DTASelect v1.8 /wfs/bfd/3/scott/cheeseman/bim1 /wfs/dbase/nci/yeast_orfs2 -o true Use criteria 1.8 Minimum +1 XCorr 2.5 Minimum +2 XCorr 3.5 Minimum +3 XCorr 0.08 Minimum DeltCN 1 Minimum charge state 3 Maximum charge state 0.0 Minimum ion proportion 1000 Maximum Sp rank Include Modified peptide inclusion Any Tryptic status requirement Ignore Peptide validation handling XCorr Purge duplicate peptides by protein false Include only loci with unique peptide true Remove subset proteins Ignore Locus validation handling 0 Minimum modified peptides per locus 10 Minimum redundancy for low coverage loci 2 Minimum peptides per locus Locus Sequence Count Spectrum Count Sequence Coverage Length MolWt pI Validation Status Descriptive Name Unique FileName XCorr DeltCN M+H+ TotalIntensity SpRank IonProportion Redundancy Sequence pI ORFP:YER016W 122 1344 87.2% 344 38362 5.4 U BIM1, Chr V from 188276-189310 * cheesemanbim1-02.3153.3153.1 2.0165 0.1617 1161.6 4496.1 16 50.0% 1 R.TELLTWLNGL.L 3.7460938 * cheesemanbim1-02.3154.3154.2 2.6897 0.2631 1161.7 5182.5 1 66.7% 1 R.TELLTWLNGL.L 3.7460938 * cheesemanbim1-02.3534.3534.2 3.3524 0.2831 1275.4 6246.2 1 70.0% 1 R.TELLTWLNGLL.N 3.7460938 * cheesemanbim1-02.3864.3864.2 3.2467 0.2607 1500.63 8091.3 1 66.7% 3 R.TELLTWLNGLLNL.N 3.7460938 * cheesemanbim1-06.3405.3405.2 5.6343 0.4905 1908.81 8667.0 1 80.0% 62 R.TELLTWLNGLLNLNYK.K 6.5625 * cheesemanbim1-05.3196.3196.2 3.5114 0.3523 1563.61 7734.0 1 70.8% 1 L.LTWLNGLLNLNYK.K 8.8046875 * cheesemanbim1-05.2992.2992.2 3.4429 0.3029 1450.02 6781.2 1 86.4% 2 L.TWLNGLLNLNYK.K 8.8046875 * cheesemanbim1-04.0437.0437.2 2.7254 0.2593 1084.67 6519.4 2 78.6% 1 L.NYKKIEEC.G 6.5625 * cheesemanbim1-04.0595.0595.2 2.9782 0.2645 1370.16 10670.6 1 63.6% 2 L.NYKKIEECGTGA.A 6.5625 * cheesemanbim1-04.3289.3289.3 4.8682 0.4524 2994.63 6413.2 1 31.0% 4 K.KIEECGTGAAYCQIMDSIYGDLPMNR.V 4.4023438 * cheesemanbim1-03.3211.3211.3 3.8492 0.307 2868.02 8731.2 1 27.1% 1 K.IEECGTGAAYCQIMDSIYGDLPMNR.V 3.9648438 * cheesemanbim1-04.3015.3015.2 4.0799 0.4492 2048.59 7766.4 1 62.5% 2 A.AYCQIMDSIYGDLPMNR.V 4.4570312 * cheesemanbim1-04.2483.2483.2 4.7728 0.3978 1813.45 7633.1 1 82.1% 4 Y.CQIMDSIYGDLPMNR.V 4.4570312 * cheesemanbim1-04.2282.2282.2 3.6581 0.4245 1653.53 7457.5 1 65.4% 5 C.QIMDSIYGDLPMNR.V 4.4570312 * cheesemanbim1-03.1193.1193.2 3.1292 0.3108 1281.58 5548.0 1 85.0% 1 M.DSIYGDLPMNR.V 4.4570312 * cheesemanbim1-05.1277.1277.2 4.8049 0.4345 1953.64 8356.0 1 70.0% 3 R.VKFNATAEYEFQTNYK.I 6.5625 * cheesemanbim1-06.1728.1728.2 5.2698 0.5009 1728.11 8677.1 1 84.6% 92 K.FNATAEYEFQTNYK.I 4.4570312 * cheesemanbim1-03.0876.0876.2 3.3928 0.4184 1293.41 6302.4 1 83.3% 2 T.AEYEFQTNYK.I 4.4570312 * cheesemanbim1-03.0878.0878.1 2.3824 0.1827 1293.49 5621.4 1 72.2% 1 T.AEYEFQTNYK.I 4.4570312 * cheesemanbim1-04.0863.0863.2 2.5856 0.3002 1011.35 4678.4 1 92.9% 1 K.ILQSCFSR.H 8.2578125 * cheesemanbim1-03.0524.0524.1 1.8536 0.0838 726.55 4886.1 14 70.0% 1 K.TVYVDK.L 6.5625 * cheesemanbim1-05.3111.3111.2 4.5794 0.2672 1870.44 7373.0 1 76.9% 11 R.CKFQDNLEFLQWLK.K 6.5625 * cheesemanbim1-05.3047.3047.3 4.2868 0.2207 1870.63 7153.1 1 48.1% 2 R.CKFQDNLEFLQWLK.K 6.5625 * cheesemanbim1-04.2191.2191.2 2.775 0.0919 1154.21 4479.6 3 81.2% 1 C.KFQDNLEFL.Q 4.4570312 * cheesemanbim1-02.2925.2925.2 2.6977 0.1555 1340.91 6931.1 2 72.2% 1 K.FQDNLEFLQW.L 3.5546875 * cheesemanbim1-06.2833.2833.2 5.0247 0.2385 1582.56 6781.4 1 90.9% 71 K.FQDNLEFLQWLK.K 4.4570312 * cheesemanbim1-05.2912.2912.2 4.0349 0.2673 1710.08 8138.2 1 75.0% 2 K.FQDNLEFLQWLKK.H 6.5625 * cheesemanbim1-05.3220.3220.1 2.6261 0.1639 1307.52 5147.3 1 72.2% 1 Q.DNLEFLQWLK.K 4.4570312 * cheesemanbim1-05.0308.0308.2 3.8877 0.4464 1432.72 5166.9 1 81.8% 56 R.HKDESVYDPDAR.R 4.8945312 * cheesemanbim1-02.0700.0700.2 2.7687 0.1521 1167.85 3451.4 1 72.2% 5 K.DESVYDPDAR.R 3.9648438 * cheesemanbim1-06.1468.1468.2 3.7232 0.3459 1506.79 10387.2 1 75.0% 1 R.KYRPIITNNSATK.P 10.294922 * cheesemanbim1-06.1472.1472.2 3.1519 0.3482 1760.9 5609.0 1 71.4% 3 R.KYRPIITNNSATKPR.T 11.1015625 * cheesemanbim1-06.1477.1477.3 4.8677 0.3035 1761.36 9049.4 1 55.4% 1 R.KYRPIITNNSATKPR.T 11.1015625 * cheesemanbim1-06.1511.1511.2 4.051 0.3723 1631.83 5229.0 1 69.2% 5 K.YRPIITNNSATKPR.T 10.9921875 * cheesemanbim1-06.1515.1515.3 4.8616 0.2061 1633.03 7300.8 1 46.2% 2 K.YRPIITNNSATKPR.T 10.9921875 * cheesemanbim1-05.0615.0615.2 3.112 0.2836 1315.38 8515.3 1 77.3% 2 R.PIITNNSATKPR.T 10.9921875 * cheesemanbim1-06.1447.1447.2 4.1795 0.3633 1684.64 6756.5 1 67.6% 1 K.RSSSTGTGSAMSGGLATR.H 12.003906 * cheesemanbim1-06.1451.1451.3 3.9443 0.2925 1685.79 6807.1 1 44.1% 1 K.RSSSTGTGSAMSGGLATR.H 12.003906 * cheesemanbim1-04.0752.0752.2 4.2856 0.3419 1528.37 8831.9 1 65.6% 5 R.SSSTGTGSAMSGGLATR.H 10.0625 * cheesemanbim1-05.0808.0808.2 2.6703 0.2814 1029.46 5625.9 1 77.8% 2 R.HSSLGINGSR.K 10.0625 * cheesemanbim1-06.1423.1423.1 2.2065 0.2692 1029.6 2236.6 1 66.7% 2 R.HSSLGINGSR.K 10.0625 * cheesemanbim1-06.1413.1413.2 3.1057 0.1058 1157.14 6405.0 1 85.0% 1 R.HSSLGINGSRK.T 10.9921875 * cheesemanbim1-05.0907.0907.2 3.7236 0.2796 1373.52 6055.4 1 75.0% 2 R.KTSVTQGQLVAIQ.A 9.078125 * cheesemanbim1-05.1597.1597.3 4.809 0.437 1915.95 8849.3 1 47.1% 27 R.KTSVTQGQLVAIQAELTK.S 8.8046875 * cheesemanbim1-06.2058.2058.2 6.2004 0.556 1917.01 9141.0 1 76.5% 151 R.KTSVTQGQLVAIQAELTK.S 8.8046875 * cheesemanbim1-04.2310.2310.3 5.093 0.2847 1788.41 10713.6 1 48.4% 8 K.TSVTQGQLVAIQAELTK.S 6.5625 * cheesemanbim1-05.2166.2166.2 5.0842 0.3303 1789.54 7449.8 1 68.8% 82 K.TSVTQGQLVAIQAELTK.S 6.5625 * cheesemanbim1-04.2083.2083.1 3.0099 0.264 1270.63 8677.8 3 54.5% 4 Q.GQLVAIQAELTK.S 6.5625 * cheesemanbim1-05.1299.1299.2 4.4592 0.4392 1273.44 8176.3 1 86.4% 2 Q.GQLVAIQAELTK.S 6.5625 * cheesemanbim1-04.2097.2097.1 2.1751 0.1306 974.61 8550.4 1 75.0% 3 L.VAIQAELTK.S 6.5625 * cheesemanbim1-03.1414.1414.2 4.5991 0.4532 1869.23 4915.2 1 76.7% 77 K.SQETIGSLNEEIEQYK.G 3.9648438 * cheesemanbim1-03.1374.1374.2 4.7703 0.4415 2028.31 5956.8 1 58.8% 1 K.SQETIGSLNEEIEQYKGT.V 3.9648438 * cheesemanbim1-04.1962.1962.2 4.7209 0.3269 2212.65 8653.2 1 55.3% 10 K.SQETIGSLNEEIEQYKGTVS.T 3.9648438 * cheesemanbim1-05.2637.2637.2 4.3808 0.4154 2426.57 10016.8 1 47.6% 12 K.SQETIGSLNEEIEQYKGTVSTL.E 3.9648438 * cheesemanbim1-03.2414.2414.2 3.3849 0.3429 2555.75 9465.7 1 40.9% 2 K.SQETIGSLNEEIEQYKGTVSTLE.I 3.8554688 * cheesemanbim1-05.2714.2714.3 5.3286 0.3716 2955.6 4608.6 1 34.0% 22 K.SQETIGSLNEEIEQYKGTVSTLEIER.E 4.1152344 * cheesemanbim1-05.2706.2706.2 3.9882 0.4091 2740.03 8388.0 1 41.3% 2 Q.ETIGSLNEEIEQYKGTVSTLEIER.E 