DTASelect v1.8 /wfs/bfd/3/scott/cheeseman/chl4 /wfs/dbase/nci/yeast_orfs2 true Use criteria 1.8 Minimum +1 XCorr 2.5 Minimum +2 XCorr 3.5 Minimum +3 XCorr 0.08 Minimum DeltCN 1 Minimum Charge State 3 Maximum Charge State 0.0 Minimum Ion Proportion 1000 Maximum Sp Rank Include Modified peptide inclusion Any Tryptic status requirement Ignore Peptide validation handling XCorr Purge Duplicate Peptides by Protein false Include Only Loci with Unique Peptide false Remove Subset Proteins Ignore Locus validation handling 0 Minimum Modified Peptides per Locus 10 Minimum Redundancy for Low Coverage Loci 2 Minimum Peptides per Locus Locus Sequence Count Spectrum Count Sequence Coverage Length MolWt pI Descriptive Name Unique FileName XCorr DeltCN M+H+ TotalIntensity SpRank IonProportion Redundancy Sequence pI KERATIN03 3 3 10.8% 593 59775 5.2 U no description * cheesemanchl4-04.1471.1471.2 2.9125 0.3632 1708.35 6741.9 1 52.8% 1 K.GSLGGGFSSGGFSGGSFSR.G 10.0625 * cheesemanchl4-04.3801.3801.2 2.888 0.3082 2113.75 7264.1 1 58.8% 1 K.ADLEM*QIESLTEELAYLK.K 3.8554688 * cheesemanchl4-04.3138.3138.3 4.7688 0.304 2875.19 7659.5 1 31.7% 1 R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S 4.142578 NRL_1MCOH 5 12 18.7% 428 47054 8.9 U owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain H... * cheesemanchl4-05.1362.1362.1 2.4641 0.2882 1188.56 5019.9 1 68.2% 1 K.GPSVFPLAPSSK.S 9.078125 * cheesemanchl4-06.2081.2081.2 4.4691 0.3908 2141.32 7007.5 1 61.1% 3 R.TPEVTCVVVDVSHEDPQVK.F 4.4023438 * cheesemanchl4-06.3140.3140.2 4.5533 0.4422 1809.6 7648.0 1 73.3% 5 R.VVSVLTVLHQNWLDGK.E 7.328125 * cheesemanchl4-04.2173.2173.3 3.753 0.3013 3817.43 7754.3 3 18.0% 1 T.KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK.T 4.8945312 * cheesemanchl4-04.2173.2173.2 3.874 0.352 2545.51 7754.3 1 47.6% 2 K.GFYPSDIAVEWESNGQPENNYK.T 3.9648438 ORFP:YAL005C 4 5 12.3% 642 69801 5.1 U SSA1, Chr I from 139501-141429, reverse complement cheesemanchl4-04.2408.2408.2 3.3717 0.3149 1550.93 5349.7 1 65.4% 1 K.NFTPEQISSMVLGK.M 6.5625 cheesemanchl4-04.1413.1413.2 4.2325 0.1745 1460.47 6817.2 1 76.9% 1 K.SQVDEIVLVGGSTR.I 4.4570312 cheesemanchl4-04.2822.2822.2 4.6775 0.5669 2578.16 7860.3 1 50.0% 1 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemanchl4-05.3553.3553.2 4.5032 0.4562 2556.93 4754.8 1 45.8% 2 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 ORFP:YAL034W-A 3 3 19.0% 289 33291 5.2 U MTW1, Chr I from 79720-80589 * cheesemanchl4-04.1846.1846.2 3.5408 0.4384 1466.8 7203.2 1 90.9% 1 R.IPEEYLDANVFR.L 4.142578 * cheesemanchl4-04.2265.2265.2 4.155 0.4308 2256.29 10610.3 1 52.6% 1 K.LYVDSESTSSTEEVEALLQR.L 3.8554688 * cheesemanchl4-02.3315.3315.2 3.5021 0.239 2511.92 6538.5 3 34.1% 1 R.TQAGDIVSIDIEEPQLDLLDDVL.- 3.1992188 ORFP:YBR107C 39 320 76.7% 245 28159 5.2 U IML3, Chr II from 453752-454489, reverse complement * cheesemanchl4-05.2975.2975.2 4.7211 0.4384 2012.16 9371.4 1 68.8% 28 K.LNQLLNLEVDLDIQTIR.V 4.142578 * cheesemanchl4-04.1389.1389.2 3.3028 0.1387 1072.92 6601.1 1 93.8% 1 E.VDLDIQTIR.V 4.4570312 * cheesemanchl4-04.0928.0928.2 2.5114 0.0875 1286.77 8824.9 2 66.7% 1 Q.TIRVPSDPDGGTA.A 4.4570312 * cheesemanchl4-04.1015.1015.2 3.113 0.4142 1663.55 5371.9 1 66.7% 2 R.VPSDPDGGTAADEYIR.Y 3.9648438 * cheesemanchl4-04.1025.1025.2 4.1929 0.5083 1564.52 6797.9 1 75.0% 1 V.PSDPDGGTAADEYIR.Y 3.9648438 * cheesemanchl4-05.1245.1245.2 4.3576 0.3937 1456.33 7003.9 1 91.7% 4 R.LDISNLDEGTYSK.F 4.142578 * cheesemanchl4-04.2352.2352.2 3.7013 0.4704 1892.9 5821.4 1 82.1% 5 K.MEVPMFLCYCGTDNR.N 4.4570312 * cheesemanchl4-04.1876.1876.2 2.9542 0.2416 1909.57 5733.6 1 64.3% 1 K.M*EVPMFLCYCGTDNR.N 4.4570312 * cheesemanchl4-04.1986.1986.2 2.6126 0.2135 1909.91 5120.5 1 53.6% 1 K.MEVPM*FLCYCGTDNR.N 4.4570312 * cheesemanchl4-04.2345.2345.2 3.6472 0.3642 1533.88 9405.3 1 77.3% 1 V.PMFLCYCGTDNR.N 5.6875 * cheesemanchl4-04.2085.2085.2 3.0727 0.1898 1129.38 5870.3 3 87.5% 3 R.NEVVLQWLK.A 6.5625 * cheesemanchl4-04.2365.2365.1 2.5484 0.2174 1130.55 4968.1 1 75.0% 2 R.NEVVLQWLK.A 6.5625 * cheesemanchl4-04.2385.2385.2 3.6664 0.255 1307.45 6916.3 1 80.0% 10 K.AEYGVIMWPIK.F 6.5625 * cheesemanchl4-04.2148.2148.2 3.1788 0.3661 1322.5 5724.1 1 75.0% 2 K.AEYGVIM*WPIK.F 6.5625 * cheesemanchl4-06.2958.2958.2 3.5813 0.4043 1840.44 7357.7 1 67.9% 1 K.AEYGVIMWPIKFEQK.T 