K.VQALEEANNDLENK.I | 2 |
| * | PARC_hx1_04_itms.07305.07305.2 | 2.4737 | 0.0312 | 98.2% | 812.7322 | 812.98773 | 7 | 4.346 | 85.7% | 1 | K.KGPAAIQK.N | 2 |
| * | PARC_hx1_02_itms.10112.10112.2 | 4.407 | 0.3787 | 100.0% | 1606.1721 | 1606.7289 | 1 | 6.885 | 87.5% | 1 | K.NYSPYYNTIDDLK.D | 2 |
| * | PARC_hx1_02_itms.10098.10098.1 | 3.1048 | 0.1472 | 100.0% | 1607.64 | 1606.7289 | 1 | 4.463 | 54.2% | 2 | K.NYSPYYNTIDDLK.D | 1 |
| * | PARC_hx1_02_itms.08925.08925.2 | 5.0347 | 0.3662 | 100.0% | 1315.7122 | 1316.4539 | 1 | 6.745 | 86.4% | 2 | K.DQIVDLTVGNNK.T | 2 |
| * | PARC_hx1_02_itms.08892.08892.1 | 3.4829 | 0.3637 | 100.0% | 1317.62 | 1316.4539 | 1 | 6.996 | 72.7% | 2 | K.DQIVDLTVGNNK.T | 1 |
| * | PARC_hx1_02_itms.09093.09093.1 | 2.0765 | 0.0242 | 97.5% | 1060.6 | 1061.1802 | 2 | 4.047 | 62.5% | 1 | K.TLLDIDNTR.M | 1 |
| * | PARC_hx1_02_itms.09088.09088.2 | 3.01 | 0.1907 | 100.0% | 1064.1721 | 1061.1802 | 1 | 4.059 | 93.8% | 3 | K.TLLDIDNTR.M | 2 |
| * | PARC_hx1_02_itms.09448.09448.2 | 2.461 | 0.147 | 100.0% | 897.89215 | 898.02155 | 20 | 4.191 | 75.0% | 3 | R.MTLDDFR.I | 2 |
| * | PARC_hx1_02_itms.09393.09393.1 | 2.199 | 0.1115 | 100.0% | 899.46 | 898.02155 | 35 | 3.72 | 66.7% | 2 | R.MTLDDFR.I | 1 |
| * | PARC_hx1_02_itms.08132.08132.1 | 1.67 | 0.1474 | 98.4% | 1066.48 | 1067.2048 | 6 | 3.815 | 57.1% | 1 | K.FEMEQNLR.Q | 1 |
| * | PARC_hx1_02_itms.08128.08128.2 | 2.4715 | 0.1378 | 100.0% | 1066.8121 | 1067.2048 | 84 | 5.182 | 71.4% | 3 | K.FEMEQNLR.Q | 2 |
| * | PARC_hx1_02_itms.08194.08194.2 | 3.0012 | 0.3861 | 100.0% | 1158.1322 | 1158.2566 | 1 | 6.112 | 85.0% | 3 | R.QGVDADINGLR.Q | 2 |
| * | PARC_hx1_02_itms.08910.08910.1 | 2.0401 | 0.2206 | 100.0% | 1190.55 | 1191.385 | 103 | 4.173 | 61.1% | 1 | R.QVLDNLTMEK.S | 1 |
| * | PARC_hx1_02_itms.08972.08972.2 | 2.5916 | 0.0444 | 98.2% | 1192.2722 | 1191.385 | 1 | 3.385 | 83.3% | 2 | R.QVLDNLTMEK.S | 2 |
| * | PARC_hx1_04_itms.18203.18203.2 | 5.9948 | 0.3792 | 100.0% | 2171.372 | 2172.4702 | 1 | 8.096 | 73.5% | 3 | K.SDLEMQYETLQEELMALK.K | 2 |
| * | PARC_hx1_04_itms.20559.20559.3 | 4.2678 | 0.4174 | 100.0% | 2737.4043 | 2739.0388 | 1 | 7.081 | 34.1% | 1 | R.YCGQLQMIQEQISNLEAQITDVR.Q | 3 |
| * | PARC_hx1_05_itms.24955.24955.2 | 4.212 | 0.3858 | 100.0% | 2738.2322 | 2739.0388 | 1 | 6.676 | 47.7% | 1 | R.YCGQLQMIQEQISNLEAQITDVR.Q | 2 |
| * | PARC_hx1_04_itms.13845.13845.2 | 3.5417 | 0.3676 | 100.0% | 1859.3522 | 1858.0587 | 1 | 6.933 | 60.0% | 1 | M.IQEQISNLEAQITDVR.Q | 2 |
| * | PARC_hx1_02_itms.09434.09434.2 | 3.3706 | 0.3134 | 100.0% | 1359.0521 | 1359.5223 | 1 | 6.442 | 72.7% | 1 | Q.ISNLEAQITDVR.Q | 2 |
| * | PARC_hx1_04_itms.14871.14871.2 | 5.7143 | 0.4186 | 100.0% | 2096.4521 | 2096.308 | 1 | 8.296 | 71.9% | 11 | R.QEIECQNQEYSLLLSIK.M | 2 |
| U | contaminant_KERATIN08 | 18 | 24 | 32.4% | 469 | 50499 | 5.0 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| PARC_hx1_02_itms.08000.08000.1 | 3.0102 | 0.2872 | 100.0% | 1301.65 | 1302.4241 | 1 | 6.355 | 63.6% | 2 | R.ALEEANADLEVK.I | 1111 | |
| PARC_hx1_02_itms.08004.08004.2 | 4.5595 | 0.325 | 100.0% | 1305.2122 | 1302.4241 | 1 | 6.344 | 81.8% | 4 | R.ALEEANADLEVK.I | 2222 | |
| PARC_hx1_04_itms.09762.09762.2 | 2.0344 | 0.0974 | 98.3% | 1036.5521 | 1037.1661 | 25 | 3.383 | 83.3% | 1 | K.IRDWYQR.Q | 222 | |
| PARC_hx1_02_itms.08505.08505.1 | 1.9086 | 0.0793 | 98.4% | 919.51 | 920.0093 | 3 | 3.31 | 83.3% | 1 | K.DYSPYFK.T | 11 | |
| * | PARC_hx1_02_itms.07799.07799.2 | 2.1257 | 0.1974 | 98.8% | 1203.5721 | 1202.3097 | 15 | 3.918 | 65.0% | 1 | R.QTVEADVNGLR.R | 2 |
| PARC_hx1_02_itms.09734.09734.2 | 3.731 | 0.1607 | 100.0% | 1029.5721 | 1030.2096 | 1 | 5.48 | 93.8% | 1 | R.VLDELTLAR.T | 22222 | |
| PARC_hx1_02_itms.09736.09736.1 | 2.0179 | 0.0782 | 98.6% | 1029.75 | 1030.2096 | 6 | 4.111 | 68.8% | 1 | R.VLDELTLAR.T | 11111 | |
| PARC_hx1_02_itms.10613.10613.1 | 1.6422 | 0.178 | 98.4% | 1276.49 | 1277.4755 | 59 | 4.253 | 45.0% | 1 | R.TDLEMQIEGLK.E | 11 | |
| PARC_hx1_02_itms.10627.10627.2 | 3.667 | 0.1639 | 100.0% | 1280.0521 | 1277.4755 | 1 | 4.426 | 85.0% | 2 | R.TDLEMQIEGLK.E | 22 | |
| * | PARC_hx1_02_itms.09519.09519.2 | 4.4868 | 0.4349 | 100.0% | 2089.4521 | 2089.2415 | 1 | 8.022 | 62.5% | 1 | R.GQTGGDVNVEMDAAPGVDLSR.I | 2 |
