DTASelect v2.0.26 /data/1/catclw/Projects/Jamie/Jamie_June2008/Mito_SPB_orange/splitted/phospho /scratch/yates/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta SEQUEST 3.0 in SQT format. --trypstat --fp 0.1 -p 1 -e con true Use criteria 0.0 Minimum peptide confidence 0.1 Peptide false positive rate 0.0 Minimum protein confidence 1.0 Protein false positive rate 1 Minimum charge state 16 Maximum charge state 0.0 Minimum ion proportion 1000 Maximum Sp rank -1.0 Minimum Sp score Include Modified peptide inclusion Any Tryptic status requirement false Multiple, ambiguous IDs allowed Ignore Peptide validation handling XCorr Purge duplicate peptides by protein false Include only loci with unique peptide true Remove subset proteins Ignore Locus validation handling con Exclude protein names matching 0 Minimum modified peptides per locus 1000 Minimum redundancy for low coverage loci 1 Minimum peptides per locus Locus Sequence Count Spectrum Count Sequence Coverage Length MolWt pI Validation Status Descriptive Name Unique FileName XCorr DeltCN Conf% M+H+ CalcM+H+ TotalIntensity SpR ZScore IonProportion Redundancy Sequence YIL002W-A 20 26 94.2% 69 7729 4.7 U YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" * Jamie_Mitco_SPB_53.18839.18839.3 3.3774 0.0888 93.9 2716.5544 2717.1072 8167.7 24 3.872 26.0 1 -.MTRDTPEDVSTAGAKDILDVLNLLK.G * Jamie_Mitco_SPB_10.03393.03393.1 1.8344 0.2602 100.0 1447.54 1448.5297 5451.1 6 5.694 46.2 1 M.TRDTPEDVSTAGAK.D * Jamie_Mitco_SPB_9.02909.02909.2 4.734 0.3176 100.0 1448.9122 1448.5297 6711.0 1 7.412 80.8 3 M.TRDTPEDVSTAGAK.D * Jamie_Mitco_SPB_53.18867.18867.3 6.8964 0.3885 100.0 2584.0144 2585.9146 8284.3 1 7.805 51.1 1 M.TRDTPEDVSTAGAKDILDVLNLLK.G * Jamie_Mitco_SPB_53.19024.19024.2 4.5899 0.3418 100.0 2585.3523 2585.9146 8774.3 1 7.209 47.8 1 M.TRDTPEDVSTAGAKDILDVLNLLK.G * Jamie_Mitco_SPB_50.17711.17711.3 6.293 0.4772 100.0 3084.4744 3086.4233 10773.4 1 9.325 39.3 1 M.TRDTPEDVSTAGAKDILDVLNLLKGGEEK.I * Jamie_Mitco_SPB_50.17919.17919.4 6.5898 0.3356 100.0 3088.4565 3086.4233 9180.9 1 7.481 31.5 1 M.TRDTPEDVSTAGAKDILDVLNLLKGGEEK.I * Jamie_Mitco_SPB_57.20301.20301.4 7.8173 0.4679 100.0 3887.8965 3885.3582 10766.9 1 7.715 30.0 1 M.TRDTPEDVSTAGAKDILDVLNLLKGGEEKISEVELK.L * Jamie_Mitco_SPB_69.24573.24573.4 5.4715 0.382 100.0 4372.5767 4373.911 6557.5 1 6.018 23.1 1 R.DTPEDVSTAGAKDILDVLNLLKGGEEKISEVELKLDEMEK.K * Jamie_Mitco_SPB_49.17499.17499.2 5.1269 0.3911 100.0 1656.9722 1656.917 9963.2 1 6.754 82.1 1 K.DILDVLNLLKGGEEK.I * Jamie_Mitco_SPB_49.17496.17496.3 2.7839 0.2123 100.0 1659.1444 1656.917 2714.8 11 4.899 46.4 1 K.DILDVLNLLKGGEEK.I * Jamie_Mitco_SPB_62.22127.22127.3 3.8133 0.1711 100.0 3329.6343 3329.8713 8960.0 1 4.628 24.1 1 K.DILDVLNLLKGGEEKISEVELKLDEMEKK.M * Jamie_Mitco_SPB_23.08217.08217.3 4.1368 0.1781 100.0 2064.1743 2064.3125 10036.9 3 4.315 39.7 1 K.GGEEKISEVELKLDEMEK.K * Jamie_Mitco_SPB_22.07858.07858.4 3.9083 0.1577 100.0 2194.8564 2192.4866 9197.0 12 4.062 32.4 2 K.GGEEKISEVELKLDEMEKK.M * Jamie_Mitco_SPB_39.13693.13693.4 4.7309 0.2068 100.0 2637.4565 2639.0054 7973.8 130 5.28 27.3 1 K.GGEEKISEVELKLDEMEKKMDSL.L * Jamie_Mitco_SPB_20.06879.06879.2 4.5714 0.3808 100.0 1563.1122 1563.8036 8036.8 1 6.915 87.5 4 K.ISEVELKLDEMEK.K * Jamie_Mitco_SPB_53.18900.18900.4 4.5124 0.0916 99.6 4017.0566 4013.5679 11190.1 1 3.23 22.7 1 K.ISEVELKLDEMEKKMDSLLVQLEDLHRDNNDLAK.S * Jamie_Mitco_SPB_29.10335.10335.2 4.4132 0.3773 100.0 2467.4321 2468.7876 6546.1 1 7.152 55.0 1 K.KMDSLLVQLEDLHRDNNDLAK.S * Jamie_Mitco_SPB_31.11095.11095.2 3.0844 0.2417 100.0 2340.2122 2340.6135 8685.5 2 4.943 39.5 1 K.MDSLLVQLEDLHRDNNDLAK.S * Jamie_Mitco_SPB_32.11254.11254.3 3.6344 0.2896 100.0 2429.7244 2427.6917 6640.3 1 5.08 41.2 1 K.MDSLLVQLEDLHRDNNDLAKS.S YKL042W 52 60 79.1% 363 42271 7.9 U SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" * Jamie_Mitco_SPB_30.10800.10800.2 2.7715 0.2206 99.7 2529.2722 2528.7546 4155.8 7 4.621 39.5 1 R.LYDDYYNIPYQYSNPTPMNR.D * Jamie_Mitco_SPB_16.05446.05446.3 2.9703 0.1761 100.0 1576.4944 1575.8052 5496.6 3 4.217 41.7 1 R.INADKLVPEEYKR.N * Jamie_Mitco_SPB_15.05195.05195.2 4.1748 0.1848 100.0 1577.1122 1575.8052 4877.8 1 4.228 79.2 1 R.INADKLVPEEYKR.N * Jamie_Mitco_SPB_19.06586.06586.3 3.7637 0.254 100.0 2502.5044 2502.7434 4092.4 47 4.534 30.3 1 R.INADKLVPEEYKRNT*EFINK.A * Jamie_Mitco_SPB_13.04637.04637.2 4.21 0.3314 100.0 1534.2922 1534.7123 4964.9 1 6.549 87.5 1 R.NTEFINKAVQQNK.E * Jamie_Mitco_SPB_12.04323.04323.2 2.4396 0.1549 99.5 1318.0922 1319.5033 7922.3 1 5.124 65.0 1 K.AVQQNKELNFK.L * Jamie_Mitco_SPB_14.05004.05004.2 2.8688 0.2561 100.0 1589.0521 1588.8502 5327.7 2 4.669 58.3 1 K.AVQQNKELNFKLR.E * Jamie_Mitco_SPB_14.04923.04923.2 4.0986 0.1917 100.0 1405.5922 1406.622 3282.5 2 5.451 80.0 1 R.EKQNEIFELKK.I * Jamie_Mitco_SPB_15.05281.05281.1 2.2137 0.1903 100.0 1323.53 1324.5602 5440.0 13 4.651 55.0 1 R.SKLEKYVDITK.K * Jamie_Mitco_SPB_26.09100.09100.2 3.5473 0.2589 100.0 2175.3123 2176.518 7809.4 1 5.328 47.1 1 K.YVDITKKLEDQNLNLQIK.I * Jamie_Mitco_SPB_26.09129.09129.3 3.25 0.1885 100.0 2175.9543 2176.518 6761.4 12 5.023 33.8 1 K.YVDITKKLEDQNLNLQIK.I * Jamie_Mitco_SPB_17.06106.06106.2 2.3149 0.0373 97.4 1329.9122 1328.5083 6351.7 47 2.919 65.0 1 K.LEDQNLNLQIK.I * Jamie_Mitco_SPB_11.03864.03864.1 1.515 0.1446 100.0 1110.25 1111.2401 4177.7 23 3.852 55.6 1 K.KLSDANSTFK.E * Jamie_Mitco_SPB_11.03838.03838.2 2.717 0.0926 99.5 1112.8121 1111.2401 5409.2 259 3.516 55.6 1 K.KLSDANSTFK.E * Jamie_Mitco_SPB_14.04695.04695.2 2.8486 0.2032 100.0 1478.9521 1479.5615 4853.8 3 4.851 72.7 1 K.LSDANST*FKEMR.F * Jamie_Mitco_SPB_24.08423.08423.2 5.214 0.4219 100.0 2080.9722 2080.2275 8297.9 1 6.883 64.7 1 K.VKDPMVDDDPVSENYDQI.N * Jamie_Mitco_SPB_22.07761.07761.3 5.5044 0.3522 100.0 2518.0144 2518.7546 6603.8 1 7.538 44.0 1 K.VKDPMVDDDPVSENYDQINVPK.H * Jamie_Mitco_SPB_23.08225.08225.2 2.1734 0.1783 99.5 2598.612 2598.7546 4635.2 31 4.211 38.1 1 K.VKDPMVDDDPVS*ENYDQINVPK.H * Jamie_Mitco_SPB_17.06093.06093.4 3.9371 0.203 100.0 2811.4565 2812.0833 6511.4 78 4.848 24.6 1 K.VKDPMVDDDPVSENYDQINVPKHR.A * Jamie_Mitco_SPB_18.06316.06316.4 4.3448 0.1694 100.0 2892.0166 2892.0833 6085.9 1 5.036 34.1 1 K.VKDPMVDDDPVS*ENYDQINVPKHR.A * Jamie_Mitco_SPB_18.06241.06241.4 4.2817 0.2185 100.0 3692.4165 3692.0112 7401.7 1 4.288 23.4 1 K.VKDPMVDDDPVSENYDQINVPKHRAPDATGNPR.T * Jamie_Mitco_SPB_1.00049.00049.2 3.1909 0.398 100.0 1192.2722 1192.2797 4753.3 1 6.923 75.0 3 K.HRAPDATGNPR.T * Jamie_Mitco_SPB_1.00310.00310.2 3.7594 0.4424 100.0 1552.7522 1553.5828 6918.5 1 7.621 80.8 1 R.TTNKVSNTSDQDSR.L * Jamie_Mitco_SPB_27.09477.09477.2 3.0059 0.1237 99.7 