4.1152344 * cheesemanbim1-04.1404.1404.2 4.0332 0.2778 1525.13 6267.8 1 75.0% 1 E.TIGSLNEEIEQYK.G 4.142578 * cheesemanbim1-05.2697.2697.2 3.5834 0.3197 2610.06 9137.6 1 40.9% 2 E.TIGSLNEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-05.2698.2698.2 4.5168 0.3819 2509.05 8271.5 1 54.8% 3 T.IGSLNEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-04.2885.2885.2 4.3014 0.4966 2395.82 7777.7 1 52.5% 10 I.GSLNEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-05.2704.2704.2 3.1118 0.2612 2338.71 6430.5 1 44.7% 1 G.SLNEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-05.2702.2702.2 3.2968 0.3465 2252.21 7490.5 1 47.2% 2 S.LNEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-01.1684.1684.1 2.2594 0.0827 926.44 5147.1 2 75.0% 1 L.NEEIEQY.K 3.4726562 * cheesemanbim1-03.0599.0599.2 2.593 0.0922 1053.89 5320.2 6 85.7% 1 L.NEEIEQYK.G 4.142578 * cheesemanbim1-03.0611.0611.1 3.0041 0.1183 1054.53 3975.9 3 78.6% 1 L.NEEIEQYK.G 4.142578 * cheesemanbim1-03.0755.0755.2 3.0627 0.3405 1397.47 8802.4 1 63.6% 1 L.NEEIEQYKGTVS.T 4.142578 * cheesemanbim1-03.1038.1038.2 3.6937 0.292 1612.42 7968.6 1 69.2% 1 L.NEEIEQYKGTVSTL.E 4.142578 * cheesemanbim1-05.1226.1226.2 4.9327 0.4331 2139.52 6062.0 1 70.6% 8 L.NEEIEQYKGTVSTLEIER.E 4.251953 * cheesemanbim1-05.0823.0823.2 2.9041 0.2534 1233.99 7178.8 1 80.0% 4 Y.KGTVSTLEIER.E 6.5625 * cheesemanbim1-05.0855.0855.2 3.1412 0.3511 1105.32 7896.2 1 88.9% 2 K.GTVSTLEIER.E 4.4570312 * cheesemanbim1-04.2397.2397.2 3.5402 0.3807 1461.42 5191.3 1 85.0% 7 S.TLEIEREFYFN.K 4.142578 * cheesemanbim1-03.1296.1296.2 2.7032 0.2032 1247.2 6766.9 2 75.0% 1 L.EIEREFYFN.K 4.142578 * cheesemanbim1-04.3660.3660.3 3.5031 0.2905 3300.7 6960.1 2 21.2% 1 R.EFYFNKLRDIEILVHTTQDLINEGVYK.F 5.0039062 * cheesemanbim1-05.1237.1237.2 3.1047 0.282 1108.44 3627.8 3 87.5% 2 K.LRDIEILVH.T 5.6328125 * cheesemanbim1-06.2618.2618.3 6.6114 0.5187 2470.69 9166.0 1 47.5% 71 K.LRDIEILVHTTQDLINEGVYK.F 4.8945312 * cheesemanbim1-06.2566.2566.2 5.9879 0.4454 2470.9 8594.1 1 55.0% 18 K.LRDIEILVHTTQDLINEGVYK.F 4.8945312 * cheesemanbim1-03.1214.1214.2 2.7789 0.1526 1041.41 5658.2 2 81.2% 1 R.DIEILVHTT.Q 4.4570312 * cheesemanbim1-03.2843.2843.2 2.5758 0.2424 1754.46 9454.2 1 57.1% 1 R.DIEILVHTTQDLINE.G 3.9648438 * cheesemanbim1-05.3135.3135.3 6.4921 0.4247 2201.62 7530.6 1 58.3% 21 R.DIEILVHTTQDLINEGVYK.F 4.4023438 * cheesemanbim1-05.3283.3283.2 6.383 0.4538 2203.86 7255.7 1 69.4% 157 R.DIEILVHTTQDLINEGVYK.F 4.4023438 * cheesemanbim1-04.3368.3368.2 4.3394 0.3902 1974.48 9024.4 1 65.6% 2 I.EILVHTTQDLINEGVYK.F 4.716797 * cheesemanbim1-05.1392.1392.2 5.2581 0.5313 1844.66 8621.6 1 70.0% 8 E.ILVHTTQDLINEGVYK.F 5.6328125 * cheesemanbim1-05.3152.3152.2 3.3875 0.3783 1731.58 8404.2 1 67.9% 1 I.LVHTTQDLINEGVYK.F 5.6328125 * cheesemanbim1-04.1020.1020.2 5.0007 0.496 1619.39 6345.2 1 80.8% 8 L.VHTTQDLINEGVYK.F 5.6328125 * cheesemanbim1-04.1007.1007.3 3.5087 0.1214 1620.15 5218.1 3 44.2% 1 L.VHTTQDLINEGVYK.F 5.6328125 * cheesemanbim1-03.0962.0962.2 3.8043 0.3031 1382.15 6331.5 1 86.4% 3 H.TTQDLINEGVYK.F 4.4570312 * cheesemanbim1-03.1678.1678.2 2.9674 0.2642 1528.98 9541.7 1 70.8% 2 H.TTQDLINEGVYKF.N 4.4570312 * cheesemanbim1-03.0927.0927.2 2.8289 0.1526 1282.37 6053.4 21 60.0% 1 T.TQDLINEGVYK.F 4.4570312 * cheesemanbim1-03.1776.1776.2 3.1318 0.2058 1198.32 7246.9 1 83.3% 1 Q.DLINEGVYKF.N 4.4570312 * cheesemanbim1-03.0735.0735.2 2.8882 0.3168 1205.5 6725.1 1 70.0% 1 K.FNDETITGHGN.G 4.4570312 * mth.0736.0736.2 3.3985 0.2444 1376.76 8270.4 1 70.8% 2 K.FNDETITGHGNGN.G 4.4570312 * cheesemanbim1-03.0955.0955.2 3.1673 0.3775 1675.36 7469.0 1 59.4% 2 K.FNDETITGHGNGNGGAL.L 4.4570312 * cheesemanbim1-05.0975.0975.2 5.1973 0.5714 1944.65 7171.6 1 52.8% 93 K.FNDETITGHGNGNGGALLR.F 5.6328125 * cheesemanbim1-04.1067.1067.3 3.5777 0.263 1945.41 4979.5 1 36.1% 1 K.FNDETITGHGNGNGGALLR.F 5.6328125 * cheesemanbim1-03.0413.0413.2 2.8376 0.2282 887.49 5767.1 1 85.7% 1 F.NDETITGH.G 4.4570312 * cheesemanbim1-04.1170.1170.1 2.0127 0.2198 1094.57 4630.1 14 50.0% 1 K.KVESILYATA.E 6.5625 * cheesemanbim1-04.1215.1215.2 3.5026 0.3437 1225.69 7178.7 1 85.0% 3 K.KVESILYATAE.G 4.4570312 * cheesemanbim1-05.2194.2194.2 4.4704 0.5082 1429.39 7190.9 1 75.0% 3 K.KVESILYATAEGF.E 4.4570312 * cheesemanbim1-05.2208.2208.2 4.4377 0.4734 1558.46 8737.3 1 69.2% 3 K.KVESILYATAEGFE.M 4.142578 * cheesemanbim1-05.2609.2609.3 8.4932 0.5403 2818.63 10477.9 1 42.7% 80 K.KVESILYATAEGFEMNDGEDELNDK.N 3.9511719 * cheesemanbim1-03.2610.2610.2 4.689 0.4232 2690.54 7244.5 1 54.3% 4 K.VESILYATAEGFEMNDGEDELNDK.N 3.6367188 * cheesemanbim1-03.2051.2051.2 4.9527 0.376 2461.65 8265.6 1 54.8% 2 E.SILYATAEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.1655.1655.2 4.7743 0.4532 2374.51 8553.2 1 55.0% 1 S.ILYATAEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.1097.1097.2 5.1127 0.4679 2148.42 8227.8 1 63.9% 1 L.YATAEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.0998.0998.2 5.2056 0.4844 1988.37 7948.7 1 67.6% 3 Y.ATAEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.0993.0993.2 5.294 0.2736 1917.7 7723.7 1 68.8% 3 A.TAEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.1052.1052.2 4.4078 0.4067 1814.41 7486.2 1 66.7% 5 T.AEGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.1282.1282.2 4.0921 0.3536 2042.24 8945.7 1 58.8% 1 T.AEGFEMNDGEDELNDKNL.G 3.6914062 * cheesemanbim1-03.0995.0995.2 3.1732 0.2713 1742.69 6256.3 1 60.7% 1 A.EGFEMNDGEDELNDK.N 3.6914062 * cheesemanbim1-03.0994.0994.2 5.1116 0.4439 1616.22 7637.8 1 80.8% 4 E.GFEMNDGEDELNDK.N 3.8007812 * cheesemanbim1-03.1233.1233.2 3.26 0.2272 1840.54 10828.8 1 60.0% 1 E.GFEMNDGEDELNDKNL.G 3.8007812 * cheesemanbim1-03.0610.0610.2 3.0626 0.173 1408.92 9589.6 1 81.8% 1 F.EMNDGEDELNDK.N 3.8007812 * cheesemanbim1-03.0908.0908.2 3.4335 0.1589 1636.39 11105.1 1 61.5% 1 F.EMNDGEDELNDKNL.G 3.8007812 * cheesemanbim1-03.0548.0548.2 3.3552 0.1848 1280.21 7023.5 1 85.0% 1 E.MNDGEDELNDK.N 3.8554688 * cheesemanbim1-03.0405.0405.2 3.1788 0.2358 1149.3 6310.0 1 88.9% 1 M.NDGEDELNDK.N 3.8554688 * cheesemanbim1-03.1284.1284.2 3.5361 0.25 1700.2 8946.4 1 60.7% 1 M.NDGEDELNDKNLGEH.G 4.1152344 * cheesemanbim1-04.0787.0787.2 3.1103 0.2467 1444.43 3237.1 2 61.5% 1 K.NLGEHGTVPNQGGY.A 5.359375 * cheesemanbim1-04.0976.0976.3 5.8815 0.5425 3510.58 7338.1 1 29.5% 1 K.NLGEHGTVPNQGGYANSNGEVNGNEGSNHDVIMQ.N 4.4023438 * cheesemanbim1-03.0761.0761.2 3.1871 0.1828 1902.15 6769.1 1 41.2% 1 N.SNGEVNGNEGSNHDVIMQ.N 4.142578 * cheesemanbim1-03.0738.0738.2 3.1416 0.2228 1701.53 5383.4 7 46.7% 2 N.GEVNGNEGSNHDVIMQ.N 4.142578 * cheesemanbim1-01.0876.0876.1 