| * | PARC_hx1_02_itms.11176.11176.1 | 2.5644 | 0.2637 | 100.0% | 1096.37 | 1097.2126 | 2 | 5.264 | 62.5% | 1 | R.DAETWFLSK.T | 1 |
| * | PARC_hx1_02_itms.06310.06310.2 | 3.4095 | 0.3472 | 100.0% | 1406.3121 | 1406.4924 | 2 | 6.61 | 70.8% | 1 | K.EVASNSELVQSSR.S | 2 |
| * | PARC_hx1_02_itms.06826.06826.2 | 2.0411 | 0.1246 | 98.3% | 990.15216 | 990.10443 | 6 | 3.774 | 85.7% | 1 | R.SEVTELRR.V | 2 |
| PARC_hx1_02_itms.07731.07731.1 | 2.282 | 0.2071 | 100.0% | 1220.53 | 1221.3068 | 8 | 4.415 | 55.0% | 1 | K.ASLENSLEETK.G | 111 | |
| PARC_hx1_02_itms.07755.07755.2 | 3.0742 | 0.2333 | 100.0% | 1221.8922 | 1221.3068 | 1 | 5.351 | 75.0% | 1 | K.ASLENSLEETK.G | 222 | |
| * | PARC_hx1_04_itms.14086.14086.2 | 4.9439 | 0.3914 | 100.0% | 2141.652 | 2142.3516 | 1 | 8.201 | 75.0% | 1 | R.CEMEQQSQEYQILLDVK.T | 2 |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.R | 222222 |
| U | YLR093C | 5 | 6 | 30.0% | 253 | 28964 | 5.7 | NYV1 SGDID:S000004083, Chr XII from 327416-327401,327259-326514, reverse complement, Verified ORF, "v-SNARE component of the vacuolar SNARE complex involved in vesicle fusion; inhibits ATP-dependent Ca(2+) transport activity of Pmc1p in the vacuolar membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.12983.12983.2 | 3.5432 | 0.1992 | 100.0% | 1200.3922 | 1198.4044 | 1 | 4.815 | 83.3% | 2 | R.FNVSYVEVIK.N | 2 |
| * | PARC_hx1_02_itms.10400.10400.2 | 3.0194 | 0.0952 | 99.1% | 1644.2722 | 1643.7595 | 1 | 4.152 | 61.5% | 1 | K.NGETISSCFQPFQK.N | 2 |
| * | PARC_hx1_02_itms.09508.09508.3 | 3.6834 | 0.2299 | 100.0% | 3368.3342 | 3366.407 | 1 | 5.482 | 25.0% | 1 | R.NQTLNSSGNGQSSNGNGQNTISDIGDATEDQIK.D | 3 |
| * | PARC_hx1_02_itms.10698.10698.2 | 3.7903 | 0.2587 | 100.0% | 1419.2122 | 1418.605 | 1 | 5.935 | 81.8% | 1 | K.DVIQIMNDNIDK.F | 2 |
| * | PARC_hx1_02_itms.08292.08292.1 | 2.2347 | 0.0825 | 98.1% | 773.6 | 773.9481 | 2 | 3.771 | 75.0% | 1 | R.VSLLVDK.T | 1 |
| U | contaminant_KERATIN22 | 22 | 54 | 29.3% | 645 | 65865 | 8.0 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_03_itms.07676.07676.2 | 4.2319 | 0.4664 | 100.0% | 1255.2922 | 1255.3298 | 1 | 8.399 | 80.8% | 2 | R.GFSSGSAVVSGGSR.R | 2 |
| * | PARC_hx1_02_itms.08066.08066.1 | 2.051 | 0.2784 | 100.0% | 831.57 | 831.9878 | 1 | 6.144 | 68.8% | 1 | R.SLVGLGGTK.S | 1 |
| PARC_hx1_02_itms.11523.11523.2 | 1.9111 | 0.1538 | 97.1% | 1398.7122 | 1398.6017 | 2 | 3.63 | 54.5% | 1 | K.TLNNKFASFIDK.V | 2222 | |
| PARC_hx1_02_itms.08331.08331.1 | 2.7442 | 0.1253 | 100.0% | 1475.61 | 1476.6726 | 4 | 3.893 | 59.1% | 2 | R.FLEQQNQVLQTK.W | 11 | |
| PARC_hx1_02_itms.08342.08342.2 | 4.834 | 0.0036 | 100.0% | 1476.4122 | 1476.6726 | 1 | 6.23 | 90.9% | 2 | R.FLEQQNQVLQTK.W | 22 | |
| * | PARC_hx1_02_itms.08414.08414.2 | 3.4399 | 0.2747 | 100.0% | 1037.4722 | 1038.1454 | 1 | 6.095 | 100.0% | 1 | R.YLDGLTAER.T | 2 |
| * | PARC_hx1_04_itms.13778.13778.2 | 5.4717 | 0.3987 | 100.0% | 2128.392 | 2129.2598 | 1 | 9.078 | 67.6% | 3 | R.TSQNSELNNMQDLVEDYK.K | 2 |
| * | PARC_hx1_02_itms.08768.08768.2 | 2.9725 | 0.3671 | 100.0% | 1209.2322 | 1209.3416 | 1 | 6.057 | 75.0% | 2 | R.TAAENDFVTLK.K | 2 |
| * | PARC_hx1_04_itms.16205.16205.2 | 4.4085 | 0.0538 | 100.0% | 1461.2922 | 1461.6982 | 1 | 5.377 | 86.4% | 2 | K.VDLLNQEIEFLK.V | 2 |
| PARC_hx1_04_itms.16573.16573.1 | 3.0439 | 0.3354 | 100.0% | 1329.53 | 1330.5211 | 6 | 6.025 | 59.1% | 4 | R.NLDLDSIIAEVK.A | 111 | |
| PARC_hx1_04_itms.16559.16559.2 | 4.5585 | 0.2401 | 100.0% | 1330.4922 | 1330.5211 | 1 | 6.262 | 77.3% | 4 | R.NLDLDSIIAEVK.A | 222 | |
| PARC_hx1_02_itms.06951.06951.2 | 2.8576 | 0.2444 | 100.0% | 1107.7322 | 1108.196 | 1 | 5.256 | 81.2% | 3 | K.AQYEEIAQR.S | 222 | |
| * | PARC_hx1_02_itms.08504.08504.2 | 3.7023 | 0.3083 | 100.0% | 1194.3121 | 1194.33 | 1 | 6.118 | 88.9% | 2 | K.YEELQVTVGR.H | 2 |
| PARC_hx1_02_itms.08312.08312.2 | 3.1798 | 0.1527 | 100.0% | 973.7922 | 974.102 | 6 | 4.302 | 92.9% | 2 | K.IEISELNR.V | 22 | |
| PARC_hx1_02_itms.08252.08252.1 | 2.2867 | 0.1457 | 100.0% | 975.6 | 974.102 | 17 | 3.881 | 64.3% | 2 | K.IEISELNR.V | 11 | |
| * | PARC_hx1_03_itms.07357.07357.2 | 2.4721 | 0.2477 | 100.0% | 995.0722 | 995.16675 | 1 | 4.573 | 87.5% | 2 | R.LQGEIAHVK.K | 2 |
| * | PARC_hx1_02_itms.08318.08318.2 | 4.678 | 0.2499 | 100.0% | 1333.1721 | 1330.3971 | 1 | 6.502 | 86.4% | 2 | K.NVQDAIADAEQR.G | 2 |