1300.1522 1297.5554 8854.6 1 3.371 85.0 3 R.TLSVLTNYVMR.S * Jamie_Mitco_SPB_35.12599.12599.3 3.432 0.2489 100.0 2766.2344 2766.058 9413.4 216 4.411 25.0 1 R.SEDGNNDRMSPLPSPLNTILPINNR.L * Jamie_Mitco_SPB_40.14164.14164.3 4.2909 0.315 100.0 2846.1243 2846.058 7072.3 1 4.93 33.3 1 R.SEDGNNDRMS*PLPSPLNTILPINNR.L * Jamie_Mitco_SPB_49.17356.17356.3 3.8335 0.1086 97.7 2927.8145 2926.058 7713.6 29 3.917 25.0 2 R.SEDGNNDRMS*PLPS*PLNTILPINNR.L * Jamie_Mitco_SPB_40.14113.14113.2 2.1138 0.0217 90.9 1876.5922 1878.2402 8397.2 17 3.571 43.8 1 R.MSPLPSPLNTILPINNR.L * Jamie_Mitco_SPB_49.17565.17565.2 2.5972 0.047 99.2 1959.2522 1958.2402 10395.4 107 3.035 37.5 1 R.MSPLPSPLNT*ILPINNR.L * Jamie_Mitco_SPB_57.20305.20305.2 2.8242 0.0809 99.6 2040.4122 2038.2402 6478.0 2 3.514 53.1 2 R.MS*PLPS*PLNTILPINNR.L * Jamie_Mitco_SPB_27.09467.09467.2 3.5828 0.0766 99.7 1959.7322 1958.1624 4715.0 1 4.677 65.6 1 K.VNPSDDDIMMYESAELK.R * Jamie_Mitco_SPB_22.07829.07829.2 2.2326 0.1167 99.2 2113.0923 2114.3499 6399.4 51 3.972 35.3 1 K.VNPSDDDIMMYESAELKR.V * Jamie_Mitco_SPB_23.07968.07968.3 3.9776 0.3248 100.0 1799.1843 1801.05 8517.2 1 5.857 51.9 1 A.ELKRVEEEIEELKR.K * Jamie_Mitco_SPB_14.04984.04984.3 2.6279 0.1467 97.2 1427.7244 1430.6011 4453.4 34 3.778 45.0 1 K.RVEEEIEELKR.K * Jamie_Mitco_SPB_14.04761.04761.1 2.5173 0.2085 100.0 1274.32 1274.4136 6159.9 3 4.678 66.7 1 R.VEEEIEELKR.K * Jamie_Mitco_SPB_13.04599.04599.2 3.0784 0.0792 99.5 1401.3522 1402.5876 4838.7 1 4.227 80.0 1 R.VEEEIEELKRK.I * Jamie_Mitco_SPB_46.16325.16325.2 3.0253 0.0934 99.5 2617.8323 2615.847 3988.7 1 4.287 45.2 1 R.KLS*LNNQLQELQSMMDGDDNIK.L * Jamie_Mitco_SPB_40.14332.14332.2 3.2778 0.4461 100.0 3191.412 3192.5837 5858.7 1 7.949 35.2 1 R.KLSLNNQLQELQSMMDGDDNIKLDNVSK.H * Jamie_Mitco_SPB_44.15723.15723.3 6.0192 0.494 100.0 3273.2043 3272.5837 6100.4 1 6.822 33.3 2 R.KLS*LNNQLQELQSMMDGDDNIKLDNVSK.H * Jamie_Mitco_SPB_47.16907.16907.2 2.4593 0.1342 99.6 2409.2322 2407.6729 8222.5 7 4.124 32.5 1 K.LSLNNQLQELQSMMDGDDNIK.L * Jamie_Mitco_SPB_45.16029.16029.2 3.3844 0.3665 100.0 3063.5122 3064.4097 6237.5 1 6.085 28.8 1 K.LSLNNQLQELQSMMDGDDNIKLDNVSK.H * Jamie_Mitco_SPB_45.16017.16017.3 4.4668 0.3159 100.0 3065.7244 3064.4097 10539.8 1 5.53 31.7 1 K.LSLNNQLQELQSMMDGDDNIKLDNVSK.H * Jamie_Mitco_SPB_121.43515.43515.3 3.4626 0.2562 100.0 3103.1343 3104.0266 6541.5 51 4.867 26.0 1 R.HSSQSSRDYS*PSSDACLECSNDLYEK.N * Jamie_Mitco_SPB_122.43635.43635.4 3.712 0.2561 100.0 3375.2166 3374.3179 6730.4 20 4.78 22.8 1 R.HSSQSSRDY*SPSSDACLECSNDLYEKNR.V * Jamie_Mitco_SPB_19.06633.06633.2 5.0461 0.3504 100.0 2256.4922 2254.2546 5649.9 1 5.85 66.7 1 R.DYSPSSDACLECSNDLYEK.N * Jamie_Mitco_SPB_24.08373.08373.2 2.0797 0.2437 99.5 2333.5522 2334.2546 6621.1 11 4.616 33.3 1 R.DY*SPSSDACLECSNDLYEK.N * Jamie_Mitco_SPB_22.07785.07785.2 3.9904 0.3985 100.0 2333.6921 2334.2546 7604.9 1 6.593 58.3 2 R.DYS*PSSDACLECSNDLYEK.N * Jamie_Mitco_SPB_14.04794.04794.3 3.3708 0.1469 99.3 2501.8442 2498.6465 5668.1 77 4.035 30.0 1 K.NRVKPENNMSETFAT*PTPNNR.- * Jamie_Mitco_SPB_16.05565.05565.2 2.8191 0.4062 100.0 1956.3322 1958.0637 6710.9 1 6.541 56.2 1 R.VKPENNMSETFAT*PTPN.N * Jamie_Mitco_SPB_14.04908.04908.2 3.9245 0.5041 100.0 2228.5122 2228.355 4270.9 2 7.041 63.9 1 R.VKPENNMSETFAT*PTPNNR.- * Jamie_Mitco_SPB_15.05049.05049.3 4.5789 0.2767 100.0 2229.0544 2228.355 6330.8 1 5.56 43.1 1 R.VKPENNMSETFAT*PTPNNR.- * Jamie_Mitco_SPB_15.05235.05235.3 3.3185 0.1416 99.0 2307.3542 2308.355 4614.2 56 4.361 30.6 1 R.VKPENNMSET*FAT*PTPNNR.- YOR257W 12 13 75.2% 161 18751 4.6 U CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" * Jamie_Mitco_SPB_21.07498.07498.2 3.3109 0.3042 100.0 1860.2522 1860.0282 5168.2 1 6.917 59.4 1 R.SSLQSGPLNSELLEEQK.Q * Jamie_Mitco_SPB_61.21621.21621.3 4.7226 0.4376 100.0 4781.304 4781.215 8493.8 1 7.084 21.2 1 R.SSLQSGPLNSELLEEQKQEIYEAFSLFDMNNDGFLDYHELK.V * Jamie_Mitco_SPB_51.18259.18259.2 2.8018 0.1764 99.7 2939.5122 2940.21 6143.0 1 5.502 32.6 1 K.QEIYEAFSLFDMNNDGFLDYHELK.V * Jamie_Mitco_SPB_65.23295.23295.4 6.9859 0.3805 100.0 4552.5767 4551.1855 10469.3 1 7.588 24.3 1 K.ALGFELPKREILDLIDEYDSEGRHLMKYDDFYIVMGEK.I * Jamie_Mitco_SPB_32.11241.11241.2 4.0331 0.4228 100.0 1822.4922 1823.9542 6767.8 1 8.623 85.7 1 K.REILDLIDEYDSEGR.H * Jamie_Mitco_SPB_37.13199.13199.1 1.5535 0.2513 100.0 1666.69 1667.7667 2008.1 2 4.659 46.2 1 R.EILDLIDEYDSEGR.H * Jamie_Mitco_SPB_31.11086.11086.3 2.8736 0.127 95.8 1892.2144 1890.222 6110.1 167 4.53 33.9 1 R.HLMKYDDFYIVMGEK.I * Jamie_Mitco_SPB_28.09927.09927.2 3.1899 0.4078 100.0 1380.0322 1380.5549 9663.5 1 7.178 90.0 2 K.YDDFYIVMGEK.I * Jamie_Mitco_SPB_28.09936.09936.1 2.4472 0.2545 100.0 1381.18 1380.5549 8672.5 1 4.712 65.0 1 K.YDDFYIVMGEK.I * Jamie_Mitco_SPB_18.06343.06343.2 3.9813 0.2434 100.0 1861.0922 1860.0746 6162.9 1 5.349 83.3 1 R.RVAKELGETLTDEELR.A * Jamie_Mitco_SPB_18.06413.06413.2 2.103 0.1076 98.5 1705.8121 1703.8871 7696.2 154 3.285 39.3 1 R.VAKELGETLTDEELR.A * Jamie_Mitco_SPB_72.25824.25824.3 3.0053 0.2186 100.0 4634.3945 4633.953 7748.7 4 4.484 16.9 1 R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS.- YIL149C 235 296 74.7% 1679 195140 6.0 U MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" * Jamie_Mitco_SPB_41.14615.14615.3 3.638 0.1976 100.0 3374.2144 3375.8035 7364.0 13 4.554 24.1 1 K.IAKFERSEEEVTKLNVLVDEIKSQYYSR.I * Jamie_Mitco_SPB_39.13907.13907.4 4.4184 0.1744 100.0 3066.9766 3063.391 9351.4 48 4.173 22.9 1 K.FERSEEEVTKLNVLVDEIKSQYYSR.I * Jamie_Mitco_SPB_29.10203.10203.2 4.5651 0.3834 100.0 1846.0922 1846.085 8097.8 1 7.133 73.3 1 R.SEEEVTKLNVLVDEIK.S * Jamie_Mitco_SPB_39.13828.13828.3 7.2322 0.3997 100.0 2631.6843 2630.9116 6782.1 1 7.035 52.4 1 R.SEEEVTKLNVLVDEIKSQYYSR.I * Jamie_Mitco_SPB_25.08790.08790.2 4.1061 0.3373 100.0 1716.0721 1714.9158 8906.7 1 7.043 80.8 1 L.NVLVDEIKSQYYSR.I * Jamie_Mitco_SPB_35.12329.12329.4 4.2787 0.0848 98.7 3831.8564 3830.2415 7628.5 40 3.827 20.8 1 R.ISKLKQLLDESSEQKNTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_26.09159.09159.4 6.5381 0.3613 100.0 3500.3364 3501.8296 6028.5 1 7.199 28.7 4 K.LKQLLDESSEQKNTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_18.06299.06299.3 4.5025 0.2402 100.0 3503.1543 3501.8296 5774.8 1 5.596 27.6 3 K.LKQLLDESSEQKNTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_24.08625.08625.4 4.1515 0.1852 100.0 3259.7766 3260.496 7659.2 4 5.031 26.5 1 K.QLLDESSEQKNTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_19.06652.06652.2 4.6659 0.3856 100.0 2101.632 2102.2656 6794.1 1 6.54 58.8 1 K.NTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_20.06891.06891.3 3.1049 0.1164 95.8 2101.7944 2102.2656 8302.1 2 