6.5625 * cheesemanchl4-05.0965.0965.2 3.4422 0.3828 1154.57 7598.1 1 85.0% 3 K.LADASIVHVTK.E 7.328125 * cheesemanchl4-04.0996.0996.1 2.135 0.236 1155.63 4811.0 3 60.0% 1 K.LADASIVHVTK.E 7.328125 * cheesemanchl4-04.2272.2272.2 2.5485 0.1523 1309.43 6745.3 1 77.8% 1 T.KENIEQITWF.S 4.4570312 * cheesemanchl4-04.1973.1973.2 4.266 0.3617 1484.99 8764.7 1 81.8% 8 K.ENIEQITWFSSK.L 4.4570312 * cheesemanchl4-04.1953.1953.1 1.8069 0.1835 1126.45 3881.0 11 56.2% 1 I.EQITWFSSK.L 6.5625 * cheesemanchl4-04.1149.1149.1 2.3145 0.1861 1271.59 6400.9 11 66.7% 1 K.LYFEPETQDK.N 4.142578 * cheesemanchl4-04.1319.1319.2 2.8903 0.2466 1389.74 4519.8 2 68.2% 1 F.SIEIPRESCEGL.A 4.142578 * cheesemanchl4-04.1582.1582.2 3.8242 0.4328 1899.39 5581.3 1 65.6% 1 R.ESCEGLALGYGNTMHPY.N 4.4570312 * cheesemanchl4-04.1364.1364.2 2.7612 0.2197 1916.95 7803.2 1 53.1% 1 R.ESCEGLALGYGNTM*HPY.N 4.4570312 * cheesemanchl4-04.3577.3577.3 4.8838 0.2891 3938.73 5378.2 1 21.3% 35 R.ESCEGLALGYGNTMHPYNDAIVPYIYNETGMAVER.L 4.251953 * cheesemanchl4-04.2789.2789.3 3.9957 0.2701 3951.19 7667.4 1 21.3% 3 R.ESCEGLALGYGNTM*HPYNDAIVPYIYNETGMAVER.L 4.251953 * cheesemanchl4-04.2963.2963.3 4.2194 0.1167 3954.21 7510.4 2 22.1% 3 R.ESCEGLALGYGNTMHPYNDAIVPYIYNETGM*AVER.L 4.251953 * cheesemanchl4-05.2180.2180.3 3.5544 0.2577 2856.96 8401.4 1 34.4% 1 Y.GNTMHPYNDAIVPYIYNETGMAVER.L 4.716797 * cheesemanchl4-04.2136.2136.2 3.529 0.3797 2055.18 3988.1 1 55.9% 1 Y.NDAIVPYIYNETGMAVER.L 4.142578 * cheesemanchl4-04.0914.0914.2 4.3506 0.3697 1283.09 6577.2 1 90.0% 1 Y.IYNETGMAVER.L 4.4570312 * cheesemanchl4-05.1872.1872.2 3.451 0.3533 1121.0 8527.9 1 95.0% 3 R.LPLTSVILAGH.T 7.328125 * cheesemanchl4-06.2464.2464.2 4.1501 0.4899 1350.34 8837.0 1 87.5% 7 R.LPLTSVILAGHTK.I 9.078125 * cheesemanchl4-06.2364.2364.1 2.9355 0.3741 1351.78 4421.4 1 66.7% 2 R.LPLTSVILAGHTK.I 9.078125 * cheesemanchl4-05.2525.2525.2 3.7735 0.3909 1237.28 8569.1 1 81.8% 2 L.PLTSVILAGHTK.I 9.078125 * cheesemanchl4-05.0810.0810.2 2.9094 0.2928 1027.27 6668.5 1 88.9% 1 L.TSVILAGHTK.I 9.078125 * cheesemanchl4-06.3221.3221.2 2.8187 0.3812 1804.65 8953.8 1 66.7% 1 R.NRVLAVVLQSIQFTSE.- 6.5625 * cheesemanchl4-02.1695.1695.2 2.7974 0.2076 1070.8 7165.9 1 72.2% 1 R.VLAVVLQSIQ.F 6.125 * cheesemanchl4-02.2398.2398.2 2.7569 0.2368 1318.42 7360.4 1 77.3% 1 R.VLAVVLQSIQFT.S 6.125 * cheesemanchl4-03.2527.2527.2 5.1936 0.3711 1537.28 7622.3 1 80.8% 177 R.VLAVVLQSIQFTSE.- 3.7460938 ORFP:YBR211C 25 65 50.3% 324 37506 4.9 U AME1, Chr II from 646116-647090, reverse complement * cheesemanchl4-05.1486.1486.2 4.9705 0.3952 1551.84 7896.6 1 91.7% 7 R.RTDDIDDDVIVFK.T 4.251953 * cheesemanchl4-04.1679.1679.2 4.5161 0.3111 1395.45 5586.8 2 86.4% 8 R.TDDIDDDVIVFK.T 3.8554688 * cheesemanchl4-04.1880.1880.2 3.7125 0.4136 2152.2 4610.5 1 52.8% 4 K.LANSFEFPITTNNVNAQDR.H 4.4570312 * cheesemanchl4-05.1930.1930.3 3.784 0.3824 2489.84 8978.0 1 30.0% 1 R.HEHGYQPLDAEDYPMIDSENK.S 4.4160156 * cheesemanchl4-06.2022.2022.2 3.9114 0.4085 2490.72 7840.2 1 47.5% 3 R.HEHGYQPLDAEDYPMIDSENK.S 4.4160156 * cheesemanchl4-03.0969.0969.2 3.6255 0.3326 1527.42 3972.2 1 75.0% 1 L.DAEDYPMIDSENK.S 3.8554688 * cheesemanchl4-04.1636.1636.2 3.6518 0.2887 1155.27 7335.9 1 87.5% 1 R.YNFDDIPIR.Q 4.4570312 * cheesemanchl4-04.1343.1343.2 3.2012 0.1814 1340.09 5120.5 1 85.0% 1 R.LFQTISDQMTR.D 6.5625 * cheesemanchl4-04.1079.1079.2 3.0673 0.1674 1356.26 5331.1 1 85.0% 1 R.LFQTISDQM*TR.D 6.5625 * cheesemanchl4-04.2309.2309.2 3.0508 0.2365 1602.4 6614.0 1 57.7% 1 R.DLKDILDINVSNNE.L 3.9648438 * cheesemanchl4-05.2724.2724.2 4.7194 0.2691 2408.93 6922.3 1 57.9% 9 R.DLKDILDINVSNNELCYQLK.Q 4.4023438 * cheesemanchl4-06.3022.3022.3 5.0179 0.3831 2409.28 9084.2 1 42.1% 1 R.DLKDILDINVSNNELCYQLK.Q 4.4023438 * cheesemanchl4-04.2390.2390.2 4.3809 0.3417 2052.62 5365.0 1 68.8% 6 K.DILDINVSNNELCYQLK.Q 4.142578 * cheesemanchl4-04.1461.1461.2 4.2313 0.3051 1443.67 9227.0 1 86.4% 6 R.KEDLNQQIISVR.N 6.5625 * cheesemanchl4-04.0934.0934.2 3.1308 0.2031 1383.93 6547.2 1 85.0% 1 K.DWHDLQNEQAK.L 4.716797 * cheesemanchl4-05.1658.1658.2 3.1783 0.2491 1331.59 5879.0 1 81.8% 2 K.RLNDLTSTLLGK.Y 9.078125 * cheesemanchl4-06.4165.4165.3 5.3509 0.4408 3995.97 8416.0 1 23.5% 3 K.IMSQDSEDDSIRDDSNILDIAHFVDLMDPYNGLLK.K 4.1220703 * cheesemanchl4-06.4077.4077.3 4.6395 0.3097 4012.54 8085.3 1 23.5% 2 