1.8183 0.1883 907.44 3303.4 11 50.0% 1 Q.NDEGEVGVS.N 3.4726562 TRYPSIN 29 83 60.3% 229 23993 7.9 U no description * cheesemanbim1-04.1753.1753.2 3.6309 0.3553 1470.35 4339.6 1 73.1% 1 G.GSLINSQWVVSAAH.C 7.328125 * cheesemanbim1-01.3322.3322.2 3.7116 0.4123 1533.42 7064.6 1 69.2% 6 R.LGEDNINVVEGNEQ.F 3.3359375 * cheesemanbim1-02.2125.2125.2 2.698 0.2912 1949.6 7820.4 1 52.9% 1 R.LGEDNINVVEGNEQFISA.S 3.3359375 * cheesemanbim1-04.1774.1774.2 4.8719 0.4046 2163.81 5163.4 1 57.9% 24 R.LGEDNINVVEGNEQFISASK.S 3.9648438 * cheesemanbim1-03.1640.1640.3 3.7173 0.1998 2166.02 10554.5 1 35.5% 1 R.LGEDNINVVEGNEQFISASK.S 3.9648438 * cheesemanbim1-03.1189.1189.2 2.7718 0.2329 2050.54 5273.8 1 47.2% 1 L.GEDNINVVEGNEQFISASK.S 3.9648438 * cheesemanbim1-03.1190.1190.2 3.0371 0.3159 1993.72 5797.8 1 50.0% 1 G.EDNINVVEGNEQFISASK.S 3.9648438 * cheesemanbim1-04.1273.1273.2 2.9145 0.2634 1750.44 8409.0 1 60.0% 1 D.NINVVEGNEQFISASK.S 4.4570312 * cheesemanbim1-03.1364.1364.1 2.0825 0.0963 1310.45 4859.0 3 50.0% 1 V.VEGNEQFISASK.S 4.4570312 * cheesemanbim1-04.0712.0712.2 3.093 0.2894 1118.43 6575.6 1 72.2% 2 K.SIVHPSYNSN.T 7.328125 * cheesemanbim1-05.0675.0675.1 2.1254 0.2568 1119.4 3334.2 3 61.1% 1 K.SIVHPSYNSN.T 7.328125 * cheesemanbim1-05.0825.0825.2 2.7082 0.2281 1446.89 7012.8 58 50.0% 1 K.SIVHPSYNSNTLN.N 7.328125 * cheesemanbim1-05.0804.0804.2 3.3556 0.2962 1560.26 6529.7 1 65.4% 1 K.SIVHPSYNSNTLNN.D 7.328125 * cheesemanbim1-04.1368.1368.2 3.2539 0.1502 1919.38 7538.9 1 53.1% 2 K.SIVHPSYNSNTLNNDIM.L 5.359375 * cheesemanbim1-06.2047.2047.2 4.7319 0.5305 2274.07 5150.1 1 60.5% 12 K.SIVHPSYNSNTLNNDIMLIK.L 7.328125 * cheesemanbim1-06.1958.1958.3 4.1865 0.2368 2274.25 6614.0 14 30.3% 10 K.SIVHPSYNSNTLNNDIMLIK.L 7.328125 * cheesemanbim1-06.1879.1879.2 3.8565 0.4716 2188.45 6293.8 1 50.0% 1 S.IVHPSYNSNTLNNDIMLIK.L 7.328125 * cheesemanbim1-04.1883.1883.2 3.9203 0.3744 1655.25 6426.9 1 69.2% 2 S.YNSNTLNNDIMLIK.L 6.5625 * cheesemanbim1-04.1646.1646.2 3.684 0.3111 1490.79 5970.2 1 75.0% 2 Y.NSNTLNNDIMLIK.L 6.5625 * cheesemanbim1-04.1528.1528.2 3.3519 0.1572 1175.28 3852.4 1 88.9% 2 N.TLNNDIMLIK.L 6.5625 * cheesemanbim1-06.1379.1379.1 1.8203 0.1318 1046.7 2893.5 8 55.6% 1 K.LKSAASLNSR.V 10.9921875 * cheesemanbim1-04.2503.2503.2 3.9719 0.4731 2666.78 8856.7 1 40.0% 1 R.VASISLPTSCASAGTQCLISGWGNTK.S 8.0390625 * cheesemanbim1-04.0638.0638.1 3.0578 0.2793 1079.46 3454.7 1 72.2% 2 K.APILSDSSCK.S 6.5625 * cheesemanbim1-04.0629.0629.2 2.5052 0.2182 1080.56 6035.0 1 77.8% 1 K.APILSDSSCK.S 6.5625 * cheesemanbim1-01.1642.1642.1 1.8098 0.2147 1039.48 3584.9 1 55.6% 1 K.SAYPGQITSN.M 6.125 * cheesemanbim1-04.2333.2333.3 4.5735 0.3666 2254.31 7342.1 1 45.0% 1 K.SAYPGQITSNMFCAGYLEGGK.D 6.5625 * cheesemanbim1-04.1205.1205.1 2.2293 0.168 1232.42 7780.0 1 65.0% 1 N.MFCAGYLEGGK.D 6.5625 * cheesemanbim1-04.1265.1265.1 2.0195 0.2061 1081.46 4010.0 3 61.1% 1 I.VSWGSGCAQK.N 8.2578125 * cheesemanbim1-06.1275.1275.1 1.8986 0.1737 792.64 3330.6 1 75.0% 1 N.KPGVYTK.V 9.6796875 ORFP:YPL269W 49 124 56.4% 644 74245 8.6 U KAR9, Chr XVI from 33013-34947 * cheesemanbim1-03.1620.1620.2 4.7048 0.5158 1852.69 7835.8 1 71.4% 14 R.SMTIGDDFQENFCER.L 3.9648438 * cheesemanbim1-03.1223.1223.2 2.9604 0.1983 1631.2 7962.4 1 66.7% 1 M.TIGDDFQENFCER.L 3.9648438 * cheesemanbim1-04.3718.3718.3 3.7805 0.197 2393.8 5980.5 1 36.2% 1 L.LVQFYDDLENVASVIPDLVNK.K 3.9648438 * cheesemanbim1-04.3724.3724.2 5.0408 0.3569 2395.53 6852.1 1 57.5% 3 L.LVQFYDDLENVASVIPDLVNK.K 3.9648438 * cheesemanbim1-03.3120.3120.2 4.513 0.2426 2054.58 6572.1 1 61.8% 5 Q.FYDDLENVASVIPDLVNK.K 3.9648438 * cheesemanbim1-05.3026.3026.2 3.1599 0.3009 2179.94 8770.5 1 44.4% 2 Q.FYDDLENVASVIPDLVNKK.R 4.4023438 * cheesemanbim1-02.1207.1207.1 2.1433 0.1352 1210.48 6370.7 3 66.7% 1 L.DLLEDEFSKD.D 3.8554688 * cheesemanbim1-02.1194.1194.2 3.7224 0.263 1212.35 7106.1 1 83.3% 4 L.DLLEDEFSKD.D 3.8554688 * cheesemanbim1-04.3120.3120.2 4.6413 0.4173 1774.63 6270.4 1 78.6% 5 R.FSPMFDVIEESTQIK.T 4.142578 * cheesemanbim1-04.3129.3129.2 4.6077 0.3366 1538.81 6671.0 1 87.5% 1 S.PMFDVIEESTQIK.T 4.142578 * cheesemanbim1-04.2031.2031.2 3.4194 0.212 1344.05 3835.8 1 80.0% 2 K.TQLEPWLTNLK.E 6.5625 * cheesemanbim1-03.1871.1871.2 3.8006 0.3519 1638.44 7527.6 1 73.1% 4 K.ELLDTSLEFNEISK.D 3.9648438 * cheesemanbim1-06.1836.1836.3 4.3469 0.2888 2619.11 8286.8 1 29.8% 1 K.ELLDTSLEFNEISKDHMDTLHK.I 4.696289 * cheesemanbim1-04.1717.1717.2 5.0684 0.4455 1981.77 6730.1 1 73.3% 3 K.IINSNISYCLEIQEER.F 4.142578 * cheesemanbim1-05.1809.1809.2 2.553 0.1806 1401.27 4018.1 1 72.7% 1 R.HTPSFTLEQLVK.L 7.328125 * cheesemanbim1-05.0630.0630.2 2.9473 0.2869 1327.54 7363.2 1 68.2% 4 K.LLGTHTETTEPK.V 5.6328125 * cheesemanbim1-06.1575.1575.2 4.0761 0.5215 1827.71 6464.6 1 65.6% 1 L.GTHTETTEPKVPKFSPA.E 7.328125 * cheesemanbim1-04.1367.1367.1 1.872 0.1156 1134.63 4192.7 2 61.1% 1 K.FSPAEDILSR.K 4.4570312 * cheesemanbim1-04.1375.1375.2 2.8653 0.0911 1044.77 4041.6 2 87.5% 2 K.SLTDILPQR.I 6.5625 * cheesemanbim1-04.2497.2497.2 5.1628 0.3716 1601.7 6940.8 1 88.5% 3 R.NITNITTLQTILQK.K 9.078125 * cheesemanbim1-04.1289.1289.2 2.8205 0.1711 927.55 4146.6 12 91.7% 1 K.TFNIIYR.A 9.078125 * cheesemanbim1-04.2493.2493.2 5.0105 0.434 1421.41 8247.8 1 84.6% 3 R.ALEFSLLDAGVASK.T 4.4570312 * cheesemanbim1-06.1656.1656.1 2.2751 0.1641 1185.58 5550.7 1 66.7% 2 R.WLNIKPTADK.I 8.8046875 * cheesemanbim1-05.1040.1040.2 3.0643 0.2176 1186.2 5937.0 1 88.9% 3 R.WLNIKPTADK.I 8.8046875 * cheesemanbim1-06.2341.2341.3 5.3456 0.4457 2323.52 7360.0 1 41.2% 4 K.SLGFGRPNSVIGTITQDFQER.V 6.5625 * cheesemanbim1-06.2343.2343.2 3.79 0.4053 2324.12 5308.9 1 52.5% 2 K.SLGFGRPNSVIGTITQDFQER.V 6.5625 * cheesemanbim1-04.2609.2609.2 4.0692 0.4928 1705.73 6460.8 1 67.9% 2 R.PNSVIGTITQDFQER.V 4.4570312 * cheesemanbim1-04.2415.2415.2 3.6886 0.4664 1496.12 5514.3 1 70.8% 4 N.SVIGTITQDFQER.V 4.4570312 * cheesemanbim1-03.0554.0554.2 2.9959 0.3759 1777.57 6699.2 1 53.1% 1 R.VAINEGDSNKTPENSTT.V 4.142578 * cheesemanbim1-04.0843.0843.2 4.484 0.5066 2188.86 6320.8 1 42.5% 1 R.VAINEGDSNKTPENSTTVALK.G 4.716797 * cheesemanbim1-04.0847.0847.3 3.9892 0.2998 2190.41 8084.5 2 37.5% 1 R.VAINEGDSNKTPENSTTVALK.G 4.716797 * cheesemanbim1-03.0408.0408.2 3.4215 0.396 1479.38 6047.8 2 57.7% 1 N.EGDSNKTPENSTTV.A 4.142578 * cheesemanbim1-05.1312.1312.2 2.9442 0.3411 1903.8 8903.2 1 50.0% 1 K.MNIKPATSPNSSNAINPF.F 9.078125 * cheesemanbim1-05.1676.1676.3 4.9926 0.3746 2819.08 6693.5 1 38.0% 1 K.MNIKPATSPNSSNAINPFFDPESPNK.G 6.5625 * cheesemanbim1-06.1851.1851.3 5.0721 0.4705 3003.75 5141.8 1 32.4% 2 K.MNIKPATSPNSSNAINPFFDPESPNKGK.L 