| * | PARC_hx1_02_itms.10238.10238.1 | 3.3917 | 0.3566 | 100.0% | 1371.68 | 1372.5181 | 1 | 6.642 | 68.2% | 1 | K.LNDLEEALQQAK.E | 1 |
| * | PARC_hx1_02_itms.10250.10250.2 | 5.3137 | 0.2581 | 100.0% | 1373.3121 | 1372.5181 | 1 | 6.505 | 86.4% | 1 | K.LNDLEEALQQAK.E | 2 |
| PARC_hx1_02_itms.09074.09074.2 | 3.1631 | 0.2567 | 100.0% | 1140.1721 | 1140.2965 | 2 | 5.732 | 81.2% | 1 | R.DYQELMNVK.L | 22 | |
| PARC_hx1_02_itms.09062.09062.1 | 3.0213 | 0.1963 | 100.0% | 1140.47 | 1140.2965 | 3 | 4.994 | 75.0% | 1 | R.DYQELMNVK.L | 11 | |
| PARC_hx1_04_itms.14429.14429.2 | 4.0094 | 0.3816 | 100.0% | 1264.0922 | 1264.4644 | 1 | 6.704 | 90.0% | 13 | K.LALDVEIATYR.K | 2222 |
| U | YGL212W | 8 | 18 | 27.5% | 316 | 36711 | 8.4 | VAM7 SGDID:S000003180, Chr VII from 91436-92386, Verified ORF, "Component of the vacuole SNARE complex involved in vacuolar morphogenesis; SNAP-25 homolog; functions with a syntaxin homolog Vam3p in vacuolar protein trafficking" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.07764.07764.2 | 2.5965 | 0.2541 | 100.0% | 1438.9321 | 1439.5396 | 1 | 4.556 | 75.0% | 3 | R.RYDDPEMIDER.R | 2 |
| * | PARC_hx1_02_itms.09518.09518.1 | 1.9648 | 0.0854 | 98.6% | 1183.54 | 1184.2938 | 16 | 3.47 | 62.5% | 1 | R.FLNELYNDR.F | 1 |
| * | PARC_hx1_02_itms.09566.09566.2 | 3.4182 | 0.2362 | 100.0% | 1184.1522 | 1184.2938 | 1 | 4.816 | 93.8% | 2 | R.FLNELYNDR.F | 2 |
| * | PARC_hx1_03_itms.10782.10782.2 | 3.6441 | 0.2381 | 100.0% | 1162.7322 | 1163.3593 | 1 | 4.954 | 83.3% | 2 | K.IAQDFLQLSK.P | 2 |
| * | PARC_hx1_02_itms.07342.07342.2 | 3.253 | 0.254 | 100.0% | 1577.9122 | 1578.5989 | 2 | 6.654 | 65.4% | 1 | K.ECDDIGTANIAQDR.G | 2 |
| * | PARC_hx1_02_itms.08156.08156.2 | 5.3249 | 0.4691 | 100.0% | 1836.0922 | 1835.9658 | 1 | 11.469 | 70.6% | 3 | R.LLGVATSDNSSTTEVQGR.T | 2 |
| * | PARC_hx1_02_itms.07949.07949.2 | 4.7494 | 0.4743 | 100.0% | 1666.0721 | 1663.864 | 1 | 7.123 | 73.1% | 3 | R.TNNDLQQGQMQMVR.D | 2 |
| * | PARC_hx1_04_itms.09774.09774.2 | 4.2463 | 0.3371 | 100.0% | 1338.2722 | 1338.463 | 1 | 7.476 | 85.0% | 3 | R.DQEQELVALHR.I | 2 |
| U | YMR197C | 5 | 13 | 26.7% | 217 | 24668 | 6.6 | VTI1 SGDID:S000004810, Chr XIII from 659197-658544, reverse complement, Verified ORF, "Protein involved in cis-Golgi membrane traffic; v-SNARE that interacts with two t-SNARES, Sed5p and Pep12p; required for multiple vacuolar sorting pathways" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_05_itms.13149.13149.2 | 2.9546 | 0.2811 | 100.0% | 1455.1122 | 1455.6108 | 11 | 5.276 | 50.0% | 1 | K.ASLAEAPSQPLSQR.N | 2 |
| * | PARC_hx1_02_itms.09920.09920.2 | 5.1082 | 0.4623 | 100.0% | 1693.2722 | 1693.7673 | 1 | 8.528 | 82.1% | 6 | R.LFGDLNASNIDDDQR.Q | 2 |
| * | PARC_hx1_04_itms.15291.15291.2 | 5.571 | 0.4611 | 100.0% | 1879.2722 | 1879.1536 | 1 | 8.163 | 75.0% | 2 | R.IANETEGIGSQIMMDLR.S | 2 |
| * | PARC_hx1_02_itms.09503.09503.1 | 2.1403 | 0.2527 | 100.0% | 1414.55 | 1415.5425 | 1 | 4.929 | 59.1% | 1 | R.QTLFQADSYVDK.S | 1 |
| * | PARC_hx1_02_itms.09524.09524.2 | 3.4633 | 0.231 | 100.0% | 1415.2122 | 1415.5425 | 1 | 5.394 | 77.3% | 3 | R.QTLFQADSYVDK.S | 2 |
| U | YOL039W | 2 | 2 | 24.5% | 106 | 10746 | 4.0 | RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.08415.08415.2 | 3.7476 | 0.3533 | 100.0% | 1399.1522 | 1399.587 | 1 | 6.357 | 69.2% | 1 | Y.LLLNAAGNTPDATK.I | 2 |
| * | PARC_hx1_02_itms.08402.08402.2 | 3.1137 | 0.2575 | 100.0% | 1333.8722 | 1334.4229 | 5 | 5.58 | 68.2% | 1 | K.SVDELITEGNEK.L | 2 |
| U | YDR382W | 2 | 2 | 23.6% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.08165.08165.2 | 4.5659 | 0.3802 | 100.0% | 1431.0322 | 1431.5425 | 1 | 8.302 | 76.9% | 1 | K.AVVESVGAEVDEAR.I | 2 |
| * | PARC_hx1_02_itms.10154.10154.2 | 3.2452 | 0.2223 | 100.0% | 1274.4722 | 1274.4136 | 1 | 4.861 | 77.3% | 1 | K.GSLEEIIAEGQK.K | 2 |
| U | contaminant_KERATIN17 | 16 | 37 | 23.4% | 590 | 62461 | 8.1 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.10059.10059.2 | 2.8088 | 0.3276 | 100.0% | 1411.2722 | 1411.5547 | 2 | 6.851 | 61.5% | 1 | R.SFSTASAITPSVSR.T | 2 |
| PARC_hx1_02_itms.11523.11523.2 | 1.9111 | 0.1538 | 97.1% | 1398.7122 | 1398.6017 | 2 | 3.63 | 54.5% | 1 | K.TLNNKFASFIDK.V | 2222 | |