K.IM*SQDSEDDSIRDDSNILDIAHFVDLMDPYNGLLK.K 4.1220703 * cheesemanchl4-06.3534.3534.3 3.6849 0.2251 4014.44 8250.9 1 22.1% 1 K.IMSQDSEDDSIRDDSNILDIAHFVDLM*DPYNGLLK.K 4.1220703 * cheesemanchl4-03.1125.1125.2 3.4636 0.1671 1594.37 5475.4 4 57.7% 1 Q.DSEDDSIRDDSNIL.D 3.8007812 * cheesemanchl4-06.4158.4158.2 4.2924 0.3717 2620.08 6544.5 1 38.6% 1 R.DDSNILDIAHFVDLMDPYNGLLK.K 4.251953 * cheesemanchl4-06.3476.3476.2 4.0627 0.3835 1962.85 7081.6 1 59.4% 1 L.DIAHFVDLMDPYNGLLK.K 4.716797 * cheesemanchl4-06.2900.2900.2 4.2453 0.4112 1662.97 6725.0 1 76.9% 1 A.HFVDLMDPYNGLLK.K 5.6328125 * cheesemanchl4-05.1896.1896.2 2.5305 0.1854 1679.92 7939.7 6 42.3% 1 A.HFVDLM*DPYNGLLK.K 5.6328125 * cheesemanchl4-04.2205.2205.2 3.006 0.0886 1378.01 4579.6 1 77.3% 1 F.VDLMDPYNGLLK.K 4.4570312 ORFP:YDL229W 2 2 6.2% 613 66625 5.4 U SSB1, Chr IV from 44066-45907 ORFP:YNL209W 2 2 6.2% 613 66618 5.5 U SSB2, Chr XIV from 252058-253899 cheesemanchl4-04.1993.1993.2 3.8188 0.5123 1730.81 6253.4 1 70.6% 1 R.IINEPTAAAIAYGLGAGK.S 6.5625 cheesemanchl4-04.2597.2597.2 4.3256 0.4116 2167.77 7491.3 1 60.5% 1 R.LESYVASIEQTVTDPVLSSK.L 4.142578 ORFP:YDR254W 50 285 69.9% 458 52827 8.8 U CHL4, Chr IV from 965104-966480 * cheesemanchl4-04.2040.2040.2 3.2071 0.2457 1840.72 3154.3 1 66.7% 3 R.LEDNYVPTSDTLVVFK.Q 4.142578 * cheesemanchl4-06.4426.4426.2 3.0798 0.3214 1866.54 7136.0 1 76.7% 4 K.LPVTVLYDLTLSWFAK.F 6.5625 * cheesemanchl4-06.4849.4849.2 4.343 0.4018 2463.19 6598.8 1 50.0% 5 K.FGGSFDGDIYLLTETLDLLIEK.G 3.8554688 * cheesemanchl4-05.2705.2705.2 3.5894 0.3352 1402.42 6960.2 1 81.8% 2 Y.LLTETLDLLIEK.G 4.142578 * cheesemanchl4-04.1735.1735.2 2.9511 0.2705 1174.58 4933.4 1 88.9% 1 L.TETLDLLIEK.G 4.142578 * cheesemanchl4-02.3215.3215.2 4.1683 0.46 1601.83 4734.3 1 70.8% 1 R.ILYVYWPDGLNVF.Q 3.7460938 * cheesemanchl4-06.2010.2010.2 2.62 0.2991 1641.21 5471.1 8 50.0% 1 A.LRGDGKPYVVKLQPA.K 9.6796875 * cheesemanchl4-04.1415.1415.2 3.7205 0.2696 1292.38 5554.4 1 90.0% 2 K.FIENLQTDLAK.I 4.4570312 * cheesemanchl4-06.2165.2165.2 3.1767 0.2723 1398.52 6151.7 1 77.8% 4 K.IYHCHVYMFK.H 8.2578125 * cheesemanchl4-06.2266.2266.1 2.0417 0.1252 1398.62 4978.7 1 66.7% 1 K.IYHCHVYMFK.H 8.2578125 * cheesemanchl4-04.2918.2918.3 4.5532 0.3359 2336.18 6947.7 1 40.0% 5 R.IQLFDSNNLFLSTPNIGSINK.E 6.5625 * cheesemanchl4-05.2816.2816.2 5.3387 0.4801 2339.26 8252.1 1 52.5% 56 R.IQLFDSNNLFLSTPNIGSINK.E 6.5625 * cheesemanchl4-06.3414.3414.2 2.6396 0.2017 1797.39 7027.8 1 53.6% 1 R.RPYYVAFPLNSPIIF.H 8.8046875 * cheesemanchl4-05.2619.2619.2 3.2369 0.2447 1519.37 3667.8 1 66.7% 1 Y.YVAFPLNSPIIFH.S 7.328125 * cheesemanchl4-06.2904.2904.2 3.5812 0.3898 1948.85 5306.2 1 62.5% 1 Y.YVAFPLNSPIIFHSVDK.D 7.328125 * cheesemanchl4-05.1109.1109.1 2.0228 0.1568 1256.57 4442.9 1 65.0% 2 L.NSPIIFHSVDK.D 7.328125 * cheesemanchl4-05.1178.1178.2 3.1744 0.379 1257.54 7708.0 1 75.0% 3 L.NSPIIFHSVDK.D 7.328125 * cheesemanchl4-05.1809.1809.2 4.0115 0.3171 1875.93 8573.2 1 63.3% 3 L.NSPIIFHSVDKDIYAR.L 7.328125 * cheesemanchl4-06.2146.2146.2 3.7679 0.306 1762.5 8664.3 1 71.4% 1 N.SPIIFHSVDKDIYAR.L 7.328125 * cheesemanchl4-05.1157.1157.1 1.8899 0.1422 1202.65 4118.7 1 66.7% 1 R.ETIIFKPVQK.I 8.8046875 * cheesemanchl4-05.1156.1156.2 2.7933 0.1145 1203.38 6376.7 1 83.3% 2 R.ETIIFKPVQK.I 8.8046875 * cheesemanchl4-06.2592.2592.2 4.37 0.444 1442.49 9973.6 1 75.0% 3 K.SIHNIMTLLGPSR.F 10.0625 * cheesemanchl4-06.2168.2168.2 3.2059 0.1418 1454.95 7387.1 2 62.5% 1 K.SIHNIM*TLLGPSR.F 10.0625 * cheesemanchl4-04.2192.2192.3 3.5152 0.2023 3234.39 7228.1 1 21.3% 1 H.NIMTLLGPSRFAESMGPWECYASANFER.S 4.716797 * cheesemanchl4-04.2172.2172.2 4.3183 0.4763 2153.3 6866.9 1 58.8% 7 R.FAESMGPWECYASANFER.S 4.142578 * cheesemanchl4-04.1827.1827.2 3.6739 0.4299 2168.66 8154.9 1 67.6% 2 R.FAESM*GPWECYASANFER.S 4.142578 * cheesemanchl4-04.1805.1805.2 2.9413 0.3282 1804.89 7034.8 1 57.1% 1 E.SMGPWECYASANFER.S 4.4570312 * cheesemanchl4-05.0492.0492.1 2.0754 0.2845 740.36 2596.7 1 83.3% 2 K.HQGLTGK.K 9.078125 * cheesemanchl4-06.2468.2468.3 4.3829 0.2238 3350.92 8271.8 1 26.0% 2 K.VMVREFDDSFLNDDENFYGKEEPEIRR.L 4.3134766 * cheesemanchl4-04.2074.2074.2 4.0097 0.3884 1957.86 6367.3 1 70.0% 8 R.EFDDSFLNDDENFYGK.E 3.8007812 * cheesemanchl4-04.2176.2176.3 3.7492 0.326 2709.67 6437.6 1 34.5% 3 R.EFDDSFLNDDENFYGKEEPEIR.R 3.8896484 * cheesemanchl4-04.2350.2350.2 