8.640625 * cheesemanbim1-04.1702.1702.2 4.0436 0.4258 2331.84 7655.6 1 54.8% 1 K.PATSPNSSNAINPFFDPESPNK.G 4.4570312 * cheesemanbim1-05.1343.1343.3 4.8135 0.3863 2517.56 8187.8 1 38.0% 1 K.PATSPNSSNAINPFFDPESPNKGK.L 6.5625 * cheesemanbim1-04.2630.2630.2 3.3211 0.4416 2262.85 3654.6 1 42.1% 12 K.LILSSVPPLPYDETDETTLR.V 3.9648438 * cheesemanbim1-03.1173.1173.2 4.3723 0.4159 1649.6 5471.4 1 73.1% 5 V.PPLPYDETDETTLR.V 3.9648438 * cheesemanbim1-04.0901.0901.2 3.1964 0.279 1567.77 5995.3 1 61.5% 1 R.GENEKSPDSFITSR.H 4.716797 * cheesemanbim1-04.1105.1105.1 2.2463 0.2714 1230.5 7236.0 2 60.0% 2 K.VQITETPLMAK.N 6.5625 * cheesemanbim1-04.1103.1103.2 3.2862 0.1812 1232.3 4338.4 2 80.0% 1 K.VQITETPLMAK.N 6.5625 * cheesemanbim1-06.1752.1752.2 3.9371 0.4486 1805.15 8550.0 1 65.4% 6 K.SVLDIEKDKWNHYR.S 7.328125 * cheesemanbim1-04.0698.0698.2 2.7808 0.2254 1074.73 6805.0 1 72.2% 1 K.VTVENTPIAK.V 6.5625 * cheesemanbim1-04.0652.0652.1 2.1195 0.1019 919.53 3830.6 20 64.3% 1 K.VFQTPPTK.I 9.078125 * cheesemanbim1-04.0657.0657.2 2.55 0.1942 920.02 4349.2 2 85.7% 1 K.VFQTPPTK.I 9.078125 * cheesemanbim1-05.0881.0881.2 2.8512 0.3555 1660.43 4595.2 1 67.9% 1 K.VFQTPPTKITTPNSQ.V 9.078125 * cheesemanbim1-05.0638.0638.2 2.5277 0.1782 1413.35 7241.8 1 62.5% 1 F.QTPPTKITTPNSQ.V 9.078125 * cheesemanbim1-04.1239.1239.2 3.5263 0.382 1588.53 6953.2 1 69.2% 2 K.ITTPNSQVWVPSTR.R 10.0625 KERATIN03 40 76 45.2% 593 59519 5.2 U no description * cheesemanbim1-04.1486.1486.2 3.5684 0.4906 1709.43 8928.1 1 58.3% 1 K.GSLGGGFSSGGFSGGSFSR.G 10.0625 * cheesemanbim1-04.0344.0344.2 2.5909 0.1669 995.08 4682.2 3 75.0% 1 L.SGNEKVTMQ.N 6.5625 cheesemanbim1-04.0973.0973.2 3.0783 0.1829 1067.2 6077.9 1 87.5% 1 Q.NLNDRLASY.L 6.5625 cheesemanbim1-05.0872.0872.2 2.7187 0.238 1065.39 7613.5 1 87.5% 1 R.LASYLDKVR.A 8.8046875 * cheesemanbim1-04.0805.0805.2 3.0752 0.2305 1238.57 7613.8 1 83.3% 1 Y.YKTIDDLKNQ.I 6.5625 * cheesemanbim1-04.0606.0606.2 2.8578 0.1637 1075.6 9722.1 10 75.0% 2 Y.KTIDDLKNQ.I 6.5625 * cheesemanbim1-03.0578.0578.2 2.7589 0.0874 947.89 3027.4 6 85.7% 1 K.TIDDLKNQ.I 4.4570312 * cheesemanbim1-06.3106.3106.3 3.546 0.1466 3054.04 9265.2 3 25.0% 2 K.TIDDLKNQILNLTTDNANILLQIDNAR.L 4.4023438 * cheesemanbim1-05.2958.2958.3 6.2369 0.3439 2369.26 10399.0 1 48.8% 4 K.NQILNLTTDNANILLQIDNAR.L 4.4570312 * cheesemanbim1-04.2290.2290.2 3.8325 0.286 1899.79 7542.8 1 62.5% 1 L.NLTTDNANILLQIDNAR.L 4.4570312 * cheesemanbim1-03.1513.1513.2 4.1034 0.2943 1673.24 6701.7 1 75.0% 2 L.TTDNANILLQIDNAR.L 4.4570312 * cheesemanbim1-03.0765.0765.2 3.0826 0.2264 995.61 4090.6 1 100.0% 2 K.YENEVALR.Q 4.4570312 * cheesemanbim1-03.0711.0711.2 3.0326 0.2315 1122.4 7480.0 1 93.8% 2 K.YENEVALRQ.S 4.4570312 cheesemanbim1-03.1059.1059.2 2.7741 0.2584 1203.34 4544.6 1 75.0% 3 R.QSVEADINGLR.R 4.4570312 * cheesemanbim1-04.3780.3780.2 3.9193 0.4038 2097.75 8022.8 1 55.9% 2 K.ADLEMQIESLTEELAYLK.K 3.8554688 * cheesemanbim1-06.2897.2897.2 4.3529 0.3149 2225.71 7828.3 1 52.8% 2 K.ADLEMQIESLTEELAYLKK.N 4.251953 * cheesemanbim1-04.1893.1893.2 2.513 0.3075 1167.32 5646.2 1 66.7% 1 E.SLTEELAYLK.K 4.4570312 * cheesemanbim1-05.0306.0306.2 2.805 0.0803 1273.78 7837.2 23 66.7% 1 K.KNHEEEMKDL.R 4.8945312 * cheesemanbim1-03.3119.3119.3 4.7336 0.4121 2875.14 7951.9 1 31.7% 1 R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S 4.142578 * cheesemanbim1-04.3224.3224.2 2.958 0.3294 1858.28 6110.6 1 59.4% 1 E.MNAAPGVDLTQLLNNMR.S 6.5625 * cheesemanbim1-04.3108.3108.2 3.1608 0.324 1616.72 4480.8 1 57.1% 2 N.AAPGVDLTQLLNNMR.S 6.5625 * cheesemanbim1-03.0716.0716.2 3.6701 0.2654 1365.76 8913.2 1 85.0% 1 R.SQYEQLAEQNR.K 4.4570312 * cheesemanbim1-03.1137.1137.1 2.6856 0.3025 1111.51 4339.0 1 68.8% 2 K.DAEAWFNEK.S 4.142578 * cheesemanbim1-03.1077.1077.2 4.0118 0.3839 1834.81 9652.0 1 60.0% 6 K.SKELTTEIDNNIEQIS.S 3.9648438 * cheesemanbim1-04.2356.2356.2 4.8596 0.4016 2083.84 10642.0 1 61.8% 4 K.SKELTTEIDNNIEQISSY.K 3.9648438 * cheesemanbim1-04.2288.2288.2 5.3329 0.4359 2213.81 8221.9 1 63.9% 5 K.SKELTTEIDNNIEQISSYK.S 4.4023438 * cheesemanbim1-04.2127.2127.3 5.1816 0.2624 2214.39 5705.2 1 43.1% 1 K.SKELTTEIDNNIEQISSYK.S 4.4023438 * cheesemanbim1-03.1292.1292.2 4.3116 0.4575 1999.34 7165.2 1 68.8% 3 K.ELTTEIDNNIEQISSYK.S 3.9648438 * cheesemanbim1-04.3050.3050.3 4.5048 0.3072 1798.71 9058.4 1 55.0% 1 R.NVQALEIELQSQLALK.Q 4.4570312 * cheesemanbim1-03.1019.1019.2 4.139 0.4425 1394.37 6139.6 1 79.2% 3 K.QSLEASLAETEGR.Y 4.142578 * cheesemanbim1-03.0574.0574.2 2.6336 0.3233 1100.23 6587.3 1 87.5% 1 S.LAETEGRYC.V 4.4570312 * cheesemanbim1-06.3136.3136.2 6.0758 0.5109 2747.72 7997.9 1 61.4% 1 R.YCVQLSQIQAQISALEEQLQQIR.A 4.4570312 * cheesemanbim1-06.3134.3134.3 5.9354 0.485 2748.83 4909.0 1 38.6% 1 R.YCVQLSQIQAQISALEEQLQQIR.A 4.4570312 * cheesemanbim1-04.3133.3133.2 4.5787 0.3845 1997.49 8484.8 1 65.6% 1 S.QIQAQISALEEQLQQIR.A 4.4570312 * cheesemanbim1-04.1059.1059.2 3.9335 0.1359 1228.51 8453.8 1 88.9% 1 S.ALEEQLQQIR.A 4.4570312 * cheesemanbim1-03.0774.0774.2 3.3755 0.1379 1168.03 6607.9 1 93.8% 2 R.LENEIQTYR.S 4.4570312 * cheesemanbim1-04.0777.0777.2 4.743 0.4878 1420.65 9166.0 1 78.6% 1 Y.RSLLEGEGSSGGGGR.G 6.5625 * cheesemanbim1-04.1053.1053.2 4.6163 0.4468 1825.83 9200.0 1 68.4% 5 Y.RSLLEGEGSSGGGGRGGGSF.G 6.5625 * cheesemanbim1-04.1208.1208.2 4.9972 0.5083 2158.8 7266.3 1 60.9% 1 Y.RSLLEGEGSSGGGGRGGGSFGGGY.G 6.5625 * cheesemanbim1-01.1763.1763.2 3.497 0.3862 1469.36 7285.7 1 59.4% 2 L.LEGEGSSGGGGRGGGSF.G 4.4570312 KERATIN13 27 37 40.7% 643 65494 6.6 U no description * cheesemanbim1-02.2680.2680.2 4.8913 0.1676 2123.48 8549.2 1 50.0% 1 Y.GGGGFGGGGFGGGGFGGGGIGGGGFGGF.G 6.125 * cheesemanbim1-04.2558.2558.2 4.339 0.3931 1968.18 4609.3 1 56.2% 3 N.QSLLQPLNVEIDPEIQK.V 4.142578 * cheesemanbim1-05.2423.2423.2 2.8004 0.3482 1640.71 7654.4 1 53.8% 1 K.SLNNQFASFIDKVR.F 9.078125 cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 Q.