| PARC_hx1_03_itms.10101.10101.2 | 3.5006 | 0.0935 | 100.0% | 1203.6721 | 1204.3684 | 1 | 5.206 | 83.3% | 3 | K.WTLLQEQGTK.T | 22 | |
| PARC_hx1_04_itms.17747.17747.2 | 3.6776 | 0.3766 | 100.0% | 1890.9521 | 1892.1216 | 1 | 6.986 | 67.9% | 2 | R.QNLEPLFEQYINNLR.R | 22 | |
| PARC_hx1_02_itms.07992.07992.1 | 1.7854 | 0.2974 | 100.0% | 1016.52 | 1017.1271 | 1 | 4.878 | 75.0% | 1 | R.QLDSIVGER.G | 11 | |
| PARC_hx1_02_itms.07982.07982.2 | 1.697 | 0.1109 | 95.4% | 1017.09216 | 1017.1271 | 9 | 4.456 | 75.0% | 1 | R.QLDSIVGER.G | 22 | |
| * | PARC_hx1_02_itms.11490.11490.2 | 3.8893 | 0.0453 | 100.0% | 1239.1522 | 1239.3856 | 3 | 5.608 | 83.3% | 1 | R.NMQDLVEDFK.N | 2 |
| * | PARC_hx1_02_itms.09969.09969.2 | 3.051 | 0.237 | 100.0% | 1283.9122 | 1283.4822 | 2 | 5.561 | 70.0% | 1 | R.TTAENEFVMLK.K | 2 |
| PARC_hx1_03_itms.14960.14960.3 | 3.6404 | 0.1737 | 100.0% | 1959.2644 | 1961.1975 | 5 | 4.271 | 39.1% | 1 | S.MDNNRNLDLDSIIAEVK.A | 33 | |
| PARC_hx1_04_itms.16573.16573.1 | 3.0439 | 0.3354 | 100.0% | 1329.53 | 1330.5211 | 6 | 6.025 | 59.1% | 4 | R.NLDLDSIIAEVK.A | 111 | |
| PARC_hx1_04_itms.16559.16559.2 | 4.5585 | 0.2401 | 100.0% | 1330.4922 | 1330.5211 | 1 | 6.262 | 77.3% | 4 | R.NLDLDSIIAEVK.A | 222 | |
| * | PARC_hx1_02_itms.06760.06760.2 | 1.8001 | 0.1877 | 98.3% | 1095.8322 | 1094.1692 | 11 | 4.043 | 81.2% | 1 | K.AQYEEIANR.S | 2 |
| * | PARC_hx1_02_itms.07896.07896.2 | 3.0498 | 0.2734 | 100.0% | 1243.0922 | 1243.3153 | 1 | 6.149 | 83.3% | 1 | R.TEAESWYQTK.Y | 2 |
| * | PARC_hx1_02_itms.09194.09194.1 | 2.3813 | 0.1775 | 100.0% | 1143.51 | 1144.3104 | 3 | 4.22 | 66.7% | 1 | K.LAELEEALQK.A | 1 |
| * | PARC_hx1_02_itms.09230.09230.2 | 4.0858 | 0.2638 | 100.0% | 1144.2322 | 1144.3104 | 1 | 5.098 | 88.9% | 1 | K.LAELEEALQK.A | 2 |
| PARC_hx1_04_itms.14429.14429.2 | 4.0094 | 0.3816 | 100.0% | 1264.0922 | 1264.4644 | 1 | 6.704 | 90.0% | 13 | K.LALDVEIATYR.K | 2222 |
| U | YMR194W | 2 | 2 | 22.0% | 100 | 11124 | 11.6 | RPL36A SGDID:S000004807, Chr XIII from 651144-651159,651623-651909, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Bp and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA" |
| U | YPL249C-A | 2 | 2 | 22.0% | 100 | 11135 | 11.6 | RPL36B SGDID:S000006438, Chr XVI from 76239-76224,75985-75699, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Ap and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.08558.08558.2 | 2.4891 | 0.3022 | 100.0% | 1134.4922 | 1135.2621 | 21 | 4.807 | 61.1% | 1 | R.EIAGLSPYER.R | 2 | |
| PARC_hx1_02_itms.08842.08842.2 | 4.4324 | 0.3876 | 100.0% | 1347.2922 | 1347.5292 | 1 | 6.952 | 86.4% | 1 | K.VEEMNNIIAASR.R | 2 |
| U | YOR106W | 5 | 15 | 18.4% | 283 | 32498 | 7.0 | VAM3 SGDID:S000005632, Chr XV from 519121-519972, Verified ORF, "Syntaxin-related protein required for vacuolar assembly; functions with Vam7p in vacuolar protein trafficking; member of the syntaxin family of proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.06699.06699.2 | 3.9661 | 0.3423 | 100.0% | 1593.0322 | 1593.65 | 1 | 6.096 | 65.4% | 5 | K.GNSQQEPQFSTNQK.T | 2 |
| * | PARC_hx1_04_itms.16163.16163.2 | 4.9346 | 0.4039 | 100.0% | 1637.1921 | 1637.7869 | 1 | 7.425 | 80.8% | 6 | K.ELSNLIETFAEQSR.V | 2 |
| * | PARC_hx1_02_itms.09224.09224.2 | 3.577 | 0.2866 | 100.0% | 1532.3522 | 1532.7002 | 5 | 4.865 | 70.8% | 2 | K.IETELIPNCTSVR.D | 2 |
| * | PARC_hx1_02_itms.08447.08447.1 | 2.0395 | 0.0912 | 98.5% | 1266.53 | 1267.3782 | 41 | 3.899 | 55.0% | 1 | R.QDPESSYISIK.V | 1 |
| * | PARC_hx1_02_itms.08462.08462.2 | 2.4008 | 0.2215 | 100.0% | 1267.2922 | 1267.3782 | 1 | 4.775 | 65.0% | 1 | R.QDPESSYISIK.V | 2 |
| U | contaminant_gi|7463016|pir||S77957 | 7 | 8 | 18.2% | 269 | 27961 | 6.7 | lysyl endopeptidase (EC 3.4.21.50) - Lysobacter enzymogenes |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.10067.10067.2 | 3.282 | 0.3821 | 100.0% | 1491.5521 | 1491.5688 | 1 | 6.839 | 75.0% | 1 | V.VYWNYQNSTCR.A | 2 |
| * | PARC_hx1_03_itms.07728.07728.2 | 3.1942 | 0.3373 | 100.0% | 1228.9722 | 1229.2604 | 1 | 6.201 | 93.8% | 1 | Y.WNYQNSTCR.A | 2 |
| * | PARC_hx1_04_itms.14829.14829.2 | 2.9117 | 0.2634 | 96.9% | 1050.7322 | 1051.1924 | 1 | 5.165 | 92.9% | 1 | N.LFWAGWDR.R | 2 |
| * | PARC_hx1_02_itms.08006.08006.2 | 4.9247 | 0.472 | 100.0% | 1749.4321 | 1749.8718 | 1 | 8.138 | 70.6% | 1 | S.GGVTEPGSSGSPIYSPEK.R | 2 |