3.6939 0.4353 2710.39 10265.5 1 38.1% 5 R.EFDDSFLNDDENFYGKEEPEIR.R 3.8896484 * cheesemanchl4-04.2162.2162.2 2.5057 0.1946 1856.12 9101.7 1 50.0% 1 L.NDDENFYGKEEPEIR.R 4.1152344 * cheesemanchl4-03.0799.0799.1 2.1022 0.243 989.54 5196.1 2 71.4% 1 N.DDENFYGK.E 4.142578 * cheesemanchl4-05.0758.0758.2 2.5246 0.2954 1282.26 3582.5 1 77.3% 1 K.FKGSANGVMDQK.Y 8.8046875 * cheesemanchl4-01.0419.0419.1 1.9665 0.2718 1007.64 4696.6 9 61.1% 3 K.GSANGVMDQK.Y 6.5625 * cheesemanchl4-06.2034.2034.2 4.257 0.4647 1929.83 9176.4 1 64.3% 1 K.YNDLKEFNEHVHNIR.N 6.4804688 * cheesemanchl4-05.0837.0837.2 3.0943 0.1872 1296.39 6288.1 1 83.3% 14 K.EFNEHVHNIR.N 6.5078125 * cheesemanchl4-06.1821.1821.2 2.9753 0.2902 1166.23 6525.3 1 81.2% 1 E.FNEHVHNIR.N 7.4101562 * cheesemanchl4-04.0809.0809.2 4.9796 0.3014 1494.51 8006.7 1 87.5% 3 K.KNEDSGEPVYISR.Y 4.716797 * cheesemanchl4-04.0815.0815.2 4.5334 0.2742 1366.26 5069.0 1 77.3% 2 K.NEDSGEPVYISR.Y 4.142578 * cheesemanchl4-04.1189.1189.1 1.9638 0.0811 1037.54 3725.7 3 68.8% 1 R.YSSLVPIEK.V 6.5625 * cheesemanchl4-04.1340.1340.2 2.68 0.2225 971.4 3576.5 13 75.0% 1 Y.SSLVPIEKV.G 6.5625 * cheesemanchl4-04.2618.2618.2 3.4921 0.3166 1434.32 5885.3 1 79.2% 2 K.FNGNDIFGGLHEL.C 4.4570312 * cheesemanchl4-05.2025.2025.3 3.5142 0.327 1836.44 5364.0 1 43.3% 1 K.FNGNDIFGGLHELCDK.N 4.716797 * cheesemanchl4-04.2547.2547.2 4.3826 0.3689 1839.76 6890.7 1 63.3% 86 K.FNGNDIFGGLHELCDK.N 4.716797 * cheesemanchl4-05.3712.3712.3 4.6173 0.4652 3252.75 10592.9 1 30.2% 13 K.NLINIDKVPGWLAGENGSFSGTIMNGDFQR.E 4.716797 * cheesemanchl4-06.3021.3021.3 5.1331 0.489 3268.51 8376.7 1 35.3% 1 K.NLINIDKVPGWLAGENGSFSGTIM*NGDFQR.E 4.716797 * cheesemanchl4-04.2445.2445.2 5.0024 0.4517 2442.05 9285.8 1 59.1% 16 K.VPGWLAGENGSFSGTIMNGDFQR.E 4.4570312 * cheesemanchl4-04.2057.2057.2 4.5718 0.3763 2457.99 9675.7 1 45.5% 2 K.VPGWLAGENGSFSGTIM*NGDFQR.E 4.4570312 ORFP:YDR318W 24 54 72.9% 251 29211 5.7 U MCM21, Chr IV from 1104184-1104939 * cheesemanchl4-04.3034.3034.2 3.2076 0.2565 2263.43 6639.6 1 57.5% 1 H.QMFDPGVADLLDTDILTSPSK.R 3.9648438 * cheesemanchl4-05.2867.2867.2 4.7711 0.4755 2136.76 7329.9 1 71.1% 3 Q.MFDPGVADLLDTDILTSPSK.R 3.9648438 * cheesemanchl4-04.2831.2831.2 3.9872 0.4488 2152.41 6403.4 1 63.2% 1 Q.M*FDPGVADLLDTDILTSPSK.R 3.9648438 * cheesemanchl4-06.3105.3105.2 2.5974 0.2308 2162.58 9355.8 1 39.5% 1 M.FDPGVADLLDTDILTSPSKR.K 4.4023438 * cheesemanchl4-04.2398.2398.2 4.6457 0.3635 1745.31 9862.6 1 73.1% 4 R.SELEDYIVLENVYR.M 3.9648438 * cheesemanchl4-05.3779.3779.2 4.5669 0.4431 1856.77 4843.8 1 63.3% 4 R.MFGITFFPLVDPIDLK.I 4.4570312 * cheesemanchl4-04.3674.3674.2 4.1967 0.4514 1870.25 6477.6 1 76.7% 6 R.M*FGITFFPLVDPIDLK.I 4.4570312 * cheesemanchl4-04.2821.2821.1 2.3124 0.1708 1303.64 5420.3 2 65.0% 2 T.FFPLVDPIDLK.I 4.4570312 * cheesemanchl4-04.2805.2805.2 2.949 0.3266 1304.29 3442.9 1 85.0% 4 T.FFPLVDPIDLK.I 4.4570312 * cheesemanchl4-04.2817.2817.2 2.6463 0.2567 1010.33 4846.0 2 87.5% 1 F.PLVDPIDLK.I 4.4570312 * cheesemanchl4-04.1101.1101.2 3.4218 0.216 1108.9 5607.4 1 88.9% 1 K.DASGEIFVDR.E 4.142578 * cheesemanchl4-06.2096.2096.2 3.4421 0.2108 1590.23 7381.7 1 66.7% 2 R.TSQFEKPHYVLLK.K 8.640625 * cheesemanchl4-04.2285.2285.2 2.6295 0.1885 1029.35 6197.7 1 85.7% 2 K.SNSWFLFK.H 9.078125 * cheesemanchl4-06.2890.2890.2 2.6002 0.3452 2368.76 6833.6 1 38.1% 1 Q.GIFDDTNGGLVISHDDAYLFAK.R 4.4023438 * cheesemanchl4-06.2380.2380.2 3.0539 0.1059 1358.67 7336.4 2 85.0% 1 K.RVFLQLVEVQK.R 9.078125 * cheesemanchl4-05.1774.1774.2 3.8298 0.2019 1203.19 8974.9 4 88.9% 3 R.VFLQLVEVQK.R 6.5625 * cheesemanchl4-06.3741.3741.2 4.7167 0.484 2208.98 9962.1 1 72.2% 3 K.IIHDLDLDLESSMVSFFVK.D 4.4023438 * cheesemanchl4-04.2833.2833.2 2.8762 0.299 2478.8 10504.8 1 37.5% 1 K.QNEIVSCSILDDIHDFSQNNK.S 4.4023438 * cheesemanchl4-04.2098.2098.2 3.3176 0.3744 1646.55 7386.8 1 69.2% 1 C.SILDDIHDFSQNNK.S 4.716797 * cheesemanchl4-06.3442.3442.2 3.7915 0.3618 1932.71 5850.1 1 65.6% 5 K.SKWEIALLGSLDDLELK.L 4.4023438 * cheesemanchl4-06.3576.3576.2 4.0377 0.4448 1715.69 5124.3 1 89.3% 4 K.WEIALLGSLDDLELK.L 3.9648438 * cheesemanchl4-04.2751.2751.2 3.3903 0.3667 1400.57 5371.1 1 87.5% 1 E.IALLGSLDDLELK.L 4.142578 * cheesemanchl4-06.2217.2217.1 2.0962 0.1076 1179.64 4397.0 17 61.1% 1 K.LNHSFATIFK.- 9.078125 * cheesemanchl4-06.2222.2222.2 2.8618 0.2366 1180.53 5799.0 1 72.2% 1 K.LNHSFATIFK.