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 * cheesemanbim1-04.2125.2125.2 2.8349 0.3577 1384.26 5391.8 2 60.0% 1 R.THNLEPYFESF.I 4.4570312 * cheesemanbim1-05.2557.2557.2 2.6691 0.2529 1611.59 6518.4 1 66.7% 1 R.THNLEPYFESFIN.N 4.4570312 * cheesemanbim1-06.1403.1403.2 3.9338 0.2165 1465.83 6876.9 1 75.0% 1 Y.RNKYEDEINKR.T 8.640625 * cheesemanbim1-06.1408.1408.3 3.9178 0.2961 1468.08 9201.5 1 65.0% 1 Y.RNKYEDEINKR.T 8.640625 * cheesemanbim1-04.1039.1039.2 3.4696 0.3053 1267.75 6744.0 1 75.0% 4 R.TNAENEFVTIK.K 4.4570312 * cheesemanbim1-04.0893.0893.2 3.223 0.3275 1394.82 7704.6 1 59.1% 1 R.TNAENEFVTIKK.D 6.5625 * cheesemanbim1-04.2776.2776.2 3.4364 0.1207 1548.43 8533.7 3 62.5% 1 Q.AKLDNLQQEIDFL.T 4.142578 * cheesemanbim1-02.2371.2371.2 2.5341 0.1044 1348.19 7035.5 1 75.0% 1 K.LDNLQQEIDFL.T 3.4726562 * cheesemanbim1-02.2549.2549.2 2.9953 0.1508 1449.13 8864.1 1 68.2% 2 K.LDNLQQEIDFLT.A 3.4726562 * cheesemanbim1-02.2840.2840.2 3.5206 0.1804 1520.49 8498.8 1 70.8% 2 K.LDNLQQEIDFLTA.L 3.4726562 * cheesemanbim1-02.3656.3656.2 3.7894 0.271 2325.87 8841.4 1 47.4% 1 K.LDNLQQEIDFLTALYQAELS.Q 3.3359375 * cheesemanbim1-02.3869.3869.2 3.9396 0.219 2583.7 6954.5 1 42.9% 1 K.LDNLQQEIDFLTALYQAELSQM.Q 3.3359375 * cheesemanbim1-06.1715.1715.3 4.8261 0.5044 2502.72 7206.8 1 40.5% 1 K.SKAEAESLYQSKYEELQITAGR.H 4.8945312 * cheesemanbim1-03.0651.0651.1 1.9706 0.1688 1125.45 6890.2 1 66.7% 1 K.AEAESLYQSK.Y 4.4570312 * cheesemanbim1-03.0646.0646.2 3.2208 0.2927 1126.97 5859.1 1 88.9% 1 K.AEAESLYQSK.Y 4.4570312 * cheesemanbim1-05.0940.0940.2 3.7151 0.3368 1847.86 7446.0 1 70.0% 2 K.KQISNLQQSISDAEQR.G 6.5625 * cheesemanbim1-05.1292.1292.2 3.3206 0.1749 1529.57 6948.3 1 66.7% 2 A.KNKLNDLEDALQQ.A 4.716797 * cheesemanbim1-05.2227.2227.2 2.8305 0.1864 1277.92 10146.4 1 75.0% 1 K.LALDLEIATYR.T 4.4570312 * cheesemanbim1-03.0435.0435.2 2.7653 0.2346 1038.34 4266.0 1 81.2% 1 L.LEGEESRMS.G 4.142578 * cheesemanbim1-04.0632.0632.2 5.8549 0.2687 2384.05 7966.7 1 46.7% 1 R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G 8.640625 * cheesemanbim1-05.0743.0743.3 3.5705 0.2612 3314.15 9691.6 6 16.4% 1 R.GSYGSGGGSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYR.G 8.5859375 ORFP:YGL123W 6 12 39.8% 254 27450 10.4 U RPS2, Chr VII from 277618-278382 * cheesemanbim1-04.2946.2946.2 3.0175 0.2418 1216.53 6693.6 1 88.9% 1 K.ITTIEEIFLH.S 4.4570312 * cheesemanbim1-05.3199.3199.2 4.7805 0.4365 1743.58 8089.4 1 71.4% 4 K.ITTIEEIFLHSLPVK.E 5.6328125 * cheesemanbim1-04.3608.3608.3 3.7475 0.2472 2770.15 5458.0 1 35.9% 1 K.EFQIIDTLLPGLQDEVMNIKPVQK.Q 4.4023438 * cheesemanbim1-06.1703.1703.2 3.9051 0.464 1731.73 4946.6 1 66.7% 1 R.GYWGTNLGQPHSLATK.T 8.8046875 * cheesemanbim1-04.1913.1913.2 4.0175 0.4176 1836.8 8447.0 1 59.4% 4 K.LLQLAGVEDVYTQSNGK.T 4.4570312 * cheesemanbim1-04.3580.3580.3 4.1431 0.4305 3189.3 7580.1 1 25.0% 1 Y.GFLTPNLWAEQPLPVSPLDIYSDEASAQK.K 3.9648438 NRL_1MCOH 19 50 38.3% 428 46852 8.9 U owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain H... * cheesemanbim1-05.1247.1247.1 2.2888 0.275 1186.51 5266.4 1 68.2% 1 K.GPSVFPLAPSSK.S 9.078125 * cheesemanbim1-05.1225.1225.2 3.0202 0.2117 1187.24 4204.7 1 77.3% 2 K.GPSVFPLAPSSK.S 9.078125 * cheesemanbim1-04.1075.1075.2 2.7569 0.3131 1322.67 7668.7 1 65.4% 1 K.STSGGTAALGCLVK.D 8.2578125 * cheesemanbim1-04.3716.3716.3 4.1782 0.4115 3728.02 9114.2 1 23.5% 2 K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSL.S 5.359375 * cheesemanbim1-04.3656.3656.3 3.6821 0.346 3814.7 9538.2 1 24.3% 1 K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS.S 5.359375 * cheesemanbim1-04.1516.1516.3 3.8976 0.2981 2141.58 7149.2 1 36.1% 1 R.TPEVTCVVVDVSHEDPQVK.F 4.4023438 * cheesemanbim1-05.1407.1407.2 4.9143 0.298 2141.78 6235.4 1 61.1% 4 R.TPEVTCVVVDVSHEDPQVK.F 4.4023438 * cheesemanbim1-03.2171.2171.2 3.637 0.4084 2400.73 8067.7 1 47.5% 4 R.TPEVTCVVVDVSHEDPQVKFN.W 4.4023438 * cheesemanbim1-05.1469.1469.2 3.8762 0.3661 1678.62 7447.9 1 69.2% 3 K.FNWYVDGVQVHNAK.T 7.328125 * cheesemanbim1-03.1208.1208.2 2.979 0.3073 1104.39 5083.8 1 93.8% 1 N.WYVDGVQVH.N 5.359375 * cheesemanbim1-06.2546.2546.2 5.1498 0.449 1810.91 8000.4 1 63.3% 6 R.VVSVLTVLHQNWLDGK.E 7.328125 * cheesemanbim1-06.2497.2497.2 3.5487 0.3975 2230.43 9835.3 1 50.0% 1 R.VVSVLTVLHQNWLDGKEYK.C 7.2460938 * cheesemanbim1-05.1056.1056.2 3.2693 0.3025 1311.54 8033.3 1 75.0% 1 L.TVLHQNWLDGK.E 7.328125 * cheesemanbim1-03.2187.2187.3 4.0935 0.2951 3816.47 8868.5 1 17.2% 4 T.KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK.T 4.8945312 * cheesemanbim1-03.2167.2167.3 3.5879 0.2258 2546.64 6975.4 1 32.1% 1 K.GFYPSDIAVEWESNGQPENNYK.T 3.9648438 * cheesemanbim1-03.2168.2168.2 5.1381 0.4685 2548.41 9555.7 1 50.0% 14 K.GFYPSDIAVEWESNGQPENNYK.T 3.9648438 * cheesemanbim1-03.1122.1122.2 3.5099 0.4487 1993.75 5209.2 1 59.4% 1 S.DIAVEWESNGQPENNYK.T 3.9648438 * cheesemanbim1-04.2262.2262.2 3.1474 0.3226 2313.57 5675.5 1 37.5% 1 N.GQPENNYKTTPPVLDSDGSFF.L 4.142578 * cheesemanbim1-03.2180.2180.2 2.5556 0.3023 1674.48 8972.6 1 50.0% 1 T.PPVLDSDGSFFLYSK.L 4.4570312 gi|67568|pir||ELPG 26 36 35.7% 266 28821 8.1 U pancreatic elastase (EC 3.4.21.36) I precursor - pig * cheesemanbim1-06.1793.1793.2 3.2094 0.3826 2377.28 9628.0 1 40.0% 2 R.VVGGTEAQRNSWPSQISLQYR.S 9.078125 * cheesemanbim1-06.1789.1789.3 4.2319 0.4265 2377.32 4913.1 1 38.8% 3 R.VVGGTEAQRNSWPSQISLQYR.S 9.078125 * cheesemanbim1-04.1100.1100.2 2.6738 0.0807 1474.84 3695.6 5 58.3% 1 G.GTEAQRNSWPSQI.S 6.5625 * cheesemanbim1-05.1327.1327.2 4.3049 0.5256 2121.99 9013.0 1 58.8% 1 G.GTEAQRNSWPSQISLQYR.S 9.078125 * cheesemanbim1-06.1820.1820.2 2.9267 0.2701 1479.43 3810.2 1 72.7% 1 R.NSWPSQISLQYR.S 9.078125 * cheesemanbim1-03.0404.0404.2 3.09 0.2 1271.48 7553.4 1 80.0% 1 G.EHNLNQNDGTE.Q 4.142578 * cheesemanbim1-03.0391.0391.2 3.9393 0.3555 1399.43 7571.6 1 81.8% 2 G.EHNLNQNDGTEQ.Y 4.142578 * cheesemanbim1-03.0602.0602.2 3.8754 0.3905 1562.47 11290.8 1 62.5% 3 G.EHNLNQNDGTEQY.V 4.142578 * cheesemanbim1-03.0757.0757.2 4.4637 0.4336 1808.56 9400.4 1 60.0% 2 H.NLNQNDGTEQYVGVQK.I 4.4570312 * cheesemanbim1-03.0650.0650.2 3.0328 0.1175 1224.51 8305.3 1 75.0% 1 N.DGTEQYVGVQK.I 4.4570312 * cheesemanbim1-06.1532.1532.2 2.83 0.2462 1083.54 5985.8 1 87.5% 1 G.VQKIVVHPY.W 8.8046875 * cheesemanbim1-06.1759.1759.2 3.1734 0.3885 1269.53 6254.0 1 88.9% 1 G.VQKIVVHPYW.N 8.8046875 * cheesemanbim1-06.1771.1771.2 3.0969 0.3571 1884.73 8812.9 1 50.0% 1 G.VQKIVVHPYWNTDDVA.A 5.6328125 * cheesemanbim1-04.1932.1932.2 2.9021 0.3349 1823.7 8121.3 1 46.7% 1 K.IVVHPYWNTDDVAAGY.D 4.4570312 * cheesemanbim1-04.2401.2401.2 2.6976 0.3397 2119.6 7753.9 1 38.9% 1 K.IVVHPYWNTDDVAAGYDIA.L 4.142578 * cheesemanbim1-04.3322.3322.2 2.5464 0.2538 2345.78 7359.3 1 35.0% 1 K.IVVHPYWNTDDVAAGYDIALL.R 4.142578 * cheesemanbim1-05.2864.2864.2 5.4861 0.5061 2503.95 9806.8 1 54.8% 2 K.IVVHPYWNTDDVAAGYDIALLR.L 4.716797 * cheesemanbim1-03.2431.2431.2 3.304 0.3579 1793.67 6376.2 1 80.0% 1 Y.WNTDDVAAGYDIALLR.L 4.142578 * cheesemanbim1-05.2525.2525.2 4.8553 0.5195 1959.92 6459.4 1 64.7% 2 R.LAQSVTLNSYVQLGVLPR.A 9.078125 * cheesemanbim1-05.2255.2255.2 3.2765 0.3867 1559.63 9714.7 1 57.7% 1 S.VTLNSYVQLGVLPR.A 9.078125 * cheesemanbim1-05.1615.1615.2 3.3328 0.2438 1359.78 8607.1 1 72.7% 2 T.LNSYVQLGVLPR.A 9.078125 * cheesemanbim1-05.1658.1658.2 