| * | PARC_hx1_04_itms.09469.09469.2 | 2.6136 | 0.3627 | 97.1% | 1692.2322 | 1692.82 | 1 | 6.073 | 56.2% | 1 | G.GVTEPGSSGSPIYSPEK.R | 2 |
| * | PARC_hx1_03_itms.07865.07865.1 | 2.3993 | 0.3895 | 100.0% | 1051.54 | 1052.1753 | 1 | 6.644 | 60.0% | 1 | R.VLGQLHGGPSS.C | 1 |
| * | PARC_hx1_04_itms.09037.09037.2 | 3.9833 | 0.4659 | 100.0% | 1211.6921 | 1212.3141 | 1 | 8.399 | 95.5% | 2 | R.VLGQLHGGPSSC.S | 2 |
| U | contaminant_KERATIN12 | 8 | 10 | 17.6% | 431 | 47974 | 5.0 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| * | PARC_hx1_02_itms.08073.08073.2 | 4.2408 | 0.3555 | 100.0% | 1345.7322 | 1346.4772 | 1 | 7.131 | 81.8% | 1 | R.ALEEANTELEVK.I | 2 |
| PARC_hx1_04_itms.09762.09762.2 | 2.0344 | 0.0974 | 98.3% | 1036.5521 | 1037.1661 | 25 | 3.383 | 83.3% | 1 | K.IRDWYQR.Q | 222 | |
| * | PARC_hx1_04_itms.15612.15612.2 | 4.0132 | 0.2529 | 100.0% | 2068.9321 | 2069.366 | 1 | 5.751 | 61.1% | 1 | K.ILTATVDNANILLQIDNAR.L | 2 |
| PARC_hx1_02_itms.09734.09734.2 | 3.731 | 0.1607 | 100.0% | 1029.5721 | 1030.2096 | 1 | 5.48 | 93.8% | 1 | R.VLDELTLAR.A | 22222 | |
| PARC_hx1_02_itms.09736.09736.1 | 2.0179 | 0.0782 | 98.6% | 1029.75 | 1030.2096 | 6 | 4.111 | 68.8% | 1 | R.VLDELTLAR.A | 11111 | |
| PARC_hx1_02_itms.06658.06658.2 | 3.8523 | 0.4354 | 100.0% | 1362.3722 | 1362.4796 | 1 | 7.47 | 75.0% | 2 | R.EVATNSELVQSGK.S | 22 | |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.R | 222222 |
| U | YDR481C | 6 | 6 | 15.9% | 566 | 63004 | 5.6 | PHO8 SGDID:S000002889, Chr IV from 1420240-1418540, reverse complement, Verified ORF, "Repressible alkaline phosphatase, a glycoprotein localized to the vacuole; regulated by levels of inorganic phosphate and by a system consisting of Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.17534.17534.2 | 3.4276 | 0.3203 | 100.0% | 2013.9922 | 2014.365 | 1 | 7.026 | 58.3% | 1 | K.NVIFFVTDGMGPASLSMAR.S | 2 |
| * | PARC_hx1_04_itms.14941.14941.2 | 4.9601 | 0.4613 | 100.0% | 2043.2922 | 2044.189 | 1 | 10.494 | 62.5% | 1 | R.SSDSLVTDSAAGATAFACALK.S | 2 |
| * | PARC_hx1_02_itms.09888.09888.2 | 3.0303 | 0.3641 | 100.0% | 1016.9322 | 1017.2316 | 1 | 6.283 | 83.3% | 1 | R.VVDLLMGGGR.S | 2 |
| * | PARC_hx1_02_itms.11545.11545.2 | 3.5668 | 0.3638 | 100.0% | 1967.4922 | 1967.0587 | 1 | 6.381 | 53.1% | 1 | R.DLIDEAQSNGWQYVGDR.K | 2 |
| * | PARC_hx1_04_itms.05166.05166.2 | 3.9387 | 0.4453 | 100.0% | 1645.3121 | 1645.7317 | 1 | 8.032 | 78.6% | 1 | R.IDHAGHQNDPASQVR.E | 2 |
| * | PARC_hx1_02_itms.08919.08919.2 | 3.2129 | 0.2746 | 100.0% | 982.2322 | 982.14246 | 1 | 6.299 | 92.9% | 1 | K.LNDMVSFR.A | 2 |
| U | contaminant_KERATIN07 | 10 | 19 | 14.2% | 473 | 50915 | 5.5 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| PARC_hx1_02_itms.08000.08000.1 | 3.0102 | 0.2872 | 100.0% | 1301.65 | 1302.4241 | 1 | 6.355 | 63.6% | 2 | R.ALEEANADLEVK.I | 1111 | |
| PARC_hx1_02_itms.08004.08004.2 | 4.5595 | 0.325 | 100.0% | 1305.2122 | 1302.4241 | 1 | 6.344 | 81.8% | 4 | R.ALEEANADLEVK.I | 2222 | |
| * | PARC_hx1_04_itms.14165.14165.3 | 5.6279 | 0.4815 | 100.0% | 2064.2043 | 2065.3774 | 1 | 8.969 | 51.4% | 1 | K.IIAATIENAQPILQIDNAR.L | 3 |
| * | PARC_hx1_04_itms.14158.14158.2 | 5.6442 | 0.4198 | 100.0% | 2065.6921 | 2065.3774 | 1 | 7.423 | 58.3% | 5 | K.IIAATIENAQPILQIDNAR.L | 2 |
| PARC_hx1_02_itms.09734.09734.2 | 3.731 | 0.1607 | 100.0% | 1029.5721 | 1030.2096 | 1 | 5.48 | 93.8% | 1 | R.VLDELTLAR.T | 22222 | |
| PARC_hx1_02_itms.09736.09736.1 | 2.0179 | 0.0782 | 98.6% | 1029.75 | 1030.2096 | 6 | 4.111 | 68.8% | 1 | R.VLDELTLAR.T | 11111 | |
| PARC_hx1_02_itms.07731.07731.1 | 2.282 | 0.2071 | 100.0% | 1220.53 | 1221.3068 | 8 | 4.415 | 55.0% | 1 | K.ASLENSLEETK.G | 111 | |
| PARC_hx1_02_itms.07755.07755.2 | 3.0742 | 0.2333 | 100.0% | 1221.8922 | 1221.3068 | 1 | 5.351 | 75.0% | 1 | K.ASLENSLEETK.G | 222 | |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.R | 222222 |
| U | YKL196C | 2 | 2 | 13.0% | 200 | 22707 | 5.7 | YKT6 SGDID:S000001679, Chr XI from 75539-74937, reverse complement, Verified ORF, "Vesicle membrane protein (v-SNARE) with acyltransferase activity; involved in trafficking to and within the Golgi, endocytic trafficking to the vacuole, and vacuolar fusion; membrane localization due to prenylation at the carboxy-terminus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.09425.09425.2 | 3.649 | 0.3779 | 100.0% | 1621.1322 | 1621.6978 | 1 | 6.817 | 57.7% | 1 | K.EEWADVTETNDALK.M | 2 |