- 9.078125 ORFP:YDR383C 15 43 53.6% 252 28613 4.7 U YDR383C, Chr IV from 1239949-1240707, reverse complement * cheesemanchl4-04.2573.2573.2 5.2064 0.5375 2415.82 7244.0 1 55.0% 5 L.LSSDDYLMDDLAGELPNEVCR.L 3.8007812 * cheesemanchl4-04.2004.2004.2 3.6723 0.3922 2428.77 7329.8 1 52.5% 1 L.LSSDDYLM*DDLAGELPNEVCR.L 3.8007812 * cheesemanchl4-04.2439.2439.2 3.0592 0.2794 2299.4 7371.6 1 47.4% 1 L.SSDDYLMDDLAGELPNEVCR.L 3.8007812 * cheesemanchl4-04.2525.2525.2 4.3371 0.3909 1744.06 7529.1 1 70.0% 4 R.ASQSQQIMELVGDIPK.Y 4.4570312 * cheesemanchl4-04.2060.2060.2 3.4071 0.2216 1760.67 8915.3 1 66.7% 1 R.ASQSQQIM*ELVGDIPK.Y 4.4570312 * cheesemanchl4-04.0460.0460.2 3.2308 0.4108 1602.26 6193.8 1 73.1% 1 R.NRVEGEPQSTSIER.L 4.716797 * cheesemanchl4-04.2109.2109.2 5.9119 0.4825 2219.67 7674.1 1 72.2% 5 K.LPQMEVADEEEVEVENDLK.V 3.6367188 * cheesemanchl4-04.1627.1627.2 3.9887 0.3618 2232.81 8744.9 1 55.6% 1 K.LPQM*EVADEEEVEVENDLK.V 3.6367188 * cheesemanchl4-04.1004.1004.2 2.6554 0.2637 1081.33 6514.6 1 93.8% 1 K.VLSEYSNLR.K 6.5625 * cheesemanchl4-04.0883.0883.2 3.3995 0.3622 1133.95 6598.7 1 83.3% 1 K.CQALQIGESK.L 6.5625 * cheesemanchl4-04.0892.0892.1 2.2996 0.1246 1135.4 3153.0 2 66.7% 1 K.CQALQIGESK.L 6.5625 * cheesemanchl4-04.2116.2116.2 4.854 0.4895 2039.26 8836.6 1 58.3% 7 K.LSDILSQTNSINSLTTSIK.E 6.5625 * cheesemanchl4-04.1801.1801.2 4.791 0.4695 2057.9 5885.0 1 55.9% 11 K.EASEDDDISEYFATYNGK.L 3.8007812 * cheesemanchl4-04.1484.1484.2 2.8611 0.1476 1032.14 3029.2 1 81.2% 1 K.LVVALEEMK.L 4.4570312 * cheesemanchl4-05.1402.1402.1 1.879 0.0887 1033.44 2455.9 4 68.8% 2 K.LVVALEEMK.L 4.4570312 ORFP:YGR179C 15 88 45.3% 406 47434 6.5 U YGR179C, Chr VII from 853670-854890, reverse complement * cheesemanchl4-04.1385.1385.2 4.5755 0.4516 2132.72 10400.8 1 70.6% 1 K.SLFYENSDDAEEGEIEER.T 3.6367188 * cheesemanchl4-03.0735.0735.2 2.5821 0.2257 1378.91 7775.7 5 68.2% 1 N.SDDAEEGEIEER.T 3.6914062 * cheesemanchl4-06.0339.0339.2 2.6138 0.276 1371.01 9014.3 1 65.0% 1 R.TNKEEGQYHHK.G 7.4101562 * cheesemanchl4-06.2129.2129.3 3.6175 0.3957 2530.69 7080.3 1 38.6% 2 K.LQSHLSDGSATSGEGNVRPWEFR.K 5.796875 * cheesemanchl4-06.2750.2750.2 4.2894 0.4756 1768.62 5209.0 1 73.3% 3 R.LLETNTVSALDSVFEK.Y 4.142578 * cheesemanchl4-04.1778.1778.2 3.6591 0.3993 1411.41 5767.3 1 70.8% 1 E.TNTVSALDSVFEK.Y 4.4570312 * cheesemanchl4-04.1690.1690.1 2.4852 0.1851 1258.56 8731.7 1 61.1% 3 R.DLDIEYIYSK.R 4.142578 * cheesemanchl4-04.1692.1692.2 3.8412 0.3388 1258.89 5991.9 1 83.3% 2 R.DLDIEYIYSK.R 4.142578 * cheesemanchl4-04.0440.0440.2 2.8233 0.2047 1280.73 8046.8 1 83.3% 1 R.YSQELQNNER.L 4.4570312 * cheesemanchl4-05.0853.0853.1 1.8245 0.2366 935.55 3989.5 1 71.4% 1 K.DLHPVLNK.A 7.328125 * cheesemanchl4-05.2114.2114.2 2.7594 0.357 2721.79 6155.9 1 37.0% 1 K.AMEYTYGLESTNGFMHPDGPVTFR.N 4.716797 * cheesemanchl4-04.1952.1952.2 4.2422 0.3886 1753.62 10348.8 1 75.0% 8 R.NDSHELNLMLNDPIK.S 4.716797 * cheesemanchl4-05.2142.2142.2 4.4332 0.4087 1586.04 7487.8 1 73.1% 60 R.LDKEEVLSLLPSLK.E 4.716797 * cheesemanchl4-04.1293.1293.2 2.8904 0.2646 1864.81 6314.2 1 53.3% 2 K.ETMGQMISDSHEEEIK.E 4.251953 * cheesemanchl4-06.1766.1766.2 2.6425 0.1411 2314.3 11386.1 3 33.3% 1 K.EVFVPHHESHQDKTEEDIH.- 5.0585938 ORFP:YHR155W 2 5 3.3% 1228 144129 8.1 U YHR155W, Chr VIII from 407104-410790 * cheesemanchl4-05.2721.2721.2 2.8956 0.2707 2283.21 7541.9 1 37.5% 3 K.VGSKTLFHVLFGDKSQVFPSS.L 8.8046875 * cheesemanchl4-04.1833.1833.3 4.057 0.1532 2213.83 10512.0 2 37.5% 2 F.NDREKM*SDVIKLCGFLGVL.P 6.5625 ORFP:YIR010W 7 7 16.5% 576 65835 5.4 U YIR010W, Chr IX from 375428-377158 * cheesemanchl4-03.0914.0914.2 3.1278 0.1018 1432.83 9608.1 1 85.0% 1 K.DEEETEYFENK.Q 3.8007812 * cheesemanchl4-06.2145.2145.2 2.748 0.4036 1255.47 4523.6 1 75.0% 1 K.HIQGFPTLGER.L 7.328125 * cheesemanchl4-04.2451.2451.2 2.6237 0.3627 1988.39 4619.6 2 44.1% 1 K.DIPEEDFYTVVGNASFGK.N 3.9648438 * cheesemanchl4-04.1127.1127.2 3.3291 0.2636 1711.85 7149.0 1 65.4% 1 K.ILDNTENYDDTELR.Q 3.8554688 * cheesemanchl4-03.0827.0827.2 2.9992 0.3034 1485.88 8197.4 1 72.7% 1 L.DNTENYDDTELR.Q 3.8554688 * cheesemanchl4-03.0986.0986.2 4.1234 0.356 2577.97 8225.9 1 57.5% 1 L.FQENDDDDDDDDEVDYSEIQR.S 3.4863281 * cheesemanchl4-04.1578.1578.2 3.4135 0.2797 2267.98 7326.5 1 42.1% 1 K.ISSETDDDHSQVINPQQLLK.G 4.4023438 ORFP:YJR045C 