3.4291 0.3472 1488.86 7209.3 1 61.5% 1 T.LNSYVQLGVLPRAG.T 9.078125 * cheesemanbim1-04.1443.1443.2 3.1642 0.2511 1248.2 8686.4 1 85.0% 1 L.NSYVQLGVLPR.A 9.078125 * cheesemanbim1-04.1441.1441.2 3.3127 0.4058 1133.33 8010.5 1 88.9% 1 N.SYVQLGVLPR.A 9.078125 * cheesemanbim1-05.1037.1037.2 2.5758 0.2353 883.07 3859.9 1 92.9% 1 Y.VQLGVLPR.A 10.0625 * cheesemanbim1-02.2924.2924.2 3.1043 0.3309 1537.3 9252.5 1 65.4% 1 R.VSAYISWINNVIAS.N 6.125 KERATIN22 22 27 34.6% 645 65865 8.0 U no description * cheesemanbim1-05.2298.2298.3 4.8766 0.4717 2835.49 11477.5 1 29.3% 2 R.GGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F 10.0625 * cheesemanbim1-06.1954.1954.2 3.4586 0.2101 2399.85 8721.8 1 44.8% 1 G.GSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F 10.0625 * cheesemanbim1-05.1256.1256.2 2.6214 0.3494 1274.34 6192.3 1 64.3% 1 F.SGGGFGGGGFGGGRF.G 10.0625 * cheesemanbim1-06.1631.1631.2 3.748 0.4565 1386.15 6208.6 1 80.0% 1 L.GGPGGFGPGGYPGGIH.E 7.328125 cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 K.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 * cheesemanbim1-05.2285.2285.2 2.8001 0.0909 1986.04 9182.4 2 43.8% 1 L.QQMNVGTRPINLEPIFQ.G 6.5625 * cheesemanbim1-05.2025.2025.2 3.6663 0.3228 1598.86 4549.0 1 69.2% 3 M.NVGTRPINLEPIFQ.G 6.5625 * cheesemanbim1-03.1874.1874.2 5.0374 0.5244 2129.63 9533.2 1 61.8% 2 R.TSQNSELNNMQDLVEDYK.K 3.9648438 * cheesemanbim1-04.1762.1762.2 3.8306 0.3918 2256.38 9689.2 1 55.6% 1 R.TSQNSELNNMQDLVEDYKK.K 4.4023438 * cheesemanbim1-03.0979.0979.2 2.8226 0.34 1209.91 4773.9 1 80.0% 1 R.TAAENDFVTLK.K 4.4570312 * cheesemanbim1-05.2782.2782.3 3.7836 0.2914 3049.23 7238.3 1 26.9% 1 K.VLYDAEISQIHQSVTDTNVILSMDNSR.N 4.4023438 cheesemanbim1-03.0674.0674.2 3.0591 0.2911 1108.62 4559.1 1 87.5% 1 K.AQYEEIAQR.S 4.4570312 cheesemanbim1-03.0516.0516.2 2.8152 0.1683 911.71 3927.1 1 91.7% 1 Q.YEEIAQR.S 4.4570312 * cheesemanbim1-03.0918.0918.2 3.8812 0.4121 1330.47 5990.2 1 81.8% 1 K.NVQDAIADAEQR.G 4.142578 * cheesemanbim1-04.1968.1968.2 2.6832 0.1397 1614.75 8600.7 1 69.2% 1 R.NKLNDLEEALQQAK.E 4.716797 * cheesemanbim1-03.1308.1308.2 4.2503 0.2454 1373.37 8249.8 1 77.3% 1 K.LNDLEEALQQAK.E 4.142578 * cheesemanbim1-04.1411.1411.2 2.6217 0.1463 1030.01 4853.0 5 75.0% 1 Q.AKEDLARLL.R 6.5625 cheesemanbim1-03.1051.1051.2 3.175 0.2338 1141.92 7848.7 1 81.2% 1 R.DYQELMNVK.L 4.4570312 cheesemanbim1-04.1900.1900.2 3.8389 0.3636 1265.35 6533.2 1 90.0% 1 K.LALDVEIATYR.K 4.4570312 * cheesemanbim1-04.0465.0465.2 4.0751 0.51 1742.84 6306.4 1 52.3% 1 R.GGSGGGGSISGGGYGSGGGSGGR.Y 9.078125 KERATIN02 17 23 33.8% 622 61987 5.2 U no description * cheesemanbim1-04.0598.0598.2 3.3509 0.4026 1233.4 6335.9 1 80.0% 1 T.SGGGGGGGLGSGGSIR.S 10.0625 * cheesemanbim1-04.0469.0469.2 2.5282 0.3214 1236.42 8489.7 1 58.3% 1 R.FSSSSGYGGGSSR.V 9.078125 * cheesemanbim1-04.1982.1982.3 4.4652 0.4451 2706.44 10810.3 1 25.0% 1 R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G 8.8046875 * cheesemanbim1-04.1357.1357.2 3.6205 0.5037 2023.77 8308.2 1 41.3% 1 Y.SYGGGSGGGFSASSLGGGFGGGSR.G 9.078125 * cheesemanbim1-04.1228.1228.2 3.3855 0.5063 1773.36 8931.6 1 52.4% 1 Y.GGGSGGGFSASSLGGGFGGGSR.G 10.0625 * cheesemanbim1-06.1992.1992.2 4.122 0.3601 2378.14 10121.0 1 50.0% 1 R.LASYLDKVQALEEANNDLENK.I 4.251953 * cheesemanbim1-04.2122.2122.3 5.7107 0.3639 2379.76 9421.5 1 47.5% 3 R.LASYLDKVQALEEANNDLENK.I 4.251953 * cheesemanbim1-03.1274.1274.2 3.0269 0.2911 1607.08 5316.6 1 75.0% 1 K.NYSPYYNTIDDLK.D 4.4570312 * cheesemanbim1-05.3232.3232.3 4.5689 0.4023 2903.76 3616.8 1 34.4% 1 K.NYSPYYNTIDDLKDQIVDLTVGNNK.T 4.4023438 * cheesemanbim1-04.3457.3457.2 4.3208 0.3375 2538.9 9608.9 1 52.4% 1 S.PYYNTIDDLKDQIVDLTVGNNK.T 4.4023438 * cheesemanbim1-04.3086.3086.2 5.2315 0.5241 2278.76 10069.3 1 60.5% 1 Y.YNTIDDLKDQIVDLTVGNNK.T 4.4023438 * cheesemanbim1-03.0829.0829.2 2.7596 0.1383 1160.22 4545.1 1 75.0% 1 R.QGVDADINGLR.Q 4.4570312 * cheesemanbim1-03.2828.2828.2 3.8649 0.4076 2351.39 10339.5 1 42.1% 1 K.DIENQYETQITQIEHEVSSS.G 3.8554688 * cheesemanbim1-04.3010.3010.3 5.1462 0.4986 3267.61 8154.3 1 31.2% 5 K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E 4.1152344 * cheesemanbim1-03.1651.1651.2 2.603 0.2575 2197.36 8753.6 1 44.4% 1 K.EIETYHNLLEGGQEDFESS.G 3.8007812 * cheesemanbim1-03.0686.0686.2 4.2011 0.4229 1511.41 6909.9 1 75.0% 1 L.LEGGQEDFESSGAGK.I 3.9648438 * cheesemanbim1-04.0750.0750.3 6.8309 0.5668 3224.89 11352.2 1 28.2% 1 R.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S 4.716797 ORFP:YNL209W 16 23 30.0% 613 66595 5.5 U SSB2, Chr XIV from 252058-253899 cheesemanbim1-03.2425.2425.2 5.2259 0.4698 2161.59 5331.5 1 66.7% 3 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemanbim1-03.2445.2445.3 5.1181 0.3344 2161.91 8832.9 1 41.7% 2 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemanbim1-04.2665.2665.2 3.3343 0.3526 1552.49 6286.2 1 69.2% 1 K.TFSPQEISAMVLTK.M 6.5625 cheesemanbim1-03.0810.0810.2 3.1002 0.2828 1064.35 4854.7 1 88.9% 1 K.TGLDISDDAR.A 4.142578 cheesemanbim1-03.1115.1115.2 4.0443 0.1812 1460.54 7142.3 1 80.8% 1 K.SQIDEVVLVGGSTR.I 4.4570312 cheesemanbim1-04.2107.2107.1 1.8552 0.2111 1041.47 6695.7 1 68.8% 1 K.LLSDFFDGK.Q 4.4570312 cheesemanbim1-03.0769.0769.2 2.8703 0.3302 1705.9 9456.7 1 59.4% 1 A.AVQGAILTGQSTSDETK.D 4.4570312 cheesemanbim1-02.3008.3008.2 3.0477 0.2673 1311.48 4342.1 2 77.3% 1 E.TKDLLLLDVAPL.S 4.4570312 * cheesemanbim1-04.1712.1712.2 3.8778 0.4477 2418.75 7457.4 1 57.5% 2 R.TFTTVSDNQTTVQFPVYQGER.V 4.4570312 * cheesemanbim1-03.1089.1089.2 2.5118 0.1502 1869.39 8760.6 1 50.0% 1 V.SDNQTTVQFPVYQGER.V 4.4570312 cheesemanbim1-04.3950.3950.2 3.9583 0.4213 2669.86 4206.0 1 50.0% 2 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemanbim1-04.3880.3880.3 4.0593 0.2241 2672.45 9631.9 1 31.2% 1 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemanbim1-05.2916.2916.2 2.7994 0.1968 2451.91 5908.2 6 33.3% 1 R.QRLESYVASIEQTVTDPVLSSK.L 4.716797 cheesemanbim1-03.2651.2651.2 3.5882 0.5068 2167.93 7707.6 1 55.3% 2 R.LESYVASIEQTVTDPVLSSK.L 4.142578 cheesemanbim1-03.1043.1043.2 3.1968 0.379 1504.96 5515.2 1 65.4% 1 A.SIEQTVTDPVLSSK.L 4.4570312 cheesemanbim1-04.3381.3381.2 4.7616 0.3689 2411.78 10173.1 1 45.5% 2 K.IEAALSDALAALQIEDPSADELR.K 3.8007812 ORFP:YDL229W 15 21 29.2% 613 66602 5.4 U SSB1, Chr IV from 44066-45907 cheesemanbim1-03.2425.2425.2 5.2259 0.4698 2161.59 5331.5 1 66.7% 3 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemanbim1-03.2445.2445.3 5.1181 0.3344 2161.91 8832.9 1 41.7% 2 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemanbim1-04.2665.2665.2 3.3343 0.3526 1552.49 