| * | PARC_hx1_02_itms.07851.07851.2 | 1.927 | 0.0769 | 95.4% | 1368.4122 | 1367.5164 | 117 | 3.092 | 50.0% | 1 | K.YQDPSQADAIMK.V | 2 |
| U | YBR031W | 3 | 4 | 12.4% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| U | YDR012W | 3 | 4 | 12.4% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_04_itms.17178.17178.2 | 3.9906 | 0.3842 | 100.0% | 1880.9722 | 1882.2047 | 1 | 7.594 | 59.4% | 1 | K.IPEIPLVVSTDLESIQK.T | 2 | |
| PARC_hx1_03_itms.10805.10805.2 | 3.7972 | 0.25 | 100.0% | 1474.4722 | 1474.697 | 1 | 7.12 | 69.2% | 2 | R.GPLVVYAEDNGIVK.A | 2 | |
| PARC_hx1_02_itms.08675.08675.2 | 4.7733 | 0.4849 | 100.0% | 1507.2122 | 1507.6403 | 1 | 8.436 | 80.8% | 1 | K.LDQVWGSETVASSK.V | 2 |
| U | YLL024C | 5 | 5 | 12.1% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.10788.10788.2 | 4.1042 | 0.4447 | 100.0% | 1592.1721 | 1592.7667 | 1 | 7.939 | 71.4% | 1 | K.NQAAMNPANTVFDAK.R | 2 |
| PARC_hx1_02_itms.10712.10712.2 | 2.8807 | 0.3092 | 100.0% | 1895.3322 | 1896.0667 | 1 | 5.836 | 46.9% | 1 | K.VNDAVVTVPAYFNDSQR.Q | 2 | |
| PARC_hx1_04_itms.13364.13364.2 | 3.8554 | 0.4255 | 100.0% | 1661.1522 | 1660.9078 | 1 | 7.236 | 70.0% | 1 | R.IINEPTAAAIAYGLDK.K | 2 | |
| PARC_hx1_03_itms.10202.10202.2 | 4.158 | 0.0702 | 100.0% | 1460.0322 | 1460.6273 | 1 | 6.695 | 69.2% | 1 | K.SQVDEIVLVGGSTR.I | 2 | |
| PARC_hx1_05_itms.13382.13382.2 | 4.564 | 0.3343 | 100.0% | 1619.4922 | 1619.7258 | 1 | 7.282 | 67.9% | 1 | K.NTISEAGDKLEQADK.D | 2 |
| U | YMR200W | 2 | 2 | 12.1% | 256 | 28908 | 5.6 | ROT1 SGDID:S000004813, Chr XIII from 664751-665521, Verified ORF, "Protein that may be involved in cell wall function; mutations in rot1 cause cell wall defects, suppress tor2 mutations, and are synthetically lethal with rot2 mutations" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.08913.08913.2 | 3.8533 | 0.3929 | 100.0% | 1602.6322 | 1603.6392 | 1 | 6.7 | 61.5% | 1 | C.EDESNSIYGTWSSK.S | 2 |
| * | PARC_hx1_02_itms.09118.09118.2 | 3.2137 | 0.2669 | 100.0% | 1961.4521 | 1962.0027 | 1 | 5.942 | 56.2% | 1 | R.QLFSDPCNDDGVSTYSR.Y | 2 |
| U | contaminant_KERATIN10 | 7 | 9 | 11.8% | 400 | 44106 | 5.1 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.07521.07521.1 | 2.1267 | 0.0998 | 98.1% | 809.4 | 809.93774 | 69 | 4.326 | 75.0% | 2 | R.LASYLDK.V | 1111111 | |
| PARC_hx1_02_itms.09429.09429.2 | 2.6813 | 0.2812 | 100.0% | 1205.0521 | 1205.3716 | 1 | 5.269 | 75.0% | 1 | R.MSVEADINGLR.R | 22 | |
| PARC_hx1_02_itms.09734.09734.2 | 3.731 | 0.1607 | 100.0% | 1029.5721 | 1030.2096 | 1 | 5.48 | 93.8% | 1 | R.VLDELTLAR.T | 22222 | |
| PARC_hx1_02_itms.09736.09736.1 | 2.0179 | 0.0782 | 98.6% | 1029.75 | 1030.2096 | 6 | 4.111 | 68.8% | 1 | R.VLDELTLAR.T | 11111 | |
| PARC_hx1_02_itms.10613.10613.1 | 1.6422 | 0.178 | 98.4% | 1276.49 | 1277.4755 | 59 | 4.253 | 45.0% | 1 | R.TDLEMQIEGLK.E | 11 | |
| PARC_hx1_02_itms.10627.10627.2 | 3.667 | 0.1639 | 100.0% | 1280.0521 | 1277.4755 | 1 | 4.426 | 85.0% | 2 | R.TDLEMQIEGLK.E | 22 | |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.S | 222222 |
| U | YAL038W | 4 | 4 | 11.6% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.09221.09221.2 | 2.7005 | 0.2195 | 100.0% | 1228.1522 | 1228.391 | 2 | 5.559 | 70.0% | 1 | K.TNNPETLVALR.K | 2 |
| * | PARC_hx1_04_itms.14305.14305.2 | 3.0063 | 0.358 | 100.0% | 1726.5721 | 1725.9365 | 1 | 6.097 | 46.9% | 1 | K.GVNLPGTDVDLPALSEK.D | 2 |
| * | PARC_hx1_04_itms.15361.15361.2 | 2.5956 | 0.1838 | 99.0% | 1749.0521 | 1750.0453 | 4 | 3.887 | 50.0% | 1 | R.GDLGIEIPAPEVLAVQK.K | 2 |
| * | PARC_hx1_02_itms.09125.09125.2 | 2.6047 | 0.4153 | 100.0% | 1518.4122 | 1519.5646 | 3 | 7.47 | 50.0% | 1 | K.EPVSDWTDDVEAR.I | 2 |
| U | YBR181C | 2 | 2 | 11.4% | 236 | 26996 | 10.4 | RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein" |
| U | YPL090C | 2 | 2 | 11.4% | 236 | 26996 | 10.4 | RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.08735.08735.2 | 4.2846 | 0.4425 | 100.0% | 1593.2922 | 1593.6874 | 1 | 8.797 | 75.0% | 1 | R.IGQEVDGEAVGDEFK.G | 2 | |
| PARC_hx1_02_itms.09918.09918.2 | 2.449 | 0.203 | 100.0% | 1280.4521 | 1278.4479 | 9 | 4.323 | 63.6% | 1 | R.EAAAEYAQLLAK.R | 2 |