3.653 36.8 1 K.NTAKEELNGLKDQLNEER.S * Jamie_Mitco_SPB_13.04384.04384.2 2.8855 0.2293 100.0 1337.3922 1336.5547 6530.6 1 5.155 75.0 1 K.KQLHVSHEAMR.E * Jamie_Mitco_SPB_20.06855.06855.3 3.0478 0.1632 99.0 2321.8442 2324.512 8157.0 2 4.556 36.8 1 R.EVNDEKRVKEEYDIWQSR.D * Jamie_Mitco_SPB_23.08109.08109.4 6.4054 0.3103 100.0 4123.5366 4125.325 9698.4 3 6.091 21.2 1 R.EVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENK.L * Jamie_Mitco_SPB_17.06021.06021.2 3.2695 0.2834 100.0 1608.2922 1609.7819 7838.3 2 5.663 54.5 1 K.RVKEEYDIWQSR.D * Jamie_Mitco_SPB_17.05892.05892.1 2.2693 0.3558 100.0 1452.42 1453.5944 4115.1 1 6.073 65.0 1 R.VKEEYDIWQSR.D * Jamie_Mitco_SPB_17.05863.05863.2 3.2949 0.0288 99.5 1455.0721 1453.5944 5889.0 1 3.992 80.0 1 R.VKEEYDIWQSR.D * Jamie_Mitco_SPB_19.06615.06615.4 5.6846 0.4007 100.0 3253.8965 3254.4075 4641.2 1 6.997 30.8 1 R.VKEEYDIWQSRDQGNDSLNDDLNKENK.L * Jamie_Mitco_SPB_26.09201.09201.3 6.5625 0.4562 100.0 3636.7444 3636.9138 9629.5 1 7.918 31.9 1 R.VKEEYDIWQSRDQGNDSLNDDLNKENKLLR.R * Jamie_Mitco_SPB_20.06916.06916.3 4.1523 0.338 100.0 3025.9143 3027.1008 9110.4 26 6.431 24.0 1 K.EEYDIWQSRDQGNDSLNDDLNKENK.L * Jamie_Mitco_SPB_19.06701.06701.2 2.9589 0.146 99.7 1819.3722 1819.8363 6740.8 55 4.038 43.3 1 R.DQGNDSLNDDLNKENK.L * Jamie_Mitco_SPB_18.06207.06207.3 3.5904 0.2268 100.0 2201.9043 2202.3428 4009.5 1 4.64 40.3 1 R.DQGNDSLNDDLNKENKLLR.R * Jamie_Mitco_SPB_18.06220.06220.2 3.6448 0.1654 100.0 2202.872 2202.3428 6038.9 1 4.474 58.3 1 R.DQGNDSLNDDLNKENKLLR.R * Jamie_Mitco_SPB_15.05391.05391.2 3.615 0.4226 100.0 2072.412 2074.2493 6717.5 1 7.839 55.9 1 K.TLTEEVTKSSHVENLEEK.L * Jamie_Mitco_SPB_43.15275.15275.3 3.9618 0.2959 100.0 4072.1643 4071.4585 11065.1 8 5.334 19.7 1 K.TLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNK.F * Jamie_Mitco_SPB_43.15240.15240.4 3.8958 0.2031 100.0 4072.6165 4071.4585 9572.3 1 4.342 20.2 1 K.TLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNK.F * Jamie_Mitco_SPB_41.14685.14685.2 3.9151 0.3919 100.0 3169.0322 3169.4463 7794.3 1 6.654 36.0 1 K.SSHVENLEEKLYQMQSNYESVFTYNK.F * Jamie_Mitco_SPB_28.09741.09741.2 2.698 0.2773 100.0 2014.3522 2016.2324 10143.1 2 4.732 43.3 1 K.LYQMQSNYESVFTYNK.F * Jamie_Mitco_SPB_30.10594.10594.3 2.888 0.1226 93.9 2508.9243 2506.9202 7572.3 84 3.817 32.5 1 K.FLLNQNKQLSQSVEEKVLEMK.N * Jamie_Mitco_SPB_19.06587.06587.3 3.8722 0.3438 100.0 2270.4243 2268.6306 7666.5 5 5.871 32.9 1 K.VLEMKNLKDTASVEKAEFSK.E * Jamie_Mitco_SPB_9.03033.03033.2 2.2927 0.2359 99.7 1104.2522 1105.2334 3276.2 1 5.404 83.3 1 K.NLKDTASVEK.A * Jamie_Mitco_SPB_19.06825.06825.2 3.0769 0.3438 100.0 2399.412 2398.734 6184.0 1 5.853 40.0 1 K.NLKDTASVEKAEFSKEMTLQK.N * Jamie_Mitco_SPB_15.05314.05314.1 2.1277 0.1908 100.0 1536.39 1537.6764 3757.8 1 4.823 62.5 1 R.SQLTSLEKDCSLR.A * Jamie_Mitco_SPB_17.05805.05805.2 3.6323 0.2215 100.0 1539.3121 1537.6764 7863.8 1 4.522 70.8 1 R.SQLTSLEKDCSLR.A * Jamie_Mitco_SPB_33.11721.11721.4 4.22 0.226 100.0 4562.0166 4561.847 7024.8 3 4.328 18.9 1 R.SQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTK.L * Jamie_Mitco_SPB_27.09447.09447.4 4.5295 0.176 100.0 3676.6565 3674.8464 7741.3 1 4.682 25.6 1 K.DCSLRAIEKNDDNSCRNPEHTDVIDELIDTK.L * Jamie_Mitco_SPB_23.08049.08049.3 4.7346 0.2869 100.0 3045.0544 3043.1938 9132.1 3 5.305 28.0 2 R.AIEKNDDNSCRNPEHTDVIDELIDTK.L * Jamie_Mitco_SPB_26.09193.09193.3 4.2953 0.3154 100.0 3310.1643 3312.5408 8521.1 2 5.969 25.9 1 R.AIEKNDDNSCRNPEHTDVIDELIDTKLR.L * Jamie_Mitco_SPB_26.09203.09203.4 6.9373 0.3367 100.0 3314.6565 3312.5408 8814.9 1 6.037 29.6 1 R.AIEKNDDNSCRNPEHTDVIDELIDTKLR.L * Jamie_Mitco_SPB_30.10677.10677.4 5.9212 0.3112 100.0 3683.2166 3682.9897 9330.8 1 6.227 25.6 3 R.AIEKNDDNSCRNPEHTDVIDELIDTKLRLEK.S * Jamie_Mitco_SPB_25.08973.08973.3 4.0777 0.2209 100.0 2603.2144 2601.666 7516.6 1 4.718 38.1 1 K.NDDNSCRNPEHTDVIDELIDTK.L * Jamie_Mitco_SPB_28.09886.09886.2 2.4654 0.2382 99.7 1739.7522 1739.8767 7822.2 1 5.106 50.0 1 R.NPEHTDVIDELIDTK.L * Jamie_Mitco_SPB_58.20683.20683.3 6.6767 0.4842 100.0 3433.6443 3431.9133 7719.7 1 7.615 35.2 1 R.NQKFQLQNQLEDFILELEHKTPELISFK.E * Jamie_Mitco_SPB_55.19491.19491.4 6.8188 0.43 100.0 3717.8965 3717.2163 9403.6 1 7.197 28.2 1 R.NQKFQLQNQLEDFILELEHKTPELISFKER.T * Jamie_Mitco_SPB_54.19273.19273.2 3.6688 0.3967 100.0 2143.8123 2145.4197 6410.6 1 6.893 59.4 1 K.FQLQNQLEDFILELEHK.T * Jamie_Mitco_SPB_54.19321.19321.3 3.848 0.0895 99.3 2148.6543 2145.4197 3562.7 3 3.669 43.8 1 K.FQLQNQLEDFILELEHK.T * Jamie_Mitco_SPB_57.20328.20328.3 5.9195 0.2132 100.0 3347.6943 3346.8076 8241.9 1 5.878 33.7 1 K.FQLQNQLEDFILELEHKTPELISFKER.T * Jamie_Mitco_SPB_16.05608.05608.2 2.453 0.3505 100.0 1219.1522 1220.4111 4729.3 25 5.33 72.2 1 K.TPELISFKER.T * Jamie_Mitco_SPB_13.04338.04338.2 1.9706 0.1456 99.2 1241.0721 1241.4331 4960.4 1 3.774 77.8 1 R.TKSLEHELKR.S * Jamie_Mitco_SPB_47.16828.16828.2 4.4487 0.3776 100.0 2727.132 2727.1277 8458.3 1 6.279 39.6 1 K.LLLLNTSAIQETASPLSQDELISLR.K * Jamie_Mitco_SPB_51.18227.18227.2 2.5724 0.1619 99.5 2805.7522 2807.1277 9028.1 4 4.48 29.2 1 K.LLLLNTSAIQETAS*PLSQDELISLR.K * Jamie_Mitco_SPB_40.14160.14160.2 2.4965 0.2764 100.0 2853.0923 2855.3018 7965.3 1 5.09 30.0 1 K.LLLLNTSAIQETASPLSQDELISLRK.I * Jamie_Mitco_SPB_42.15035.15035.2 1.9244 0.1798 99.2 2933.632 2935.3018 5556.2 8 3.607 28.0 1 K.LLLLNTSAIQETAS*PLSQDELISLRK.I * Jamie_Mitco_SPB_23.07983.07983.2 3.4182 0.2765 100.0 2246.632 2246.4363 6606.6 1 5.327 55.3 1 K.ILESSNIVNENDSQAIITER.L * Jamie_Mitco_SPB_24.08395.08395.2 2.3662 0.1421 99.6 2325.0923 2326.4363 8578.8 6 4.127 39.5 1 K.ILESSNIVNENDS*QAIITER.L * Jamie_Mitco_SPB_28.09965.09965.2 4.8326 0.3396 100.0 2327.392 2326.4363 10131.5 1 6.912 47.4 1 K.ILES*SNIVNENDSQAIITER.L * Jamie_Mitco_SPB_20.06855.06855.2 3.3391 0.3009 100.0 1548.2322 1549.721 8157.0 1 5.253 83.3 1 R.LVEFSNVNELQEK.N * Jamie_Mitco_SPB_19.06799.06799.1 3.1819 0.3495 100.0 1549.38 1549.721 5970.6 1 6.762 66.7 1 R.LVEFSNVNELQEK.N * Jamie_Mitco_SPB_35.12538.12538.2 3.9569 0.2112 100.0 2661.0522 2661.9812 7436.6 1 5.87 45.2 1 R.LVEFSNVNELQEKNVELLNCIR.I * Jamie_Mitco_SPB_14.05022.05022.2 2.3179 0.1514 99.6 1763.0721 1764.9731 5217.6 198 4.077 46.4 1 R.ILADKLENYEGKQDK.T * Jamie_Mitco_SPB_27.09411.09411.4 4.8867 0.2015 100.0 3376.1765 3376.832 7875.7 1 4.637 26.8 1 R.ILADKLENYEGKQDKTLQKVENQTIKEAK.D * Jamie_Mitco_SPB_58.20697.20697.4 4.5343 0.1767 100.0 4703.7363 4701.3286 9640.8 1 4.412 20.0 1 R.ILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAK.M * Jamie_Mitco_SPB_13.04527.04527.2 3.728 0.2816 100.0 1630.4722 1630.8821 7561.9 1 6.096 69.2 1 K.TLQKVENQTIKEAK.D * Jamie_Mitco_SPB_51.18275.18275.4 5.2957 0.2485 