6286.2 1 69.2% 1 K.TFSPQEISAMVLTK.M 6.5625 cheesemanbim1-03.0810.0810.2 3.1002 0.2828 1064.35 4854.7 1 88.9% 1 K.TGLDISDDAR.A 4.142578 cheesemanbim1-03.1115.1115.2 4.0443 0.1812 1460.54 7142.3 1 80.8% 1 K.SQIDEVVLVGGSTR.I 4.4570312 cheesemanbim1-04.2107.2107.1 1.8552 0.2111 1041.47 6695.7 1 68.8% 1 K.LLSDFFDGK.Q 4.4570312 cheesemanbim1-03.0769.0769.2 2.8703 0.3302 1705.9 9456.7 1 59.4% 1 A.AVQGAILTGQSTSDETK.D 4.4570312 cheesemanbim1-02.3008.3008.2 3.0477 0.2673 1311.48 4342.1 2 77.3% 1 E.TKDLLLLDVAPL.S 4.4570312 * cheesemanbim1-03.1098.1098.2 3.2538 0.313 1853.83 7357.8 1 60.0% 1 C.ADNQTTVQFPVYQGER.V 4.4570312 cheesemanbim1-04.3950.3950.2 3.9583 0.4213 2669.86 4206.0 1 50.0% 2 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemanbim1-04.3880.3880.3 4.0593 0.2241 2672.45 9631.9 1 31.2% 1 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemanbim1-05.2916.2916.2 2.7994 0.1968 2451.91 5908.2 6 33.3% 1 R.QRLESYVASIEQTVTDPVLSSK.L 4.716797 cheesemanbim1-03.2651.2651.2 3.5882 0.5068 2167.93 7707.6 1 55.3% 2 R.LESYVASIEQTVTDPVLSSK.L 4.142578 cheesemanbim1-03.1043.1043.2 3.1968 0.379 1504.96 5515.2 1 65.4% 1 A.SIEQTVTDPVLSSK.L 4.4570312 cheesemanbim1-04.3381.3381.2 4.7616 0.3689 2411.78 10173.1 1 45.5% 2 K.IEAALSDALAALQIEDPSADELR.K 3.8007812 ORFP:YLL024C 16 21 27.4% 639 69470 5.1 U SSA2, Chr XII from 95565-97484, reverse complement * cheesemanbim1-04.1139.1139.2 3.0218 0.132 1594.72 5230.0 1 67.9% 2 K.NQAAMNPANTVFDAK.R 6.5625 * cheesemanbim1-03.0803.0803.2 3.0443 0.1777 1394.44 5765.3 4 72.7% 1 R.NFNDPEVQGDMK.H 4.142578 cheesemanbim1-04.2704.2704.2 2.6607 0.1184 1553.51 5501.3 2 65.4% 1 K.NFTPEQISSMVLGK.M 6.5625 cheesemanbim1-03.1363.1363.2 2.6069 0.1475 1896.89 3899.4 3 53.1% 1 K.VNDAVVTVPAYFNDSQR.Q 4.4570312 cheesemanbim1-04.1895.1895.2 3.9912 0.4102 1660.11 5709.2 1 70.0% 1 R.IINEPTAAAIAYGLDK.K 4.4570312 cheesemanbim1-04.0793.0793.2 3.3375 0.4543 1676.57 6248.8 1 73.3% 1 K.ATAGDTHLGGEDFDNR.L 4.4023438 cheesemanbim1-06.1733.1733.2 3.6933 0.3527 1275.65 7269.6 1 83.3% 1 R.LVNHFIQEFK.R 7.328125 cheesemanbim1-03.2976.2976.2 6.0382 0.5977 2580.88 7849.2 1 52.0% 3 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemanbim1-03.0843.0843.2 2.7119 0.1628 1390.42 8228.0 1 61.5% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemanbim1-03.0484.0484.2 2.7557 0.3416 1179.22 6030.1 1 85.0% 1 A.ILTGDESSKTQ.D 4.4570312 cheesemanbim1-02.3008.3008.2 3.0477 0.2673 1311.48 4342.1 2 77.3% 1 K.TQDLLLLDVAPL.S 3.5546875 cheesemanbim1-04.3736.3736.2 5.8004 0.5353 2556.14 4891.3 1 52.1% 3 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemanbim1-04.3738.3738.3 3.993 0.3716 2558.73 8173.7 1 35.4% 1 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemanbim1-03.2282.2282.2 3.5185 0.4524 1761.58 5548.6 1 67.6% 1 L.DVAPLSLGIETAGGVMTK.L 4.4570312 cheesemanbim1-05.2914.2914.3 4.5209 0.3911 2713.83 11798.7 1 37.0% 1 K.KSEVFSTYADNQPGVLIQVFEGER.A 4.4023438 cheesemanbim1-04.2690.2690.2 3.922 0.41 1774.21 6309.7 1 63.3% 1 Y.ADNQPGVLIQVFEGER.A 4.142578 ORFP:YAL005C 15 19 25.5% 642 69768 5.1 U SSA1, Chr I from 139501-141429, reverse complement * cheesemanbim1-03.0851.0851.2 3.2053 0.2226 1408.36 6188.8 1 81.8% 1 R.NFNDPEVQADMK.H 4.142578 cheesemanbim1-04.2704.2704.2 2.6607 0.1184 1553.51 5501.3 2 65.4% 1 K.NFTPEQISSMVLGK.M 6.5625 cheesemanbim1-03.1363.1363.2 2.6069 0.1475 1896.89 3899.4 3 53.1% 1 K.VNDAVVTVPAYFNDSQR.Q 4.4570312 cheesemanbim1-04.1895.1895.2 3.9912 0.4102 1660.11 5709.2 1 70.0% 1 R.IINEPTAAAIAYGLDK.K 4.4570312 cheesemanbim1-04.0793.0793.2 3.3375 0.4543 1676.57 6248.8 1 73.3% 1 K.ATAGDTHLGGEDFDNR.L 4.4023438 cheesemanbim1-06.1733.1733.2 3.6933 0.3527 1275.65 7269.6 1 83.3% 1 R.LVNHFIQEFK.R 7.328125 cheesemanbim1-03.2976.2976.2 6.0382 0.5977 2580.88 7849.2 1 52.0% 3 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemanbim1-03.0843.0843.2 2.7119 0.1628 1390.42 8228.0 1 61.5% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemanbim1-03.0484.0484.2 2.7557 0.3416 1179.22 6030.1 1 85.0% 1 A.ILTGDESSKTQ.D 4.4570312 cheesemanbim1-02.3008.3008.2 3.0477 0.2673 1311.48 4342.1 2 77.3% 1 K.TQDLLLLDVAPL.S 3.5546875 cheesemanbim1-04.3736.3736.2 5.8004 0.5353 2556.14 4891.3 1 52.1% 3 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemanbim1-04.3738.3738.3 3.993 0.3716 2558.73 8173.7 1 35.4% 1 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemanbim1-03.2282.2282.2 3.5185 0.4524 1761.58 5548.6 1 67.6% 1 L.DVAPLSLGIETAGGVMTK.L 4.4570312 cheesemanbim1-04.2690.2690.2 3.922 0.41 1774.21 6309.7 1 63.3% 1 Y.ADNQPGVLIQVFEGER.A 4.142578 * cheesemanbim1-03.1145.1145.2 2.935 0.1412 1360.4 6121.0 2 68.2% 1 K.ELQDIANPIMSK.L 4.4570312 ORFP:YDR450W 3 4 21.2% 146 17038 10.3 U RPS18A, Chr IV from 1359912-1359958,1360394-1360787 ORFP:YML026C 3 4 21.2% 146 17038 10.3 U RPS18B, Chr XIII from 222987-223033,223435-223828, reverse complement cheesemanbim1-03.0783.0783.2 3.2998 0.2667 1275.44 7466.2 1 75.0% 1 R.AGELTQEELER.I 3.9648438 cheesemanbim1-06.1617.1617.2 4.1053 0.3894 1475.72 9156.6 1 77.3% 2 R.IVQIMQNPTHYK.I 8.8046875 cheesemanbim1-06.2042.2042.2 2.5162 0.3586 1018.04 4200.5 1 92.9% 1 K.IPAWFLNR.Q 10.0625 NRL_1MCOL 4 6 20.4% 216 22815 6.3 U owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain L... * cheesemanbim1-04.2272.2272.2 2.6511 0.311 1555.33 4254.2 1 57.7% 1 L.ISDFYPGAVTVAWK.A 6.5625 * cheesemanbim1-05.2121.2121.2 3.9159 0.3591 1746.24 7604.5 1 57.1% 3 K.YAASSYLSLTPEQWK.S 6.5625 * cheesemanbim1-04.1861.1861.2 2.5121 0.1369 1353.29 5480.7 1 70.0% 1 S.SYLSLTPEQWK.S 6.5625 * cheesemanbim1-04.0395.0395.2 3.7889 0.505 1712.53 6123.0 1 67.9% 1 R.SYSCQVTHEGSTVEK.T 5.6328125 gi|135017|sp|P07518|SUBT_BACPU 4 5 18.5% 275 27656 6.8 U SUBTILISIN (ALKALINE MESENTERICOPEPTIDASE) * cheesemanbim1-05.0867.0867.1 2.0685 0.133 742.59 2191.4 1 75.0% 1 S.QIKAPAL.H 9.078125 * cheesemanbim1-03.0960.0960.2 3.9611 0.3294 1357.39 5325.1 1 79.2% 1 A.VIDSGIDSSHPDL.N 4.142578 * cheesemanbim1-04.3503.3503.2 2.6732 0.1493 2261.63 7053.6 3 32.6% 1 A.GTIAALNNSIGVLGVAPSSALYAV.K 6.125 * cheesemanbim1-01.3738.3738.1 2.3607 0.1568 838.39 5043.6 27 75.0% 2 N.NMDVINM.S 3.7460938 ORFP:YLR075W 3 5 18.1% 221 25361 10.0 U RPL10, Chr XII from 282928-283593 * cheesemanbim1-05.3720.3720.3 5.4259 0.4579 3230.95 7669.2 1 32.1% 2 K.ATVDEFPLCVHLVSNELEQLSSEALEAAR.I 4.1152344 * cheesemanbim1-04.3169.3169.2 3.7253 0.3212 1959.98 9222.9 1 55.9% 2 H.LVSNELEQLSSEALEAAR.I 3.9648438 * cheesemanbim1-04.3066.3066.2 4.1008 0.4152 1247.93 8375.7 1 85.0% 1 R.VDIGQIIFSVR.T 6.5625 KERATIN05 7 7 17.4% 471 51531 5.2 U no description cheesemanbim1-04.0973.0973.2 3.0783 0.1829 1067.2 6077.9 1 87.5% 1 Q.NLNDRLASY.L 6.5625 cheesemanbim1-05.0872.0872.2 2.7187 0.238 1065.39 7613.5 1 87.5% 1 R.LASYLDKVR.A 8.8046875 * cheesemanbim1-04.2445.2445.2 4.8006 0.5039 2055.76 10271.6 1 72.2% 1 K.ILTATVDNANVLLQIDNAR.L 4.4570312 * cheesemanbim1-03.1207.1207.2 4.496 0.5058 2086.76 5705.4 1 50.0% 1 R.GQVGGDVNVEMDAAPGVDLSR.I 3.9648438 * cheesemanbim1-03.1904.1904.2 2.9417 0.2984 1173.48 6406.5 1 81.2% 1 K.DAEEWFFTK.T 4.142578 cheesemanbim1-03.0590.0590.2 3.1223 0.2659 1276.59 5199.3 1 70.0% 1 K.TEELNREVATN.S 4.142578 cheesemanbim1-03.0636.0636.2 3.5629 0.3328 1362.49 8431.3 1 70.8% 1 R.EVATNSELVQSGK.S 4.4570312 ORFP:YNL178W 2 3 14.2% 240 26503 9.4 U RPS3, Chr XIV from 302677-303399 * cheesemanbim1-05.3475.3475.2 4.26 0.4543 1993.65 8456.1 1 75.0% 2 K.LVADGVFYAELNEFFTR.E 4.142578 * cheesemanbim1-03.0815.0815.2 3.4479 0.4349 1905.58 4667.7 1 56.2% 1 K.DYRPAEETEAQAEPVEA.