| U | contaminant_KERATIN15 | 8 | 38 | 9.9% | 629 | 64511 | 6.5 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.11523.11523.2 | 1.9111 | 0.1538 | 97.1% | 1398.7122 | 1398.6017 | 2 | 3.63 | 54.5% | 1 | K.TLNNKFASFIDK.V | 2222 | |
| PARC_hx1_02_itms.08343.08343.2 | 4.9059 | 0.1302 | 100.0% | 1479.4922 | 1477.7007 | 1 | 5.757 | 86.4% | 6 | R.FLEQQNKVLETK.W | 22 | |
| * | PARC_hx1_04_itms.16637.16637.2 | 5.1559 | 0.3406 | 100.0% | 1302.8722 | 1303.4521 | 1 | 7.046 | 79.2% | 10 | R.SLDLDSIIAEVGA.Q | 2 |
| * | PARC_hx1_04_itms.16520.16520.1 | 3.2983 | 0.3082 | 100.0% | 1304.62 | 1303.4521 | 1 | 5.679 | 58.3% | 3 | R.SLDLDSIIAEVGA.Q | 1 |
| * | PARC_hx1_04_itms.16637.16637.3 | 3.2982 | 0.242 | 100.0% | 1953.8043 | 1952.1223 | 4 | 5.606 | 32.4% | 3 | R.SLDLDSIIAEVGAQYEDI.A | 2 |
| PARC_hx1_02_itms.09074.09074.2 | 3.1631 | 0.2567 | 100.0% | 1140.1721 | 1140.2965 | 2 | 5.732 | 81.2% | 1 | R.DYQELMNVK.L | 22 | |
| PARC_hx1_02_itms.09062.09062.1 | 3.0213 | 0.1963 | 100.0% | 1140.47 | 1140.2965 | 3 | 4.994 | 75.0% | 1 | R.DYQELMNVK.L | 11 | |
| PARC_hx1_04_itms.14429.14429.2 | 4.0094 | 0.3816 | 100.0% | 1264.0922 | 1264.4644 | 1 | 6.704 | 90.0% | 13 | K.LALDVEIATYR.K | 2222 |
| U | YHL033C | 2 | 3 | 9.0% | 256 | 28125 | 10.0 | RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" |
| U | YLL045C | 2 | 3 | 9.0% | 256 | 28112 | 10.0 | RPL8B SGDID:S000003968, Chr XII from 48628-47858, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.08993.08993.2 | 4.6897 | 0.4272 | 100.0% | 1118.0721 | 1118.2755 | 1 | 8.137 | 95.0% | 2 | K.TSAVAALTEVR.A | 2 | |
| PARC_hx1_02_itms.09072.09072.2 | 3.543 | 0.2625 | 100.0% | 1295.3722 | 1294.4473 | 1 | 6.369 | 77.3% | 1 | K.LVSTIDANFADK.Y | 2 |
| U | YLR058C | 3 | 3 | 8.7% | 469 | 52219 | 7.4 | SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, involved in one-carbon metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.15198.15198.2 | 3.7049 | 0.3699 | 100.0% | 1667.5122 | 1667.8584 | 1 | 7.602 | 65.4% | 1 | K.ISAVSTYFESFPYR.V | 2 |
| * | PARC_hx1_02_itms.10466.10466.2 | 3.4808 | 0.3787 | 100.0% | 1710.1122 | 1707.8749 | 1 | 7.541 | 71.4% | 1 | R.VNPETGIIDYDTLEK.N | 2 |
| * | PARC_hx1_02_itms.09615.09615.2 | 4.4405 | 0.4101 | 100.0% | 1363.3722 | 1363.4668 | 1 | 7.197 | 86.4% | 1 | K.VDEGSDVLNTWK.K | 2 |
| U | YML123C | 3 | 3 | 8.0% | 587 | 64382 | 6.4 | PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.14985.14985.2 | 3.4315 | 0.3773 | 100.0% | 1936.7322 | 1936.1284 | 1 | 6.062 | 53.1% | 1 | R.LALESIDDEGFGWQQVK.T | 2 |
| * | PARC_hx1_02_itms.07815.07815.2 | 5.5518 | 0.4883 | 100.0% | 1473.0721 | 1473.5798 | 1 | 8.154 | 84.6% | 1 | K.LELAAAAQEQDGEK.K | 2 |
| * | PARC_hx1_02_itms.07575.07575.2 | 3.6736 | 0.4224 | 100.0% | 1756.6122 | 1756.7802 | 1 | 7.33 | 53.3% | 1 | K.NNDIESSSPSQLQHEA.- | 2 |
| U | YOR270C | 4 | 4 | 7.3% | 840 | 95529 | 5.5 | VPH1 SGDID:S000005796, Chr XV from 830571-828049, reverse complement, Verified ORF, "Subunit of vacuolar-ATPase V0 domain, one of two isoforms (Vph1p and Stv1p); Vph1p is located in V-ATPase complexes of the vacuole while Stv1p is located in V-ATPase complexes of the Golgi and endosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.09500.09500.2 | 5.6124 | 0.3566 | 100.0% | 1761.2522 | 1761.985 | 1 | 6.657 | 85.7% | 1 | R.LIQMEDATDQIEVQK.N | 2 |
| * | PARC_hx1_02_itms.08896.08896.2 | 3.7435 | 0.3146 | 100.0% | 1419.5922 | 1420.6024 | 1 | 6.308 | 72.7% | 1 | K.TVEIEQPVYDVK.T | 2 |
| * | PARC_hx1_02_itms.09886.09886.2 | 5.2814 | 0.5673 | 100.0% | 2068.3523 | 2069.146 | 1 | 9.882 | 63.9% | 1 | K.IAESLDANLYDVDSSNEGR.S | 2 |
| * | PARC_hx1_04_itms.15028.15028.2 | 4.0461 | 0.4426 | 100.0% | 1628.9321 | 1628.8169 | 1 | 7.912 | 60.7% | 1 | K.TTSTTLESELYAIAK.E | 2 |
| U | contaminant_KERATIN04 | 4 | 9 | 7.0% | 458 | 49644 | 4.9 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.08000.08000.1 | 3.0102 | 0.2872 | 100.0% | 1301.65 | 1302.4241 | 1 | 6.355 | 63.6% | 2 | R.ALEEANADLEVK.I | 1111 | |
| PARC_hx1_02_itms.08004.08004.2 | 4.5595 | 0.325 | 100.0% | 1305.2122 | 1302.4241 | 1 | 6.344 | 81.8% | 4 | R.ALEEANADLEVK.I | 2222 | |
| PARC_hx1_02_itms.08522.08522.2 | 3.486 | 0.1704 | 100.0% | 1202.0922 | 1202.3097 | 1 | 5.643 | 90.0% | 2 | R.QSVEADINGLR.R | 22 | |