100.0 2955.5764 2955.3787 9492.1 5 4.729 29.3 2 K.TLQKVENQTIKEAKDAIIELENINAK.M * Jamie_Mitco_SPB_49.17542.17542.3 5.2427 0.3143 100.0 2958.0842 2955.3787 9175.3 1 5.648 34.0 1 K.TLQKVENQTIKEAKDAIIELENINAK.M * Jamie_Mitco_SPB_1.00353.00353.2 2.6351 0.195 99.7 1159.5122 1160.3127 6630.0 10 4.636 72.2 1 K.VENQTIKEAK.D * Jamie_Mitco_SPB_24.08524.08524.1 3.4057 0.0378 100.0 1344.35 1343.5199 5943.3 1 3.402 68.2 2 K.DAIIELENINAK.M * Jamie_Mitco_SPB_28.10059.10059.2 4.3366 0.3801 100.0 1860.7722 1861.1205 9804.2 1 8.124 66.7 1 K.DAIIELENINAKMETR.I * Jamie_Mitco_SPB_18.06292.06292.2 4.6978 0.4651 100.0 2832.112 2832.0686 5580.4 1 7.677 48.0 1 R.DSYKLLASTEENKANTNSVTSMEAAR.E * Jamie_Mitco_SPB_30.10600.10600.3 3.4644 0.1443 99.0 2742.1143 2743.133 7275.4 2 3.884 30.4 1 K.KIRELEAELSSTKVENSAIIQNLR.K * Jamie_Mitco_SPB_29.10229.10229.4 4.9279 0.2158 100.0 2871.8564 2871.3071 6722.5 1 4.717 29.9 1 K.KIRELEAELSSTKVENSAIIQNLRK.E * Jamie_Mitco_SPB_15.05099.05099.2 3.0701 0.1427 99.7 1378.0521 1376.5498 7400.0 1 3.793 68.2 1 K.IRELEAELSSTK.V * Jamie_Mitco_SPB_27.09624.09624.3 4.1173 0.2397 100.0 2613.6543 2614.959 8912.5 10 4.389 26.1 1 K.IRELEAELSSTKVENSAIIQNLR.K * Jamie_Mitco_SPB_26.09267.09267.4 4.4029 0.2844 100.0 2744.8965 2743.133 6938.3 1 5.272 27.5 1 K.IRELEAELSSTKVENSAIIQNLRK.E * Jamie_Mitco_SPB_14.04719.04719.1 2.9706 0.3057 100.0 1107.42 1107.2029 3062.8 1 5.296 77.8 1 R.ELEAELSSTK.V * Jamie_Mitco_SPB_26.09213.09213.3 3.1995 0.2094 100.0 2344.2244 2345.612 6252.4 15 5.23 31.2 1 R.ELEAELSSTKVENSAIIQNLR.K * Jamie_Mitco_SPB_23.08160.08160.3 5.3016 0.4279 100.0 2471.6943 2473.7861 6895.7 1 6.372 44.0 1 R.ELEAELSSTKVENSAIIQNLRK.E * Jamie_Mitco_SPB_19.06525.06525.3 3.3759 0.0709 97.2 1501.9143 1500.6915 6860.2 65 3.502 47.7 1 K.KKTTLEDFENFK.G * Jamie_Mitco_SPB_20.06922.06922.2 2.8006 0.2187 100.0 1373.6522 1372.5175 3566.2 1 5.102 75.0 1 K.KTTLEDFENFK.G * Jamie_Mitco_SPB_23.08019.08019.3 4.1752 0.3339 100.0 1741.2843 1741.9817 5258.9 1 6.189 46.4 1 K.KTTLEDFENFKGLAK.E * Jamie_Mitco_SPB_22.07907.07907.2 2.6173 0.1471 99.5 1742.5922 1741.9817 7807.9 16 4.066 53.6 1 K.KTTLEDFENFKGLAK.E * Jamie_Mitco_SPB_25.08680.08680.1 2.2625 0.1805 100.0 1243.09 1244.3434 6340.8 112 5.204 61.1 1 K.TTLEDFENFK.G * Jamie_Mitco_SPB_26.09363.09363.2 3.2118 0.372 100.0 1612.3522 1613.8076 9721.6 1 6.524 69.2 1 K.TTLEDFENFKGLAK.E * Jamie_Mitco_SPB_31.11020.11020.2 3.2303 0.3519 100.0 2024.9521 2026.3557 5634.8 1 6.83 56.2 1 R.MLEEAIDHLKAELEKQK.S * Jamie_Mitco_SPB_31.11001.11001.3 4.8011 0.363 100.0 2028.4744 2026.3557 5513.3 1 6.454 45.3 1 R.MLEEAIDHLKAELEKQK.S * Jamie_Mitco_SPB_16.05465.05465.3 3.4994 0.292 100.0 1949.0044 1950.2859 5079.6 23 5.368 35.9 1 K.LKKETASFIPTKESLTR.D * Jamie_Mitco_SPB_16.05739.05739.2 3.4294 0.273 100.0 1581.3722 1580.7783 4001.2 1 4.875 69.2 1 K.ETASFIPTKESLTR.D * Jamie_Mitco_SPB_16.05757.05757.3 2.9861 0.2214 100.0 1582.3444 1580.7783 4078.8 13 4.881 40.4 1 K.ETASFIPTKESLTR.D * Jamie_Mitco_SPB_14.04998.04998.2 2.8127 0.2289 100.0 1574.0521 1573.632 3856.7 1 5.226 63.6 1 K.ESLTRDFEQCCK.E * Jamie_Mitco_SPB_1.00219.00219.2 3.5747 0.3057 100.0 1427.9922 1428.5419 5153.9 1 6.481 86.4 3 R.LKESEISHNENK.M * Jamie_Mitco_SPB_10.03297.03297.3 2.7325 0.0674 91.2 1428.7444 1428.5419 5128.1 6 3.989 47.7 1 R.LKESEISHNENK.M * Jamie_Mitco_SPB_14.04932.04932.3 3.2949 0.1349 99.0 2125.7043 2124.33 6639.8 21 4.485 35.3 1 R.LKESEISHNENKMDFSSK.E * Jamie_Mitco_SPB_12.04311.04311.2 1.9748 0.0228 94.1 1019.1322 1017.0837 4668.3 17 2.786 71.4 1 K.ELENNLER.L * Jamie_Mitco_SPB_27.09574.09574.2 2.8749 0.1434 99.7 1648.3922 1646.8381 6284.2 1 3.814 65.4 1 R.SDLQSKIQEIESIR.S * Jamie_Mitco_SPB_16.05589.05589.2 3.7279 0.3343 100.0 1710.6522 1711.9453 4945.2 1 5.81 76.9 1 K.WAQNTIDDTEMKMK.S * Jamie_Mitco_SPB_53.18750.18750.4 3.4186 0.1427 98.7 3493.5764 3493.9922 8551.4 44 3.512 21.8 1 K.MKSLLTELSNKETTIEKLSSEIENLDKELR.K * Jamie_Mitco_SPB_22.07692.07692.2 3.2266 0.2755 100.0 1706.5122 1706.931 8141.3 1 5.671 60.7 2 K.SLLTELSNKETTIEK.L * Jamie_Mitco_SPB_52.18413.18413.3 7.0332 0.3198 100.0 3234.5942 3234.6257 6549.2 1 7.124 39.8 2 K.SLLTELSNKETTIEKLSSEIENLDKELR.K * Jamie_Mitco_SPB_52.18621.18621.4 6.8204 0.3335 100.0 3234.7366 3234.6257 8329.4 1 6.746 38.9 1 K.SLLTELSNKETTIEKLSSEIENLDKELR.K * Jamie_Mitco_SPB_50.17754.17754.4 5.3942 0.2134 100.0 3464.8164 3463.9048 8429.7 1 4.963 29.3 1 K.SLLTELSNKETTIEKLSSEIENLDKELRKT.K * Jamie_Mitco_SPB_42.14769.14769.4 6.8598 0.3436 100.0 3034.3765 3034.388 11522.8 1 7.662 40.7 1 L.LTELSNKETTIEKLSSEIENLDKELR.K * Jamie_Mitco_SPB_15.05139.05139.1 2.003 0.1442 100.0 1146.99 1148.2554 5658.0 38 4.537 61.1 1 K.LSSEIENLDK.E * Jamie_Mitco_SPB_19.06537.06537.3 3.5554 0.2112 100.0 1674.8944 1674.8918 4110.8 1 4.3 51.9 1 K.LSSEIENLDKELRK.T * Jamie_Mitco_SPB_19.06549.06549.2 4.244 0.2721 100.0 1675.5721 1674.8918 5515.7 1 5.22 73.1 1 K.LSSEIENLDKELRK.T * Jamie_Mitco_SPB_23.08200.08200.2 2.3648 0.0306 95.6 2503.892 2502.7864 7164.5 8 2.951 35.0 1 K.FQYKFLDQNSDASTLEPTLRK.E * Jamie_Mitco_SPB_24.08307.08307.3 3.2594 0.1903 100.0 2504.3342 2502.7864 8114.2 1 4.376 38.8 1 K.FQYKFLDQNSDASTLEPTLRK.E * Jamie_Mitco_SPB_23.07966.07966.2 2.4385 0.1756 99.5 1809.0721 1807.9548 8444.9 5 4.277 46.7 1 K.FLDQNSDASTLEPTLR.K * Jamie_Mitco_SPB_18.06354.06354.2 2.916 0.1753 99.7 1935.8922 1936.1289 7994.2 1 4.582 53.1 1 K.FLDQNSDASTLEPTLRK.E * Jamie_Mitco_SPB_44.15503.15503.3 3.8097 0.2074 100.0 3144.3843 3145.537 7646.1 1 4.788 26.9 1 K.FLDQNSDASTLEPTLRKELEQIQVQLK.D * Jamie_Mitco_SPB_70.25181.25181.4 6.4376 0.4245 100.0 6377.2964 6376.07 10095.5 1 6.17 16.1 2 K.FLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_58.20673.20673.4 8.1649 0.4649 100.0 4586.0967 4587.138 11257.8 1 8.471 27.8 1 R.KELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_61.21909.21909.3 6.261 0.4712 100.0 4457.9043 4458.964 9671.6 1 7.525 25.0 2 K.ELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_62.22023.22023.4 7.8368 0.4347 100.0 4460.9766 4458.964 9996.9 1 7.351 21.5 1 K.ELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_55.19671.19671.2 5.5001 0.3156 100.0 2695.4922 2693.9243 6087.4 1 6.424 60.9 1 K.DANSQIQAYEEIISSNENALIELK.N * Jamie_Mitco_SPB_60.21423.21423.3 5.4027 0.3629 100.0 3249.5344 3249.556 6721.7 1 7.213 28.6 1 K.DANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_60.21373.21373.2 4.4809 0.3905 100.0 3250.2722 3249.556 7633.8 1 6.184 37.5 1 K.DANSQIQAYEEIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_70.25133.25133.2 2.8864 0.2545 100.0 2129.0923 2129.4155 6783.3 11 4.206 36.1 2 E.EIISSNENALIELKNELAK.T * Jamie_Mitco_SPB_71.25248.25248.2 2.4508 0.2527 94.4 1772.1122 1773.9811 