2 2 5.7% 654 70621 5.6 U SSC1, Chr X from 519330-521294, reverse complement * cheesemanchl4-04.2669.2669.2 4.356 0.491 2263.58 7118.1 1 50.0% 1 K.VQGSVIGIDLGTTNSAVAIMEGK.V 4.4570312 * cheesemanchl4-04.1499.1499.2 3.3372 0.3082 1532.59 5330.7 1 61.5% 1 R.QAVVNPENTLFATK.R 6.5625 ORFP:YJR112W 2 2 12.4% 201 23686 4.9 U NNF1, Chr X from 636723-637328 * cheesemanchl4-04.2501.2501.2 4.1934 0.2152 1401.2 8064.5 1 81.8% 1 K.LNELDELILEAK.E 3.9648438 * cheesemanchl4-04.1288.1288.2 4.1538 0.2249 1532.7 8850.2 1 79.2% 1 K.VNEMNDQLAQELK.D 4.142578 ORFP:YJR135C 17 64 66.5% 239 27583 6.0 U MCM22, Chr X from 675752-676471, reverse complement * cheesemanchl4-04.0582.0582.2 3.143 0.1998 1031.37 5396.5 20 75.0% 1 K.NLENQIGNK.R 6.5625 * cheesemanchl4-05.0704.0704.2 2.6183 0.2049 1186.04 9250.5 3 77.8% 2 K.NLENQIGNKR.Y 9.078125 * cheesemanchl4-04.1197.1197.2 2.7513 0.1862 1753.91 6138.2 1 46.7% 1 R.SLDTEGKPVNSEVFTE.L 3.9648438 * cheesemanchl4-04.2793.2793.2 3.7772 0.4379 2135.35 3398.3 1 58.3% 26 R.SLDTEGKPVNSEVFTELLR.K 4.4023438 * cheesemanchl4-04.2366.2366.2 4.0266 0.4822 1404.65 7677.9 1 86.4% 1 K.PVNSEVFTELLR.K 4.4570312 * cheesemanchl4-04.3065.3065.2 4.2411 0.3862 1738.46 8555.1 1 80.0% 5 R.ADPIGFSLTSNFLSLR.A 6.5625 * cheesemanchl4-05.1876.1876.2 2.94 0.2456 1137.89 7575.8 1 77.8% 2 F.SLTSNFLSLR.A 10.0625 * cheesemanchl4-04.2006.2006.2 4.723 0.3797 2155.93 6570.7 1 61.1% 3 R.AQSSSEWLSLMNDQSVDQK.A 4.142578 * cheesemanchl4-05.1814.1814.2 4.2281 0.3231 1590.39 7394.3 1 76.9% 2 K.AMLLLQNNINSDLK.E 6.5625 * cheesemanchl4-06.1989.1989.1 1.8237 0.1824 1130.56 4166.7 201 50.0% 1 R.KLQHQMTIM.D 9.078125 * cheesemanchl4-06.1942.1942.2 4.0308 0.3288 1460.47 6608.5 1 81.8% 2 R.KLQHQMTIMDSK.K 8.8046875 * cheesemanchl4-05.0944.0944.2 3.2633 0.3705 1332.29 7532.3 1 85.0% 1 K.LQHQMTIMDSK.K 7.328125 * cheesemanchl4-04.3334.3334.1 2.4071 0.1193 1338.42 3030.1 2 65.0% 2 K.ELWDSLADFLK.G 4.142578 * cheesemanchl4-04.3335.3335.2 3.1763 0.2969 1340.32 7639.7 1 80.0% 4 K.ELWDSLADFLK.G 4.142578 * cheesemanchl4-04.3066.3066.3 3.7398 0.4363 2971.74 5764.7 1 33.0% 1 K.GYLVPNLDDNDESIDSLTNEVM*LLM*K.R 3.8007812 * cheesemanchl4-04.2322.2322.2 4.7213 0.4476 1860.2 7212.7 1 73.3% 8 R.LIEHDLNLTLNDFSSK.T 4.716797 * cheesemanchl4-04.2104.2104.2 3.3485 0.3791 1616.47 9127.8 1 60.0% 2 R.ANIITVIEGSTNPGTK.Y 6.5625 ORFP:YKR061W 1 10 4.2% 425 50914 5.8 U KTR2, Chr XI from 557313-558590 * cheesemanchl4-05.1444.1444.2 3.1531 0.0959 2211.96 9889.7 2 47.1% 10 D.SNHPDNIDLNVISCLRRW.W 7.109375 ORFP:YLL024C 5 6 14.7% 639 69504 5.1 U SSA2, Chr XII from 95565-97484, reverse complement * cheesemanchl4-04.1272.1272.2 3.451 0.441 1592.48 5359.5 1 71.4% 1 K.NQAAMNPANTVFDAK.R 6.5625 cheesemanchl4-04.2408.2408.2 3.3717 0.3149 1550.93 5349.7 1 65.4% 1 K.NFTPEQISSMVLGK.M 6.5625 cheesemanchl4-04.1413.1413.2 4.2325 0.1745 1460.47 6817.2 1 76.9% 1 K.SQVDEIVLVGGSTR.I 4.4570312 cheesemanchl4-04.2822.2822.2 4.6775 0.5669 2578.16 7860.3 1 50.0% 1 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemanchl4-05.3553.3553.2 4.5032 0.4562 2556.93 4754.8 1 45.8% 2 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 ORFP:YLR189C 2 2 2.9% 1198 136389 7.5 U UGT51, Chr XII from 530799-534395, reverse complement * cheesemanchl4-04.1261.1261.1 1.9505 0.1798 1243.58 2696.3 12 60.0% 1 D.DENGYNNDNAD.D 3.3359375 * cheesemanchl4-05.2435.2435.2 2.8296 0.0923 2501.41 10854.3 30 30.4% 1 M.KSIAGLLTTASVYAGM*NNAQEMNV.L 6.5625 ORFP:YLR259C 2 2 5.9% 572 60755 5.3 U HSP60, Chr XII from 663284-665002, reverse complement * cheesemanchl4-04.3003.3003.2 2.7679 0.3788 1526.56 10040.7 1 50.0% 1 K.GVETLAEAVAATLGPK.G 4.4570312 * cheesemanchl4-04.2730.2730.2 3.0773 0.394 1985.91 5260.9 1 47.1% 1 K.ISSIQDILPALEISNQSR.R 4.4570312 ORFP:YLR315W 12 21 63.4% 153 17889 4.7 U YLR315W, Chr XII from 764808-765269 * cheesemanchl4-05.3324.3324.2 3.3782 0.3558 1828.61 7043.7 1 60.0% 4 Y.VSDSLLTTLISFQEFK.Q 4.4570312 * cheesemanchl4-06.2989.2989.3 4.1291 0.3464 2895.22 7689.1 1 31.8% 2 K.QQLQSYTSDEQQLQHWYELLQAR.D 4.716797 * cheesemanchl4-04.3075.3075.2 3.7395 0.3506 2397.11 7935.4 1 47.2% 1 Q.SYTSDEQQLQHWYELLQAR.D 4.716797 * cheesemanchl4-06.2782.2782.2 3.4351 0.3121 2145.54 6428.7 1 56.2% 4 Y.TSDEQQLQHWYELLQAR.D 4.716797 * cheesemanchl4-04.1506.1506.2 3.1079 0.1595 1290.22 7826.5 1 85.0% 1 R.FLESEQLSHSL.S 4.4570312 * cheesemanchl4-06.3820.3820.2 3.8285 0.3924 2538.66 9817.2 1 38.1% 1 R.FLESEQLSHSLSLETLIDALYK.I 4.4023438 * cheesemanchl4-04.3090.3090.2 3.6042 0.3125 1266.39 8103.6 1 85.0% 1 L.SLETLIDALYK.I 4.4570312 * cheesemanchl4-04.1518.1518.2 3.4325 0.2408 1286.49 4743.3 1 85.0% 1 R.LQILDDAIQEK.T 4.142578 * cheesemanchl4-04.1528.1528.1 2.6735 0.1788 1287.57 7288.8 1 65.0% 2 R.LQILDDAIQEK.T 4.142578 * cheesemanchl4-04.2141.2141.2 4.4158 0.4174 1426.35 7628.3 1 77.3% 2 K.TSELAEFENMVR.S 4.142578 * cheesemanchl4-04.1498.1498.2 2.9442 0.2214 1442.43 8972.3 1 72.7% 1 K.TSELAEFENM*VR.S 4.142578 * cheesemanchl4-02.2352.2352.2 2.6454 0.1515 1576.61 8311.3 1 83.3% 1 L.QIIQSYINLLEEN.- 3.5546875 ORFP:YLR381W 39 83 53.8% 733 84487 8.7 U YLR381W, Chr XII from 879723-881924 * cheesemanchl4-04.1491.1491.2 2.7558 0.3382 1067.66 4846.5 1 87.5% 1 K.TTLSLLYEK.S 6.5625 * cheesemanchl4-05.1729.1729.2 3.3746 0.4516 1560.67 8067.5 1 65.4% 3 K.QYGLSSPQLQALVR.L 9.078125 * cheesemanchl4-04.1809.1809.2 3.8866 0.3725 1493.4 8212.4 1 70.8% 2 R.LLCETSIIDTVTK.V 4.4570312 * cheesemanchl4-04.2387.2387.2 4.2502 0.3489 1934.86 5556.2 1 60.0% 4 K.VYIVENCFLPDGYLTK.E 4.4570312 * cheesemanchl4-05.3404.3404.1 1.9989 0.1278 1208.82 4364.2 1 66.7% 1 K.ELLLEIINHL.G 4.4570312 * cheesemanchl4-06.3752.3752.2 4.6903 0.5013 2052.93 8164.5 1 64.7% 2 K.ELLLEIINHLGTPTVFSR.Y 5.6328125 * cheesemanchl4-05.1490.1490.2 3.0405 0.3708 1455.88 5240.5 1 70.8% 2 R.IQTPPVLQSALCK.W 8.2578125 * cheesemanchl4-05.1720.1720.2 2.9259 0.1924 1768.87 4689.9 24 46.4% 1 L.VIWQATTPVDVKPWK.L 8.8046875 * cheesemanchl4-06.1757.1757.1 1.9698 0.2633 993.43 2120.8 3 57.1% 1 R.CAMHPGYR.D 8.230469 * cheesemanchl4-04.1252.1252.2 3.0741 0.1813 1242.63 3747.7 2 72.7% 1 R.DAPGSATLILQR.F 6.5625 * cheesemanchl4-05.2416.2416.2 3.486 0.3251 2511.7 8220.8 1 50.0% 4 R.FQCLVGASSQITESIITINCNR.K 5.6875 * cheesemanchl4-05.2009.2009.2 2.7404 0.2448 1157.38 6174.8 1 88.9% 1 K.LDAHFLSILK.R 7.328125 * cheesemanchl4-04.1989.1989.2 2.5432 0.224 2005.38 10257.2 1 47.1% 1 R.AHPANFPADTVQNTIDMY.L 4.4570312 * cheesemanchl4-05.1312.1312.2 3.4451 0.2508 1210.45 8289.6 1 85.0% 1 K.PSLNSNVLLPR.K 10.0625 * cheesemanchl4-04.2662.2662.2 4.2944 0.5208 1931.28 5439.8 1 67.9% 2 R.DESSSPYEWCIWQLK.R 4.142578 * cheesemanchl4-04.3199.3199.2 3.4861 0.2938 2342.54 5210.5 7 35.0% 1 H.QIETPQEVIPIIISVSSMDNK.L 4.142578 * cheesemanchl4-04.1223.1223.2 2.8939 0.2142 1137.13 4543.4 2 81.2% 1 R.IIQTFCNLK.Y 8.2578125 * cheesemanchl4-04.1228.1228.1 2.4589 0.2394 1138.51 3811.6 1 75.0% 1 R.IIQTFCNLK.Y 8.2578125 * cheesemanchl4-06.2964.2964.2 3.8326 0.3763 1997.63 4792.6 1 55.9% 1 K.VCGGILPLWKPELISGTR.E 8.2578125 * cheesemanchl4-06.4004.4004.2 2.7831 0.3791 2002.73 6886.4 1 55.9% 1 R.FSTMAFISSLDILTQLSK.Q 6.5625 * cheesemanchl4-06.3738.3738.2 2.5926 0.3203 2019.09 6402.6 1 47.1% 1 R.FSTM*AFISSLDILTQLSK.Q 6.5625 * cheesemanchl4-05.2881.2881.2 4.3575 0.3849 1536.33 9299.0 1 73.1% 4 M.AFISSLDILTQLSK.Q 6.5625 * cheesemanchl4-04.2425.2425.2 3.339 0.2796 1317.83 7838.9 1 90.9% 1 F.ISSLDILTQLSK.Q 6.5625 * cheesemanchl4-04.2747.2747.2 4.4437 0.4905 1943.67 5184.7 1 65.6% 3 K.SDYAIQYLIVGPDIMNK.V 4.4570312 * cheesemanchl4-04.2396.2396.2 3.1628 0.1399 1957.79 5047.7 1 53.1% 1 K.SDYAIQYLIVGPDIM*NK.V 4.4570312 * cheesemanchl4-01.4249.4249.1 1.871 0.1992 1106.42 3411.1 4 61.1% 1 K.VFSSDDPLLL.S 3.5546875 * cheesemanchl4-04.1881.1881.2 4.5642 0.3981 1654.55 8268.7 1 78.6% 3 K.VFSSDDPLLLSAACR.Y 4.4570312 * cheesemanchl4-05.2808.2808.2 5.0069 0.4474 1967.63 6677.3 1 78.6% 5 R.MQNQYIMDLTNYLYR.N 6.5625 * cheesemanchl4-05.2677.2677.2 4.5312 0.3954 1983.7 6530.1 1 75.0% 3 R.M*QNQYIMDLTNYLYR.N 6.5625 * cheesemanchl4-04.2802.2802.2 4.8772 0.3168 1984.53 8316.4 1 75.0% 2 R.MQNQYIM*DLTNYLYR.N 6.5625 * cheesemanchl4-04.2622.2622.2 3.0482 0.2892 1998.29 12190.3 1 64.3% 2 R.M*QNQYIM*DLTNYLYR.N 6.5625 * cheesemanchl4-04.2637.2637.2 3.0204 0.3389 1244.31 4336.2 1 80.0% 4 K.SLFGVSPDFFK.Q 6.5625 * cheesemanchl4-04.2645.2645.1 2.6872 0.2766 1245.75 3695.2 1 70.0% 5 K.SLFGVSPDFFK.Q 6.5625 * cheesemanchl4-04.2402.2402.2 2.5989 0.178 1665.53 7016.1 1 61.5% 1 K.QILENLYIPTADFK.N 4.4570312 * cheesemanchl4-05.2725.2725.2 4.6258 0.4612 1939.51 8235.7 1 70.0% 8 K.FTSGIINEETFNNFFR.V 4.4570312 * cheesemanchl4-06.2125.2125.2 3.8115 0.2871 1556.21 7669.1 1 75.0% 2 R.VHHDEIGQHGWIK.G 6.767578 * cheesemanchl4-05.0821.0821.2 2.9006 0.1315 1037.5 4508.7 1 87.5% 3 K.GVNNIHDLR.V 7.328125 * cheesemanchl4-06.2061.2061.2 4.2154 0.3353 1530.62 6719.7 1 79.2% 1 K.ILMHLSNTANPYR.D 9.078125 * cheesemanchl4-06.3713.3713.1 1.9579 0.1679 1301.71 4593.1 1 55.0% 1 R.DIAAFLFTYLK.S 6.5625 ORFP:YOR288C 2 2 4.7% 318 36517 9.6 U MPD1, Chr XV from 852117-853073, reverse complement * cheesemanchl4-01.3775.3775.1 1.8407 0.154 1152.39 5215.9 60 50.0% 1 L.LLGLFIMNEV.K 3.7460938 * cheesemanchl4-01.3217.3217.1 1.8162 0.1717 1097.28 6227.4 12 56.2% 1 I.M*NEVKAQNF.Y 6.5625 ORFP:YPL018W 16 43 47.7% 369 42858 8.6 U CTF19, Chr XVI from 517647-518756 * cheesemanchl4-04.1417.1417.2 3.2442 0.2989 1433.36 8959.7 1 72.7% 2 K.QQLSLLDDDQVR.A 4.142578 * cheesemanchl4-02.1740.1740.2 3.0988 0.3298 1466.15 8193.9 1 77.3% 1 R.NTLLQEIQTYQN.I 3.7460938 * cheesemanchl4-06.3533.3533.2 5.4209 0.4212 1952.56 9050.1 1 76.7% 8 R.NTLLQEIQTYQNILMK.E 6.5625 * cheesemanchl4-04.3097.3097.2 5.1284 0.3759 1966.99 9248.0 1 76.7% 5 R.NTLLQEIQTYQNILM*K.E 6.5625 * cheesemanchl4-04.3086.3086.3 5.2858 0.3523 1968.15 9362.8 1 56.7% 2 R.NTLLQEIQTYQNILM*K.E 6.5625 * cheesemanchl4-04.4121.4121.3 4.1313 0.1994 3364.57 8454.7 1 25.8% 3 K.NGDILQNDITQDFLNLISISSSNPNSAISDR.K 3.9648438 * cheesemanchl4-04.2641.2641.2 3.6208 0.4529 1465.74 3471.2 1 90.9% 3 K.YDTLPLLNMNLR.L 6.5625 * cheesemanchl4-06.1982.1982.2 3.1632 0.4224 1667.63 4916.8 1 76.9% 1 R.DHTYPHLQVSVQSR.D 7.4101562 * cheesemanchl4-06.2174.2174.2 3.0474 0.2865 1870.68 7440.1 1 63.3% 1 R.DRVHNDGIEVLVVNYK.F 5.796875 * cheesemanchl4-06.2218.2218.2 4.0926 0.3626 1599.31 5399.0 1 80.8% 3 R.VHNDGIEVLVVNYK.F 5.6328125 * cheesemanchl4-04.2125.2125.2 3.1266 0.2912 1369.34 5340.6 1 70.0% 1 R.NTMNPFEIQFK.M 6.5625 * cheesemanchl4-04.2214.2214.2 2.7225 0.1032 1289.46 5659.3 2 88.9% 1 K.CLLSLYEFDK.I 4.4570312 * cheesemanchl4-06.3849.3849.2 3.8495 0.3303 1374.49 8478.5 1 81.8% 2 K.TGIFQNLINLLK.R 9.078125 * cheesemanchl4-04.1552.1552.2 3.8247 0.4344 1714.57 7317.6 1 76.9% 2 R.CYLMNNSDSLIVER.V 4.4570312 * cheesemanchl4-06.2994.2994.2 3.6077 0.2243 1533.87 9305.8 1 70.8% 2 K.LQINFIITMPGER.G 6.5625 * cheesemanchl4-04.2639.2639.2 5.0214 0.3758 1844.48 6893.4 1 82.1% 6 R.FNQIDLDEICYGLIK.E 4.142578 ORFP:YPR046W 9 46 46.4% 181 21161 5.8 U MCM16, Chr XVI from 656794-657339 * cheesemanchl4-05.1068.1068.2 2.568 0.1775 1123.12 5545.0 1 87.5% 2 R.HQLQINLEK.T 7.328125 * cheesemanchl4-05.1066.1066.1 2.3119 0.0966 1124.59 4226.0 3 68.8% 1 R.HQLQINLEK.T 7.328125 * cheesemanchl4-04.1479.1479.2 3.3783 0.3683 1632.69 3408.6 1 73.1% 4 R.LLEKPDNTNVLFTK.L 6.5625 * cheesemanchl4-02.3299.3299.2 5.1656 0.529 2225.07 10205.1 1 63.9% 4 K.LQNLLEESNSLDYELLQSL.G 3.3359375 * cheesemanchl4-02.3156.3156.2 4.3109 0.3828 2477.88 9933.9 1 42.9% 1 K.LQNLLEESNSLDYELLQSLGAQ.S 3.3359375 * cheesemanchl4-02.3077.3077.2 4.1639 0.373 2651.71 9613.9 1 45.7% 1 K.LQNLLEESNSLDYELLQSLGAQSS.L 3.3359375 * cheesemanchl4-05.3415.3415.3 4.9096 0.3219 3030.83 6687.1 1 30.8% 23 K.LQNLLEESNSLDYELLQSLGAQSSLHK.Q 4.4023438 * cheesemanchl4-05.1146.1146.2 4.5018 0.4609 1689.56 5054.3 1 76.7% 9 K.FPKPTIPPDDSDTAGK.Q 4.716797 * cheesemanchl4-04.3118.3118.2 2.5201 0.12 2118.2 10464.2 40 32.4% 1 K.QVEVEKENETIQELMIAL.Q 3.8554688 gi|67568|pir||ELPG 6 7 19.9% 266 28927 8.1 U pancreatic elastase (EC 3.4.21.36) I precursor - pig * cheesemanchl4-04.1598.1598.2 3.1713 0.3184 1479.14 4074.9 1 77.3% 1 R.NSWPSQISLQYR.S 9.078125 * cheesemanchl4-04.0896.0896.2 3.2901 0.3912 1807.13 8720.9 1 60.0% 1 H.NLNQNDGTEQYVGVQK.I 4.4570312 * cheesemanchl4-06.2162.2162.1 2.2085 0.2906 1268.66 3614.8 1 77.8% 1 G.VQKIVVHPYW.N 8.8046875 * cheesemanchl4-06.2160.2160.2 2.6016 0.3732 1269.17 8370.2 1 83.3% 1 G.VQKIVVHPYW.N 8.8046875 * cheesemanchl4-05.1530.1530.2 2.7759 0.2085 1884.32 9072.8 1 43.3% 2 G.VQKIVVHPYWNTDDVA.A 5.6328125 * cheesemanchl4-05.1656.1656.2 3.4473 0.3548 1359.2 8978.4 1 86.4% 1 T.LNSYVQLGVLPR.A 9.078125 gi|89258|pir||A26823 2 2 11.2% 269 28753 8.0 U pancreatic elastase II (EC 3.4.21.71) precursor - pig * cheesemanchl4-05.1186.1186.2 2.8203 0.2158 1541.95 7841.0 1 57.1% 1 R.HSLSTNEPGSLAVKV.S 7.328125 * cheesemanchl4-02.2783.2783.2 2.574 0.2783 1723.69 7801.5 1 53.6% 1 R.VSNYIDWINSVIANN.- 3.7460938 Proteins Peptide IDs Copies Unfiltered 5758 18880 39803 Redundant 28 311 1184 Nonredundant 27 307 1179