| PARC_hx1_02_itms.07630.07630.2 | 3.1343 | 0.2168 | 100.0% | 1123.0521 | 1123.2511 | 1 | 5.419 | 87.5% | 1 | R.LEQEIATYR.S | 222222 |
| U | YER178W | 2 | 2 | 6.4% | 420 | 46343 | 8.1 | PDA1 SGDID:S000000980, Chr V from 546812-548074, Verified ORF, "E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex, catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA, regulated by glucose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.09051.09051.2 | 2.6016 | 0.1747 | 100.0% | 1068.0721 | 1068.2151 | 2 | 4.315 | 87.5% | 1 | K.LDSIITSYR.C | 2 |
| * | PARC_hx1_02_itms.08826.08826.2 | 2.7449 | 0.2237 | 100.0% | 1943.1721 | 1943.1174 | 1 | 5.476 | 50.0% | 1 | K.YVDEQVELADAAPPPEAK.L | 2 |
| U | YJL034W | 2 | 2 | 4.5% | 682 | 74468 | 4.9 | KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" |
| U | contaminant_GR78_YEAST | 2 | 2 | 4.5% | 682 | 74468 | 4.9 | owl|P16474| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_04_itms.17651.17651.2 | 4.9797 | 0.4893 | 100.0% | 2023.5122 | 2024.2323 | 1 | 8.642 | 70.6% | 1 | R.IEIDSFVDGIDLSETLTR.A | 2 | |
| PARC_hx1_02_itms.09986.09986.2 | 3.3397 | 0.3837 | 100.0% | 1346.2922 | 1346.4802 | 1 | 6.564 | 66.7% | 1 | K.DVDDIVLVGGSTR.I | 2 |
| U | YJL012C | 3 | 3 | 4.2% | 721 | 83155 | 6.8 | VTC4 SGDID:S000003549, Chr X from 413314-411149, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_02_itms.06862.06862.2 | 2.4613 | 0.2667 | 100.0% | 1355.7922 | 1353.4777 | 1 | 4.943 | 60.0% | 1 | K.EVQEQVQHTVR.L | 2 |
| * | PARC_hx1_02_itms.09105.09105.2 | 2.1995 | 0.1421 | 98.9% | 1071.1721 | 1071.2181 | 1 | 4.197 | 81.2% | 1 | K.YTVDQVFAK.M | 2 |
| * | PARC_hx1_02_itms.08951.08951.2 | 2.6756 | 0.1723 | 100.0% | 1076.7922 | 1076.1973 | 1 | 5.371 | 83.3% | 1 | R.TAFQLPGDAR.V | 2 |
| U | YOR127W | 2 | 2 | 4.0% | 1007 | 112831 | 6.4 | RGA1 SGDID:S000005653, Chr XV from 561170-564193, Verified ORF, "GTPase-activating protein for the polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_01_itms.10313.10313.2 | 2.7307 | 0.0291 | 97.0% | 2601.872 | 2603.108 | 111 | 3.21 | 28.6% | 1 | K.GRKISRSLSRRSKDLMINLKSR.A | 2 |
| * | PARC_hx1_04_itms.17381.17381.2 | 3.5407 | 0.2466 | 97.1% | 2204.632 | 2206.2407 | 1 | 5.208 | 47.1% | 1 | N.SDNFEEQKETLYENSESR.N | 2 |
| U | contaminant_KERATIN16 | 2 | 9 | 3.9% | 534 | 57265 | 6.6 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PARC_hx1_02_itms.08343.08343.2 | 4.9059 | 0.1302 | 100.0% | 1479.4922 | 1477.7007 | 1 | 5.757 | 86.4% | 6 | Q.FLEQQNKVLETK.W | 22 | |
| PARC_hx1_02_itms.06951.06951.2 | 2.8576 | 0.2444 | 100.0% | 1107.7322 | 1108.196 | 1 | 5.256 | 81.2% | 3 | R.AQYEEIAQR.S | 222 |
| U | YDL077C | 2 | 2 | 3.3% | 1049 | 122881 | 7.1 | VAM6 SGDID:S000002235, Chr IV from 320120-316971, reverse complement, Verified ORF, "Vacuolar protein that plays a critical role in the tethering steps of vacuolar membrane fusion by facilitating guanine nucleotide exchange on small guanosine triphosphatase Ypt7p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.15013.15013.2 | 2.9999 | 0.2116 | 100.0% | 1549.5322 | 1549.81 | 1 | 4.68 | 66.7% | 1 | K.LFQVYPDLLQNAK.N | 2 |
| * | PARC_hx1_04_itms.14516.14516.2 | 2.3742 | 0.3111 | 100.0% | 2416.7322 | 2417.6782 | 1 | 4.806 | 35.7% | 1 | K.LLNDAIESGSDQLPTNQLNFVK.Y | 2 |
| U | YDR135C | 3 | 3 | 3.0% | 1515 | 171120 | 8.4 | YCF1 SGDID:S000002542, Chr IV from 727546-722999, reverse complement, Verified ORF, "Vacuolar glutathione S-conjugate transporter of the ATP-binding cassette family, has a role in detoxifying metals such as cadmium, mercury, and arsenite; also transports unconjugated bilirubin; similar to human cystic fibrosis protein CFTR" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | PARC_hx1_04_itms.15949.15949.2 | 3.2503 | 0.2045 | 100.0% | 2071.7122 | 2072.2817 | 1 | 4.754 | 56.2% | 1 | R.LFTFFTNEELQPDSVQR.L | 2 |
| * | PARC_hx1_04_itms.14339.14339.2 | 3.4394 | 0.4733 | 100.0% | 1468.3121 | 1468.7106 | 1 | 7.749 | 66.7% | 1 | R.APMTFFETTPIGR.I | 2 |
| * | PARC_hx1_02_itms.10348.10348.2 | 4.055 | 0.3414 | 100.0% | 1619.9521 | 1620.7563 | 1 | 6.021 | 60.7% | 1 | K.VAEFDSPGQLLSDNK.S | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 7152 | 15504 | 17035 |
| Filtered | 40 | 258 | 537 |
| Forward matches | 40 | 258 | 537 |
| Decoy matches | 0 | 0 | 0 |
| Forward FP rate | 0.0% | 0.0% | 0.0% |