- 3.8007812 ORFP:YJR045C 5 7 13.1% 654 70628 5.6 U SSC1, Chr X from 519330-521294, reverse complement * cheesemanbim1-04.3001.3001.2 5.0956 0.5734 2260.85 7063.7 1 61.4% 2 K.VQGSVIGIDLGTTNSAVAIMEGK.V 4.4570312 * cheesemanbim1-04.1421.1421.2 2.7303 0.2316 1533.2 5655.7 6 50.0% 1 R.QAVVNPENTLFATK.R 6.5625 * cheesemanbim1-04.1971.1971.2 4.2286 0.4219 1681.67 5687.1 1 70.0% 1 R.GQTYSPAQIGGFVLNK.M 8.8046875 * cheesemanbim1-03.2824.2824.2 2.8582 0.2425 2007.52 7827.0 1 50.0% 2 K.DAGLSTSDISEVLLVGGMSR.M 4.142578 * cheesemanbim1-03.0740.0740.2 2.8668 0.2182 1402.34 4676.0 1 79.2% 1 R.VQGGEEVNAEELK.T 3.9648438 gi|89258|pir||A26823 3 3 12.6% 269 28699 8.0 U pancreatic elastase II (EC 3.4.21.71) precursor - pig * cheesemanbim1-04.2618.2618.2 2.9718 0.38 2127.23 5920.6 1 44.4% 1 R.VVGGEDARPNSWPWQVSLQ.Y 4.4570312 * cheesemanbim1-02.3094.3094.2 2.6008 0.1609 1494.49 7799.1 1 62.5% 1 R.VSNYIDWINSVIA.N 3.7460938 * cheesemanbim1-02.3081.3081.2 2.5992 0.1804 1724.3 4900.9 1 53.6% 1 R.VSNYIDWINSVIANN.- 3.7460938 KERATIN17 8 11 11.0% 590 62461 8.1 U no description cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 K.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-04.3317.3317.2 4.1551 0.4775 1891.71 4728.3 1 75.0% 3 R.QNLEPLFEQYINNLR.R 4.4570312 * cheesemanbim1-03.0604.0604.2 3.5369 0.2976 1195.42 7240.7 1 94.4% 1 K.YEELQQTAGR.H 4.4570312 cheesemanbim1-03.0452.0452.1 1.9097 0.1545 817.56 6769.0 3 64.3% 1 R.GELALKDA.R 4.4570312 * cheesemanbim1-03.1064.1064.2 3.1725 0.1807 1146.01 7510.4 1 88.9% 1 K.LAELEEALQK.A 4.142578 cheesemanbim1-04.1900.1900.2 3.8389 0.3636 1265.35 6533.2 1 90.0% 1 K.LALDVEIATYR.K 4.4570312 KERATIN18 8 12 10.3% 562 59822 8.0 U no description cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 K.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-04.3317.3317.2 4.1551 0.4775 1891.71 4728.3 1 75.0% 3 R.QNLEPLFEQYINNLR.R 4.4570312 cheesemanbim1-03.2159.2159.2 3.3787 0.2483 1408.4 8098.5 1 81.8% 2 K.ADTLTDEINFLR.A 4.142578 cheesemanbim1-03.0674.0674.2 3.0591 0.2911 1108.62 4559.1 1 87.5% 1 K.AQYEEIAQR.S 4.4570312 cheesemanbim1-03.0516.0516.2 2.8152 0.1683 911.71 3927.1 1 91.7% 1 Q.YEEIAQR.S 4.4570312 cheesemanbim1-04.1900.1900.2 3.8389 0.3636 1265.35 6533.2 1 90.0% 1 K.LALDVEIATYR.K 4.4570312 ORFP:YCL018W 2 2 9.9% 364 38953 5.8 U LEU2, Chr III from 91323-92417 * cheesemanbim1-05.1045.1045.2 3.0869 0.2871 1297.26 7753.6 3 61.5% 1 K.KADAVLLGAVGGPK.W 8.8046875 * cheesemanbim1-03.1152.1152.2 4.8336 0.5107 2136.45 7487.3 1 57.1% 1 R.TGDLGGSNSTTEVGDAVAEEVK.K 3.8554688 KERATIN08 3 3 7.5% 469 50499 5.0 U no description cheesemanbim1-04.0973.0973.2 3.0783 0.1829 1067.2 6077.9 1 87.5% 1 Q.NLNDRLASY.L 6.5625 cheesemanbim1-05.0872.0872.2 2.7187 0.238 1065.39 7613.5 1 87.5% 1 R.LASYLDKVR.A 8.8046875 * cheesemanbim1-03.1114.1114.2 4.179 0.1063 2088.54 5965.0 1 45.0% 1 R.GQTGGDVNVEMDAAPGVDLSR.I 3.9648438 KERATIN15 6 8 7.0% 629 64511 6.5 U no description cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 K.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 * cheesemanbim1-03.2732.2732.1 2.6121 0.1106 1304.6 3618.0 25 50.0% 2 R.SLDLDSIIAEVGA.Q 3.4726562 cheesemanbim1-03.1051.1051.2 3.175 0.2338 1141.92 7848.7 1 81.2% 1 R.DYQELMNVK.L 4.4570312 cheesemanbim1-04.1900.1900.2 3.8389 0.3636 1265.35 6533.2 1 90.0% 1 K.LALDVEIATYR.K 4.4570312 KERATIN20 5 6 6.2% 483 53748 5.4 U no description cheesemanbim1-05.1138.1138.2 2.6918 0.1889 1083.78 8082.3 1 93.8% 2 K.FASFIDKVR.F 9.078125 cheesemanbim1-06.1901.1901.1 1.8237 0.1368 1037.8 3532.5 12 71.4% 1 S.FIDKVRFL.E 9.078125 cheesemanbim1-06.1900.1900.2 2.5102 0.1473 1038.49 4440.9 21 78.6% 1 S.FIDKVRFL.E 9.078125 * cheesemanbim1-03.0452.0452.1 1.9097 0.1545 817.56 6769.0 3 64.3% 1 R.GELAIKDA.N 4.4570312 cheesemanbim1-05.2227.2227.2 2.8305 0.1864 1277.92 10146.4 1 75.0% 1 K.LALDIEIATYR.K 4.4570312 KERATIN07 2 2 5.9% 473 50915 5.5 U no description cheesemanbim1-05.0872.0872.2 2.7187 0.238 1065.39 7613.5 1 87.5% 1 R.LASYLDKVR.A 8.8046875 * cheesemanbim1-04.2158.2158.2 3.3943 0.3913 2064.61 5893.7 1 52.8% 1 K.IIAATIENAQPILQIDNAR.L 4.4570312 GR78_HUMAN 2 2 4.3% 653 72116 5.1 U owl|P11021| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... GR78_RAT 2 2 4.3% 654 72347 5.2 U owl|P06761| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... GR78_MOUSE 2 2 4.3% 655 72421 5.2 U owl|P20029| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... GR78_MESAU 2 2 4.3% 654 72379 5.2 U owl|P07823| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... cheesemanbim1-04.1895.1895.2 3.9912 0.4102 1660.11 5709.2 1 70.0% 1 R.IINEPTAAAIAYGLDK.R 4.4570312 cheesemanbim1-04.1128.1128.2 2.7267 0.1449 1424.51 6727.8 3 59.1% 1 A.YSLKNQIGDKEK.L 8.6953125 KERATIN16 3 3 3.7% 534 57265 6.6 U no description cheesemanbim1-03.0674.0674.2 3.0591 0.2911 1108.62 4559.1 1 87.5% 1 R.AQYEEIAQR.S 4.4570312 cheesemanbim1-03.0516.0516.2 2.8152 0.1683 911.71 3927.1 1 91.7% 1 Q.YEEIAQR.S 4.4570312 cheesemanbim1-05.2227.2227.2 2.8305 0.1864 1277.92 10146.4 1 75.0% 1 K.LALDIEIATYR.K 4.4570312 ORFP:YDR425W 1 13 3.2% 625 70741 7.0 U YDR425W, Chr IV from 1320053-1321930 * cheesemanbim1-03.2115.2115.2 3.3173 0.1423 2250.74 7349.5 8 39.5% 13 F.NWKDVLSSSPIIILPLNNLL.A 6.5625 ORFP:YER033C 2 5 3.1% 1076 119350 4.9 U ZRG8, Chr V from 218056-221286, reverse complement * cheesemanbim1-04.2931.2931.2 2.873 0.0827 1943.09 11503.7 7 41.2% 1 N.RTTDSLPAIKGTITHSWG.D 9.078125 * cheesemanbim1-04.3332.3332.2 2.8803 0.0978 1630.66 2905.9 298 42.9% 4 K.RLENGKETFNGNHGG.H 7.328125 Proteins Peptide IDs Copies Unfiltered 5628 20437 36773 Redundant 37 492 2003 Nonredundant 33 431 1925 Classification Nonredundant Proteins Redundant Proteins Unclassified 0 0