6381.5 1 5.688 50.0 1 I.SSNENALIELKNELAK.T * Jamie_Mitco_SPB_122.43864.43864.4 3.5156 0.1796 100.0 1710.0165 1709.9371 5877.8 14 4.516 39.7 3 K.TKENYDAKIELEKK.E * Jamie_Mitco_SPB_14.05021.05021.2 2.4674 0.0578 99.2 1711.5521 1709.9371 5757.8 1 3.586 53.8 3 K.TKENYDAKIELEKK.E * Jamie_Mitco_SPB_20.06939.06939.2 2.2486 0.0718 97.3 1966.7322 1967.2267 6214.9 1 3.437 46.7 1 K.TKENYDAKIELEKKEK.W * Jamie_Mitco_SPB_25.08860.08860.3 4.0557 0.3493 100.0 2509.2244 2511.8435 6311.9 1 5.578 38.8 2 K.LKEGALHFVQQSEKLRNEVER.I * Jamie_Mitco_SPB_1.00047.00047.2 2.3489 0.0375 99.2 915.8122 916.02496 5982.2 14 3.244 83.3 1 K.LRNEVER.I * Jamie_Mitco_SPB_12.04125.04125.2 3.2919 0.2178 100.0 1604.4122 1604.7902 3603.4 1 4.984 75.0 1 K.EMSQYQSTMKENK.D * Jamie_Mitco_SPB_24.08512.08512.1 2.1208 0.0667 100.0 944.43 945.1039 3737.5 16 4.372 71.4 1 K.DLSELVIR.L * Jamie_Mitco_SPB_49.17610.17610.3 4.5356 0.3198 100.0 2520.8643 2518.79 11135.4 1 6.162 38.1 1 K.DLSELVIRLEKDAADCQAELTK.T * Jamie_Mitco_SPB_13.04350.04350.1 2.1712 0.2865 100.0 1591.32 1592.7095 5763.2 1 4.975 53.8 1 R.LEKDAADCQAELTK.T * Jamie_Mitco_SPB_12.04324.04324.3 3.0099 0.2459 100.0 1592.1543 1592.7095 5132.3 1 5.262 46.2 1 R.LEKDAADCQAELTK.T * Jamie_Mitco_SPB_1.00022.00022.2 2.9262 0.2222 100.0 1592.6721 1592.7095 8672.3 1 5.003 69.2 2 R.LEKDAADCQAELTK.T * Jamie_Mitco_SPB_17.05865.05865.3 2.8294 0.321 100.0 1762.1943 1762.917 4631.3 1 5.107 55.4 1 K.SSLYSAQDLLDKHER.K * Jamie_Mitco_SPB_18.06449.06449.2 2.588 0.1794 99.7 1763.2722 1762.917 6901.8 7 4.327 46.4 1 K.SSLYSAQDLLDKHER.K * Jamie_Mitco_SPB_37.13216.13216.4 3.967 0.2834 100.0 3001.6565 2999.322 6986.1 3 4.845 26.8 1 R.KWMEEKADYERELISNIEQTESLR.V * Jamie_Mitco_SPB_38.13470.13470.3 4.374 0.2412 100.0 2872.0144 2871.148 7275.9 1 5.16 37.5 1 K.WMEEKADYERELISNIEQTESLR.V * Jamie_Mitco_SPB_22.07620.07620.2 3.5567 0.389 100.0 1532.3722 1532.6909 5542.9 1 6.652 75.0 1 R.ELISNIEQTESLR.V * Jamie_Mitco_SPB_6.01809.01809.2 3.6048 0.3089 100.0 1612.8322 1613.6812 6392.1 7 5.682 50.0 3 K.VDDTAANNGDKDHLK.L * Jamie_Mitco_SPB_30.10791.10791.4 4.4196 0.3107 100.0 2643.2966 2643.9163 7162.0 1 5.821 29.7 2 K.VDDTAANNGDKDHLKLVSLFSNLR.H * Jamie_Mitco_SPB_29.10147.10147.2 3.0137 0.255 100.0 2643.872 2643.9163 6276.2 1 4.782 39.1 1 K.VDDTAANNGDKDHLKLVSLFSNLR.H * Jamie_Mitco_SPB_30.10539.10539.3 3.3776 0.12 96.1 2646.0842 2643.9163 9069.4 8 3.819 29.3 1 K.VDDTAANNGDKDHLKLVSLFSNLR.H * Jamie_Mitco_SPB_26.09047.09047.2 2.324 0.2264 99.7 1049.3922 1049.2584 4354.9 1 5.187 93.8 1 K.LVSLFSNLR.H * Jamie_Mitco_SPB_38.13605.13605.3 5.3763 0.3607 100.0 2845.6143 2848.1426 9086.0 1 7.028 33.7 1 R.TQTLSEKEYQCSAVIIDEFKDITK.E * Jamie_Mitco_SPB_54.19149.19149.4 6.1976 0.1922 100.0 4786.2563 4784.3813 8834.6 1 4.498 21.2 1 R.TQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQK.S * Jamie_Mitco_SPB_19.06736.06736.2 4.4779 0.2117 100.0 1955.3522 1955.2621 7645.9 1 5.385 62.5 1 K.EVTQVNILKENNAILQK.S * Jamie_Mitco_SPB_9.02982.02982.1 2.055 0.0268 98.4 929.46 930.0489 5485.9 1 3.265 78.6 1 K.ENNAILQK.S * Jamie_Mitco_SPB_4.01089.01089.1 2.001 0.1297 100.0 918.19 919.066 5426.3 43 3.918 64.3 1 K.SLKNVTEK.N * Jamie_Mitco_SPB_4.01143.01143.2 1.8908 0.0304 93.5 919.03217 919.066 5476.1 42 3.221 78.6 2 K.SLKNVTEK.N * Jamie_Mitco_SPB_14.04983.04983.4 3.1742 0.1475 99.3 2193.0964 2192.3965 6144.8 64 3.56 32.3 1 K.NREIYKQLNDRQEEISR.L * Jamie_Mitco_SPB_22.07841.07841.3 3.7166 0.0717 95.1 2815.4644 2814.106 7594.6 1 3.555 31.8 1 K.EQVSINSNKILVYESEMEQCKQR.Y * Jamie_Mitco_SPB_15.05359.05359.2 3.4829 0.3642 100.0 1813.2722 1814.0297 4456.3 1 6.402 69.2 1 K.ILVYESEMEQCKQR.Y * Jamie_Mitco_SPB_8.02795.02795.1 1.9147 0.1498 100.0 1138.2 1138.2224 5587.6 11 4.161 62.5 1 R.YQDLSQQQK.D * Jamie_Mitco_SPB_8.02679.02679.2 2.6191 0.1525 99.7 1140.3522 1138.2224 5215.9 4 3.978 87.5 1 R.YQDLSQQQK.D * Jamie_Mitco_SPB_7.02368.02368.2 3.9693 0.3797 100.0 1579.6921 1580.6946 7205.7 1 6.825 83.3 1 R.YQDLSQQQKDAQK.K * Jamie_Mitco_SPB_12.04185.04185.3 3.0747 0.1432 97.4 2196.4143 2194.4062 4904.8 1 3.767 38.2 1 R.YQDLSQQQKDAQKKDIEK.L * Jamie_Mitco_SPB_28.09771.09771.3 5.0178 0.4127 100.0 3393.2644 3393.776 8617.7 1 6.029 30.4 1 R.YQDLSQQQKDAQKKDIEKLTNEISDLKGK.L * Jamie_Mitco_SPB_24.08505.08505.4 4.0551 0.1935 100.0 2274.7766 2274.5767 6124.6 4 4.496 37.7 1 K.DAQKKDIEKLTNEISDLKGK.L * Jamie_Mitco_SPB_37.13095.13095.4 5.3478 0.2545 100.0 3582.7366 3578.915 8075.3 1 5.3 25.3 1 K.DIEKLTNEISDLKGKLSSAENANADLENKFNR.L * Jamie_Mitco_SPB_28.09762.09762.4 3.4232 0.0873 93.9 3094.7766 3093.3774 7286.7 83 4.371 23.5 1 K.LTNEISDLKGKLSSAENANADLENKFNR.L * Jamie_Mitco_SPB_15.05158.05158.2 4.6712 0.2934 100.0 2078.8123 2079.234 5528.7 1 6.593 61.1 1 K.GKLSSAENANADLENKFNR.L * Jamie_Mitco_SPB_13.04366.04366.1 2.4241 0.258 100.0 1475.3 1476.54 6282.4 1 5.334 57.7 1 K.LSSAENANADLENK.F * Jamie_Mitco_SPB_15.05308.05308.2 4.3297 0.5494 100.0 1892.2922 1894.0079 6359.6 1 9.711 59.4 3 K.LSSAENANADLENKFNR.L * Jamie_Mitco_SPB_18.06325.06325.2 2.9549 0.1834 99.7 1601.1721 1600.8125 6942.5 17 4.29 50.0 1 K.KQQAALTNELNELK.A * Jamie_Mitco_SPB_47.16773.16773.4 7.7045 0.4382 100.0 3482.5764 3481.931 8062.7 1 8.002 33.9 1 K.KQQAALTNELNELKAIKDKLEQDLHFENAK.V * Jamie_Mitco_SPB_48.16943.16943.3 4.214 0.1808 100.0 3356.3044 3353.7568 5218.9 7 4.053 24.1 1 K.QQAALTNELNELKAIKDKLEQDLHFENAK.V * Jamie_Mitco_SPB_20.06966.06966.2 4.3302 0.4229 100.0 1898.9122 1900.1417 8187.3 1 7.061 66.7 2 K.AIKDKLEQDLHFENAK.V * Jamie_Mitco_SPB_19.06819.06819.3 3.8678 0.2455 100.0 1899.0543 1900.1417 8509.8 1 5.185 48.3 2 K.AIKDKLEQDLHFENAK.V * Jamie_Mitco_SPB_19.06838.06838.4 3.8722 0.1694 100.0 1903.5765 1900.1417 3804.7 1 4.119 40.0 1 K.AIKDKLEQDLHFENAK.V * Jamie_Mitco_SPB_16.05573.05573.2 3.4012 0.1338 99.7 1588.9122 1587.7294 6697.9 1 4.006 75.0 3 K.DKLEQDLHFENAK.V * Jamie_Mitco_SPB_14.04819.04819.1 2.4108 0.303 100.0 1344.02 1344.4668 7728.9 5 5.652 55.0 1 K.LEQDLHFENAK.V * Jamie_Mitco_SPB_14.05031.05031.2 2.7396 0.1996 100.0 1044.5922 1045.2645 3104.9 1 4.807 87.5 1 K.VIDLDTKLK.A * Jamie_Mitco_SPB_14.04887.04887.4 3.6499 0.1009 97.2 2556.9766 2557.7393 6137.8 1 4.412 34.2 1 K.LKAHELQSEDVSRDHEKDTYR.T * Jamie_Mitco_SPB_14.04870.04870.2 3.0769 0.2735 100.0 2557.2522 2557.7393 7493.4 3 5.666 40.0 1 K.LKAHELQSEDVSRDHEKDTYR.T * Jamie_Mitco_SPB_38.13354.13354.4 4.8431 0.3197 100.0 3859.1365 3860.2878 11265.7 367 5.3 17.2 1 K.LKAHELQSEDVSRDHEKDTYRTLMEEIESLKK.E * Jamie_Mitco_SPB_37.13183.13183.3 3.5938 0.1995 100.0 3861.1443 3860.2878 10748.0 14 4.524 21.0 1 K.LKAHELQSEDVSRDHEKDTYRTLMEEIESLKK.E * Jamie_Mitco_SPB_5.01507.01507.2 3.3986 0.3433 100.0 1271.4521 1271.3292 6983.1 1 6.504 85.0 4 K.AHELQSEDVSR.D * Jamie_Mitco_SPB_13.04578.04578.2 2.5026 0.0264 96.6 2317.4521 2316.4055 6642.9 30 3.01 36.1 2 K.AHELQSEDVSRDHEKDTYR.T * Jamie_Mitco_SPB_13.04330.04330.3 2.6716 0.1434 94.3 2317.9143 2316.4055 6803.4 1 4.189 37.5 1 K.AHELQSEDVSRDHEKDTYR.T * Jamie_Mitco_SPB_26.09046.09046.2 2.6023 0.1214 99.5 1322.5122 1321.572 6376.5 2 3.623 80.0 3 R.TLMEEIESLKK.E * Jamie_Mitco_SPB_51.18129.18129.3 2.7391 0.16 96.6 2079.5344 2080.4878 2901.4 2 4.246 40.6 1 R.TLMEEIESLKKELQIFK.T * Jamie_Mitco_SPB_51.18124.18124.2 4.5182 0.3276 100.0 2081.372 2080.4878 11151.5 1 6.118 62.5 1 R.TLMEEIESLKKELQIFK.T * Jamie_Mitco_SPB_21.07233.07233.2 4.4409 0.3925 100.0 1915.7322 1916.0947 7684.4 1 7.102 68.8 1 K.ELQIFKTANSSSDAFEK.L * Jamie_Mitco_SPB_13.04635.04635.2 3.5133 0.3284 100.0 1397.8322 1398.5126 7256.8 1 6.806 75.0 1 K.TANSSSDAFEKLK.V * Jamie_Mitco_SPB_18.06341.06341.2 2.9656 0.1136 99.5 2017.1721 2017.3513 5322.8 4 4.19 50.0 1 K.LKVNMEKEKDRIIDER.T * Jamie_Mitco_SPB_19.06519.06519.4 3.3358 0.2145 100.0 2017.2965 2017.3513 3892.2 3 4.41 36.7 1 K.LKVNMEKEKDRIIDER.T * Jamie_Mitco_SPB_15.05291.05291.2 2.654 0.0765 99.1 1775.0521 1776.0178 4229.0 4 4.161 53.8 1 K.VNMEKEKDRIIDER.T * Jamie_Mitco_SPB_13.04421.04421.2 2.8061 0.173 99.7 1409.2922 1408.5944 4884.5 1 4.066 75.0 1 R.IIDERTKEFEK.K * Jamie_Mitco_SPB_6.01864.01864.2 2.4285 0.0144 99.2 972.39215 974.1454 4276.2 6 3.588 78.6 1 K.KLQETLNK.S * Jamie_Mitco_SPB_7.02332.02332.1 2.0418 0.0214 97.0 974.4 974.1454 4087.6 23 3.054 64.3 1 K.KLQETLNK.S * Jamie_Mitco_SPB_17.05952.05952.4 4.0796 0.1182 99.6 2872.6165 2872.1992 7298.0 1 4.005 28.5 1 K.KLQETLNKSTSSEAEYSKDIETLKK.E * Jamie_Mitco_SPB_17.05987.05987.3 3.8902 0.264 100.0 2873.6643 2872.1992 10964.7 1 5.247 33.3 1 K.KLQETLNKSTSSEAEYSKDIETLKK.E * Jamie_Mitco_SPB_40.14338.14338.4 5.8109 0.4037 100.0 4464.8965 4464.9243 10501.0 1 6.231 19.9 1 K.KLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLR.R * Jamie_Mitco_SPB_40.14055.14055.4 5.7338 0.1466 100.0 4624.3364 4624.9243 10074.8 1 6.111 23.6 1 K.KLQETLNKSTSSEAEYSKDIETLKKEWLKEY*EDET*LR.R * Jamie_Mitco_SPB_15.05217.05217.2 2.5527 0.0792 99.2 1916.3922 1917.0771 3969.8 69 3.44 37.5 2 K.STSSEAEYSKDIETLKK.E * Jamie_Mitco_SPB_40.14385.14385.4 5.8379 0.4196 100.0 3508.8564 3509.8022 7623.9 1 7.005 29.8 1 K.STSSEAEYSKDIETLKKEWLKEYEDETLR.R * Jamie_Mitco_SPB_41.14475.14475.3 3.1603 0.0869 91.5 3511.1343 3509.8022 8558.1 43 3.37 24.1 1 K.STSSEAEYSKDIETLKKEWLKEYEDETLR.R * Jamie_Mitco_SPB_39.13938.13938.3 4.9835 0.399 100.0 3665.4844 3665.9897 8238.0 1 6.979 31.0 1 K.STSSEAEYSKDIETLKKEWLKEYEDETLRR.I * Jamie_Mitco_SPB_38.13552.13552.4 5.5141 0.2781 100.0 3668.0566 3665.9897 9335.3 1 5.489 27.0 2 K.STSSEAEYSKDIETLKKEWLKEYEDETLRR.I * Jamie_Mitco_SPB_22.07623.07623.2 2.3636 0.1246 99.6 1611.0521 1611.7484 6475.9 2 3.76 68.2 1 K.EWLKEYEDETLR.R * Jamie_Mitco_SPB_20.07173.07173.2 3.1214 0.3267 100.0 1767.0721 1767.9359 4419.9 1 6.308 79.2 1 K.EWLKEYEDETLRR.I * Jamie_Mitco_SPB_20.07179.07179.3 2.064 0.1749 91.6 1768.7344 1767.9359 5248.6 148 4.073 39.6 1 K.EWLKEYEDETLRR.I * Jamie_Mitco_SPB_11.03729.03729.2 2.4259 0.0234 98.7 1231.0322 1230.4069 4441.6 2 2.544 77.8 1 R.RIKEAEENLK.K * Jamie_Mitco_SPB_9.03184.03184.1 2.4497 0.111 100.0 1074.34 1074.2194 4688.9 19 3.619 68.8 1 R.IKEAEENLK.K * Jamie_Mitco_SPB_5.01653.01653.2 2.523 0.1027 99.5 1075.1921 1074.2194 5625.7 33 3.944 75.0 3 R.IKEAEENLK.K * Jamie_Mitco_SPB_12.04005.04005.2 3.5528 0.2811 100.0 1358.3322 1358.5809 6617.1 1 5.693 85.0 5 R.IKEAEENLKKR.I * Jamie_Mitco_SPB_12.04043.04043.3 2.7851 0.1458 99.0 1360.7043 1358.5809 3466.2 51 3.821 47.5 2 R.IKEAEENLKKR.I * Jamie_Mitco_SPB_13.04553.04553.2 2.8211 0.1174 99.7 1366.3922 1365.4857 5700.9 2 5.217 77.8 3 K.RKEELEEEFR.K * Jamie_Mitco_SPB_18.06141.06141.3 2.8736 0.143 99.6 1367.7244 1365.4857 6262.7 33 3.783 38.9 2 K.RKEELEEEFR.K * Jamie_Mitco_SPB_15.05199.05199.2 3.5526 0.18 100.0 1494.5521 1493.6598 4175.8 1 4.641 80.0 2 K.RKEELEEEFRK.K * Jamie_Mitco_SPB_14.04906.04906.3 3.4495 0.1927 100.0 1621.5543 1621.8339 6023.1 65 4.47 47.7 1 K.RKEELEEEFRKK.L * Jamie_Mitco_SPB_14.04897.04897.2 4.0362 0.1092 100.0 1623.0122 1621.8339 5918.1 1 4.498 77.3 3 K.RKEELEEEFRKK.L * Jamie_Mitco_SPB_14.04737.04737.3 2.7129 0.1624 99.3 1335.9844 1337.4723 7146.4 49 4.131 52.8 1 R.KEELEEEFRK.K * Jamie_Mitco_SPB_17.05901.05901.2 4.7095 0.3628 100.0 1678.5721 1678.9261 6839.2 1 6.978 85.7 1 K.KLKENAGSLTFLDNK.G * Jamie_Mitco_SPB_28.09772.09772.3 4.7121 0.3495 100.0 3267.0842 3267.487 9421.4 1 5.968 26.7 1 K.LKENAGSLTFLDNKGSGEDAEEELWNSPSK.G * Jamie_Mitco_SPB_30.10715.10715.3 4.3578 0.396 100.0 3346.8843 3347.487 4823.9 1 6.005 30.2 1 K.LKENAGSLTFLDNKGS*GEDAEEELWNSPSK.G * Jamie_Mitco_SPB_29.10099.10099.4 4.9995 0.309 100.0 4242.9766 4245.43 5355.7 6 5.33 18.0 1 K.LKENAGSLTFLDNKGSGEDAEEELWNS*PSKGNSERPSAV.A * Jamie_Mitco_SPB_30.10803.10803.4 5.1766 0.3051 100.0 4920.3765 4924.3057 7348.1 1 5.08 18.5 2 K.LKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQK.N * Jamie_Mitco_SPB_31.11109.11109.4 4.1213 0.2337 100.0 5002.2563 5004.3057 4233.9 11 4.841 16.3 1 K.LKENAGSLTFLDNKGSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N * Jamie_Mitco_SPB_31.10990.10990.3 2.9674 0.2706 100.0 5002.6743 5004.3057 3912.5 81 5.431 13.3 1 K.LKENAGSLTFLDNKGSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N * Jamie_Mitco_SPB_37.13157.13157.3 4.6848 0.3219 100.0 3186.1443 3186.1536 7607.3 30 6.806 24.1 1 K.ENAGSLTFLDNKGS*GEDAEEELWNS*PSK.G * Jamie_Mitco_SPB_18.06249.06249.1 2.4684 0.2835 100.0 1734.4 1735.7582 5579.4 5 5.681 43.3 1 K.GSGEDAEEELWNSPSK.G * Jamie_Mitco_SPB_17.06076.06076.2 4.7277 0.2474 100.0 1737.0721 1735.7582 8543.5 1 5.916 70.0 2 K.GSGEDAEEELWNSPSK.G * Jamie_Mitco_SPB_24.08467.08467.4 4.1264 0.1766 100.0 3395.8164 3392.5767 6608.7 1 4.322 25.3 1 K.GSGEDAEEELWNSPSKGNSERPSAVAGFINQK.N * Jamie_Mitco_SPB_16.05405.05405.2 2.8543 0.0551 99.2 1675.0721 1675.8418 6484.4 2 3.58 53.3 1 K.GNSERPSAVAGFINQK.N * Jamie_Mitco_SPB_22.07791.07791.3 4.3457 0.39 100.0 4407.2046 4407.813 7468.6 1 7.26 20.5 1 K.NLKPQEQLKNVKNDVSFNDSQSMVTNKENNIVDSSAAGNK.A * Jamie_Mitco_SPB_17.05949.05949.2 3.0044 0.2268 100.0 1686.7722 1686.7906 10313.5 1 5.039 60.7 2 K.NDVSFNDSQSMVTNK.E * Jamie_Mitco_SPB_11.03712.03712.2 3.0966 0.2409 100.0 1318.1122 1319.3708 6971.1 1 6.413 83.3 1 K.ENNIVDSSAAGNK.A * Jamie_Mitco_SPB_48.16953.16953.3 6.7364 0.559 100.0 4353.4146 4353.7944 7866.6 1 10.318 29.5 1 K.AIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLR.T * Jamie_Mitco_SPB_48.17031.17031.4 5.5431 0.3958 100.0 4355.2563 4353.7944 7774.3 1 6.761 21.8 1 K.AIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLR.T * Jamie_Mitco_SPB_18.06355.06355.2 3.6353 0.4008 100.0 1973.8722 1974.1405 6914.9 1 6.46 52.9 1 F.QNPFTASQSNINTNAPLR.T * Jamie_Mitco_SPB_13.04476.04476.2 2.6876 0.2503 96.6 1485.8922 1487.6127 6711.3 314 4.436 42.3 1 F.TASQSNINTNAPLR.T * Jamie_Mitco_SPB_16.05655.05655.2 2.8382 0.2593 100.0 1211.1522 1212.4319 7621.9 7 5.315 75.0 1 R.TLNIQPEVAVK.A * Jamie_Mitco_SPB_25.08853.08853.2 4.2802 0.4884 100.0 2053.0122 2054.1777 7515.0 1 8.692 60.5 4 K.AAINFSNVTDLTNNSTDGAK.I * Jamie_Mitco_SPB_25.08956.08956.2 3.7425 0.4704 100.0 1982.0922 1983.099 8709.4 2 7.422 44.4 1 A.AINFSNVTDLTNNSTDGAK.I * Jamie_Mitco_SPB_24.08469.08469.3 4.2113 0.2374 100.0 1984.5543 1983.099 6026.4 2 4.901 43.1 1 A.AINFSNVTDLTNNSTDGAK.I * Jamie_Mitco_SPB_8.02803.02803.1 1.9425 0.232 100.0 935.75 936.0501 4412.2 1 4.763 75.0 2 K.ITEIGSTSK.R * Jamie_Mitco_SPB_5.01563.01563.3 3.8651 0.3786 100.0 1618.7644 1618.741 7629.4 1 6.309 48.2 1 K.RPIESGTSSDPDTKK.V * Jamie_Mitco_SPB_1.00180.00180.2 2.1546 0.0579 95.2 1619.1322 1618.741 4504.0 9 3.466 50.0 1 K.RPIESGTSSDPDTKK.V YBR109C 12 13 74.1% 147 16135 4.3 U CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" * Jamie_Mitco_SPB_52.18414.18414.2 2.6028 0.3417 100.0 3159.9922 3161.378 9037.4 2 6.397 25.0 1 R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFS.E * Jamie_Mitco_SPB_65.23317.23317.3 4.4402 0.3902 100.0 4107.9546 4109.526 7741.1 1 6.777 25.0 1 R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q * Jamie_Mitco_SPB_24.08571.08571.2 2.8172 0.3171 100.0 1880.8121 1880.0618 5100.9 1 5.173 53.3 1 R.QLKSNDSEQELLEAFK.V * Jamie_Mitco_SPB_29.10086.10086.2 3.321 0.3642 100.0 1509.2322 1510.5975 7942.7 1 6.883 79.2 2 K.SNDSEQELLEAFK.V * Jamie_Mitco_SPB_28.09976.09976.1 2.48 0.1933 100.0 1509.37 1510.5975 6920.4 8 4.825 50.0 1 K.SNDSEQELLEAFK.V * Jamie_Mitco_SPB_49.17427.17427.3 4.5889 0.0883 99.6 3170.9343 3169.4692 8505.9 1 4.565 31.2 1 K.SNDSEQELLEAFKVFDKNGDGLISAAELK.H * Jamie_Mitco_SPB_20.06978.06978.2 2.654 0.2157 92.3 1578.8922 1578.7625 7789.2 1 4.491 60.7 1 V.FDKNGDGLISAAELK.H * Jamie_Mitco_SPB_33.11687.11687.3 3.5084 0.2748 100.0 2245.2844 2243.537 8053.4 1 5.679 34.2 1 K.HVLTSIGEKLTDAEVDDMLR.E * Jamie_Mitco_SPB_48.17157.17157.3 3.9315 0.2627 96.2 3471.8643 3472.803 7394.0 1 5.033 23.4 1 K.HVLTSIGEKLTDAEVDDMLREVSDGSGEINIQ.Q * Jamie_Mitco_SPB_61.21731.21731.3 2.6696 0.1576 94.1 4331.0044 4331.839 8500.8 167 3.551 17.3 1 K.HVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK.- * Jamie_Mitco_SPB_25.08739.08739.2 4.4912 0.2407 100.0 1794.3922 1792.999 8699.1 1 6.338 73.3 1 T.SIGEKLTDAEVDDMLR.E * Jamie_Mitco_SPB_51.18267.18267.3 4.5617 0.3881 100.0 3366.5645 3368.651 8671.6 1 6.641 30.0 1 T.SIGEKLTDAEVDDMLREVSDGSGEINIQQFA.A YDR356W 135 161 74.0% 944 111782 7.1 U SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" * Jamie_Mitco_SPB_34.12015.12015.1 1.8398 0.0528 98.4 1363.39 1363.528 4024.5 37 3.021 55.0 1 K.NMEFT*PVGFIK.S * Jamie_Mitco_SPB_34.12039.12039.2 3.1154 0.1863 100.0 1363.7722 1363.528 6953.1 1 5.277 75.0 1 K.NMEFT*PVGFIK.S * Jamie_Mitco_SPB_9.03022.03022.2 3.0538 0.3889 100.0 1383.5122 1384.4429 5430.4 1 6.346 72.7 2 R.NTTQTQVVS*PTK.V * Jamie_Mitco_SPB_13.04482.04482.2 1.7613 0.0938 92.7 3123.4922 3124.3945 5429.2 1 3.75 28.6 1 R.NTTQTQVVSPTKVPNANNGDENEGPVKKR.Q * Jamie_Mitco_SPB_9.02895.02895.2 2.6237 0.1361 99.5 1684.4321 1682.7875 6609.5 5 4.003 50.0 1 K.VPNANNGDENEGPVKK.R * Jamie_Mitco_SPB_47.16569.16569.3 3.616 0.302 100.0 2966.0645 2965.1536 8348.0 2 5.465 28.0 1 R.SIDDTIDSTRLFSEASQFDDSFPEIK.A * Jamie_Mitco_SPB_34.11940.11940.2 3.373 0.3139 100.0 2167.2722 2168.281 4156.7 1 5.715 50.0 1 T.RLFSEASQFDDS*FPEIKA.N * Jamie_Mitco_SPB_33.11793.11793.2 4.9111 0.4558 100.0 1860.3121 1861.0148 8382.6 1 8.38 80.0 1 R.LFSEASQFDDSFPEIK.A * Jamie_Mitco_SPB_38.13372.13372.2 3.6898 0.1881 100.0 1942.4922 1941.0148 7097.6 1 5.433 66.7 2 R.LFSEASQFDDS*FPEIK.A * Jamie_Mitco_SPB_10.03315.03315.2 1.9898 0.1324 99.6 931.3522 931.981 2794.6 221 4.149 64.3 2 K.ANIPPS*PR.S * Jamie_Mitco_SPB_31.10974.10974.3 4.19 0.2133 100.0 2880.1743 2881.3635 8273.0 17 4.967 27.2 1 R.KRNLIDDLKKDVPMSQPLKEQEVR.E * Jamie_Mitco_SPB_31.10829.10829.2 2.6117 0.0592 99.2 2596.912 2597.002 10007.8 1 3.554 38.1 1 R.NLIDDLKKDVPMSQPLKEQEVR.E * Jamie_Mitco_SPB_31.10984.10984.3 6.1709 0.3022 100.0 2598.0244 2597.002 9090.1 1 6.737 40.5 1 R.NLIDDLKKDVPMSQPLKEQEVR.E * Jamie_Mitco_SPB_31.10860.10860.2 2.2326 0.2332 97.0 999.3122 999.15515 4053.3 1 4.681 78.6 1 Q.PLKEQEVR.E * Jamie_Mitco_SPB_18.06456.06456.2 1.6484 0.087 91.0 1381.9122 1381.6615 5888.7 88 3.223 50.0 1 K.SLKHEIKELRK.E * Jamie_Mitco_SPB_19.06693.06693.3 3.5071 0.1792 100.0 1382.2144 1381.6615 4665.9 4 3.829 50.0 1 K.SLKHEIKELRK.E * Jamie_Mitco_SPB_19.06739.06739.2 2.5397 0.3515 100.0 2797.6921 2798.934 5449.7 1 7.146 38.6 1 R.KEKNDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_19.06731.06731.3 5.0967 0.259 100.0 2800.6143 2798.934 8477.8 1 5.803 40.9 1 R.KEKNDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_23.07974.07974.2 3.3862 0.3192 100.0 2399.892 2400.4688 5868.3 2 6.223 39.5 1 K.EKNDTLNNYDTLEEETDDLK.N * Jamie_Mitco_SPB_19.06815.06815.2 3.4784 0.3935 100.0 2669.7722 2670.76 3776.4 1 7.158 50.0 2 K.EKNDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_20.06987.06987.4 3.3519 0.1079 95.8 2671.5366 2670.76 6710.3 30 3.212 26.2 1 K.EKNDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_20.06869.06869.3 4.5621 0.3375 100.0 2672.5745 2670.76 5728.6 1 5.86 39.3 1 K.EKNDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_48.17049.17049.4 5.2546 0.1809 100.0 3911.2166 3910.1943 8927.4 41 4.601 19.8 2 K.EKNDTLNNYDTLEEETDDLKNRLQALEKELDAK.N * Jamie_Mitco_SPB_48.17218.17218.3 5.0886 0.2348 100.0 3911.5144 3910.1943 7346.8 8 4.984 23.4 1 K.EKNDTLNNYDTLEEETDDLKNRLQALEKELDAK.N * Jamie_Mitco_SPB_24.08610.08610.2 3.5058 0.4058 100.0 2141.4321 2143.1792 7671.3 1 7.801 67.6 6 K.NDTLNNYDTLEEETDDLK.N * Jamie_Mitco_SPB_22.07696.07696.2 4.578 0.4006 100.0 2414.4722 2413.4705 8035.3 1 6.933 50.0 2 K.NDTLNNYDTLEEETDDLKNR.L * Jamie_Mitco_SPB_50.17896.17896.4 3.5138 0.1009 95.6 3655.1765 3652.9048 6792.2 2 3.451 24.4 1 K.NDTLNNYDTLEEETDDLKNRLQALEKELDAK.N * Jamie_Mitco_SPB_14.05037.05037.3 2.6735 0.067 91.2 1259.7244 1258.4575 4663.1 4 3.581 55.0 1 R.LQALEKELDAK.N * Jamie_Mitco_SPB_14.04708.04708.2 3.0238 0.1238 99.7 1501.7522 1500.7355 6498.9 3 3.682 66.7 1 R.LQALEKELDAKNK.I * Jamie_Mitco_SPB_16.05745.05745.4 3.4549 0.2962 100.0 2070.4165 2070.397 4144.0 1 5.92 37.3 1 R.LQALEKELDAKNKIVNSR.K * Jamie_Mitco_SPB_17.05884.05884.3 2.7013 0.115 91.6 2073.1143 2070.397 6772.4 1 4.225 36.8 1 R.LQALEKELDAKNKIVNSR.K * Jamie_Mitco_SPB_1.00183.00183.2 3.423 0.4081 100.0 1444.9321 1445.495 5730.4 1 7.112 77.3 3 R.KVDDHSGCIEER.E * Jamie_Mitco_SPB_11.03747.03747.3 2.8507 0.1508 99.3 1445.1543 1445.495 6228.0 242 4.581 36.4 1 R.KVDDHSGCIEER.E * Jamie_Mitco_SPB_122.43805.43805.3 3.002 0.3098 100.0 2117.3342 2119.2366 7149.3 1 5.682 40.6 1 R.KVDDHSGCIEEREQMER.K * Jamie_Mitco_SPB_17.06054.06054.4 2.7738 0.1092 92.2 2123.1765 2119.2366 5733.2 3 3.208 37.5 1 R.KVDDHSGCIEEREQMER.K * Jamie_Mitco_SPB_11.03867.03867.2 2.5573 0.0825 99.5 859.6922 859.0134 3736.2 1 3.656 91.7 1 R.KLAELER.K * Jamie_Mitco_SPB_24.08620.08620.2 2.317 0.0764 98.7 2160.2722 2160.3862 9111.6 81 3.194 33.3 1 K.TVKDQVLELENNSDVQSLK.L * Jamie_Mitco_SPB_23.08025.08025.2 3.8946 0.2381 100.0 1831.3922 1831.9744 7250.6 1 5.98 60.0 2 K.DQVLELENNSDVQSLK.L * Jamie_Mitco_SPB_39.13816.13816.2 5.453 0.284 100.0 2048.7722 2048.316 10469.5 1 6.489 68.8 1 R.SKEDELKNLMNELNELK.S * Jamie_Mitco_SPB_39.13895.13895.3 4.9679 0.1572 100.0 2050.8245 2048.316 6490.0 1 4.574 48.4 2 R.SKEDELKNLMNELNELK.S * Jamie_Mitco_SPB_42.15051.15051.4 5.9977 0.4008 100.0 3568.9365 3568.932 8802.1 1 6.331 25.9 2 R.SKEDELKNLMNELNELKSNAEEKDTQLEFK.K * Jamie_Mitco_SPB_39.13815.13815.3 4.5196 0.3474 100.0 4207.8843 4209.6724 7320.7 1 6.77 25.7 1 R.SKEDELKNLMNELNELKSNAEEKDTQLEFKKNELR.K * Jamie_Mitco_SPB_39.13896.13896.4 6.5927 0.47 100.0 4208.6963 4209.6724 8578.2 1 7.179 24.5 1 R.SKEDELKNLMNELNELKSNAEEKDTQLEFKKNELR.K * Jamie_Mitco_SPB_27.09621.09621.2 1.7319 0.1382 97.6 1218.1522 1218.4106 5308.2 54 3.551 61.1 1 K.NLMNELNELK.S * Jamie_Mitco_SPB_35.12358.12358.3 5.1818 0.2465 100.0 2739.1743 2739.0266 7070.9 1 6.318 39.8 1 K.NLMNELNELKSNAEEKDTQLEFK.K * Jamie_Mitco_SPB_13.04659.04659.2 3.0776 0.2624 100.0 1539.0721 1539.639 9980.2 1 5.259 70.8 1 K.SNAEEKDTQLEFK.K * Jamie_Mitco_SPB_14.04893.04893.2 2.1991 0.0697 99.2 882.09216 880.9732 4090.3 5 3.663 91.7 1 K.DTQLEFK.K * Jamie_Mitco_SPB_14.04842.04842.2 2.5493 0.1224 99.5 1520.8922 1521.7135 5281.7 52 3.957 54.5 1 K.DTQLEFKKNELR.K * Jamie_Mitco_SPB_25.08937.08937.3 4.5926 0.2965 100.0 2262.0244 2262.5806 8272.5 1 5.608 40.3 1 R.TNELNELKIKSDEMDLQLK.Q * Jamie_Mitco_SPB_16.05507.05507.1 1.9885 0.1008 100.0 1078.2 1079.2103 7391.2 15 4.354 62.5 1 K.SDEMDLQLK.Q * Jamie_Mitco_SPB_16.05482.05482.2 2.7236 0.2288 100.0 1080.4722 1079.2103 7668.8 6 4.769 87.5 1 K.SDEMDLQLK.Q * Jamie_Mitco_SPB_16.05763.05763.2 3.029 0.1116 99.7 1489.8922 1488.6812 8338.1 1 3.299 77.3 1 K.RLKDELNELETK.F * Jamie_Mitco_SPB_16.05710.05710.3 3.5931 0.1741 100.0 1490.2444 1488.6812 6921.3 6 4.026 50.0 1 K.RLKDELNELETK.F * Jamie_Mitco_SPB_28.09931.09931.3 4.0564 0.2876 100.0 3224.7544 3225.4937 8833.6 132 5.09 22.2 1 K.RLKDELNELETKFSENGSQSSAKENELK.M * Jamie_Mitco_SPB_24.08289.08289.3 3.9689 0.0262 91.6 3069.4443 3069.3062 7828.3 1 4.11 32.7 1 R.LKDELNELETKFSENGSQSSAKENELK.M * Jamie_Mitco_SPB_23.08139.08139.4 4.5098 0.167 100.0 3072.3765 3069.3062 3896.4 1 3.772 26.9 1 R.LKDELNELETKFSENGSQSSAKENELK.M * Jamie_Mitco_SPB_8.02836.02836.2 2.8362 0.2232 100.0 1755.6322 1755.8357 5437.2 3 4.941 53.3 2 K.FSENGSQSSAKENELK.M * Jamie_Mitco_SPB_22.07612.07612.1 2.5264 0.3027 100.0 1504.44 1504.6775 6000.0 1 5.717 50.0 1 K.NKIAELEEEISTK.N * Jamie_Mitco_SPB_21.07497.07497.2 3.627 0.2039 100.0 1505.2322 1504.6775 6251.2 1 5.36 83.3 2 K.NKIAELEEEISTK.N * Jamie_Mitco_SPB_27.09695.09695.2 2.2522 0.0772 97.8 2257.892 2259.562 7846.5 27 3.919 31.6 1 K.NKIAELEEEISTKNSQLIAK.E * Jamie_Mitco_SPB_27.09509.09509.3 4.6678 0.3006 100.0 2262.1143 2259.562 4376.2 1 5.521 40.8 1 K.NKIAELEEEISTKNSQLIAK.E * Jamie_Mitco_SPB_27.09417.09417.4 4.2006 0.2557 100.0 2574.2566 2573.9036 7758.7 27 5.508 28.8 1 K.NKIAELEEEISTKNSQLIAKEGK.L * Jamie_Mitco_SPB_26.09359.09359.3 3.0354 0.131 95.3 2575.3442 2573.9036 8624.3 411 3.655 22.7 1 K.NKIAELEEEISTKNSQLIAKEGK.L * Jamie_Mitco_SPB_16.05595.05595.2 4.2271 0.3306 100.0 1262.8922 1262.3997 8109.7 2 6.419 90.0 1 K.IAELEEEISTK.N * Jamie_Mitco_SPB_5.01517.01517.2 2.6027 0.1362 99.7 1087.9722 1088.2493 4593.0 1 4.43 72.2 1 K.NSQLIAKEGK.L * Jamie_Mitco_SPB_5.01467.01467.1 1.8169 0.085 100.0 1088.19 1088.2493 4158.6 1 4.326 66.7 1 K.NSQLIAKEGK.L * Jamie_Mitco_SPB_45.16147.16147.2 2.8382 0.1807 99.7 2360.2922 2359.7466 6752.2 1 4.292 37.5 1 K.EGKLASLMAQLTQLESKLNQR.D * Jamie_Mitco_SPB_36.12766.12766.2 3.8729 0.2613 100.0 1534.4122 1533.8236 9274.0 1 5.795 76.9 1 K.LASLMAQLTQLESK.L * Jamie_Mitco_SPB_43.15453.15453.2 4.0539 0.2311 100.0 2046.5721 2045.4052 9650.6 1 5.371 52.9 1 K.LASLMAQLTQLESKLNQR.D * Jamie_Mitco_SPB_13.04441.04441.1 2.4133 0.2781 100.0 1390.51 1391.4778 4049.4 8 5.589 54.5 1 R.DSQLGSREEELK.K * Jamie_Mitco_SPB_12.04215.04215.2 3.3634 0.1348 99.7 1520.8722 1519.6519 6486.7 8 3.542 70.8 1 R.DSQLGSREEELKK.T * Jamie_Mitco_SPB_4.01422.01422.2 2.8566 0.1172 99.7 1231.9122 1231.3945 4944.3 17 3.658 77.8 1 K.TNDKLQKDIR.I * Jamie_Mitco_SPB_8.02751.02751.2 1.949 0.0363 91.4 1430.9922 1433.5614 4327.5 5 3.531 63.6 1 R.IAREETVSKDER.I * Jamie_Mitco_SPB_8.02782.02782.3 3.4948 0.1642 100.0 1433.3344 1433.5614 3684.9 3 5.549 50.0 1 R.IAREETVSKDER.I * Jamie_Mitco_SPB_21.07531.07531.2 3.4275 0.3248 100.0 1446.4922 1446.73 8981.9 1 6.393 77.3 1 K.VKQLENDLFVIK.K * Jamie_Mitco_SPB_12.04234.04234.2 3.8187 0.4627 100.0 1819.4521 1819.92 3748.3 1 8.125 60.0 1 K.THSESKTITDNELESK.D * Jamie_Mitco_SPB_15.05239.05239.2 1.8501 0.2735 99.5 2415.7122 2417.6758 7105.2 7 5.437 35.0 1 K.THSESKTITDNELESKDKLIK.I * Jamie_Mitco_SPB_15.05367.05367.2 4.0148 0.3432 100.0 1778.6721 1779.0435 4779.2 1 6.095 71.4 1 K.ILENDLKVAQEKYSK.M * Jamie_Mitco_SPB_19.06592.06592.2 2.7868 0.2691 100.0 2166.2122 2167.5256 6623.6 1 5.658 47.1 1 K.ILENDLKVAQEKYSKMEK.E * Jamie_Mitco_SPB_3.00953.00953.2 2.5108 0.0902 99.5 1064.3522 1063.2573 8019.6 17 3.964 78.6 2 K.MEKELKER.E * Jamie_Mitco_SPB_22.07893.07893.3 3.5849 0.048 92.0 2547.7744 2546.7905 7995.3 1 3.784 37.5 1 R.EFNYKISESKLEDEKTTLNEK.I * Jamie_Mitco_SPB_26.09118.09118.4 4.758 0.3762 100.0 3134.4966 3134.465 7480.2 1 5.335 24.1 1 K.ISESKLEDEKTTLNEKISNLAAENSQLK.N * Jamie_Mitco_SPB_14.04827.04827.2 3.1789 0.2233 100.0 1288.2322 1288.4435 8095.7 1 4.778 81.8 1 K.ISNLAAENSQLK.N * Jamie_Mitco_SPB_4.01443.01443.2 3.5737 0.2927 100.0 1626.2522 1626.7844 6375.1 1 5.783 69.2 2 K.NKIEDNSTATHHMK.E * Jamie_Mitco_SPB_13.04445.04445.2 3.6654 0.3181 100.0 2289.7122 2290.4692 7672.4 1 5.965 50.0 1 K.NKIEDNSTATHHMKENYEK.Q * Jamie_Mitco_SPB_36.12701.12701.3 3.0505 0.1612 97.2 3521.6943 3523.9194 6625.7 31 3.756 22.3 1 K.QLESLRKDIEEYKESAKDSEDKIEELKIR.I * Jamie_Mitco_SPB_36.12849.12849.4 4.3119 0.171 100.0 3521.9766 3523.9194 7551.0 119 4.51 21.4 1 K.QLESLRKDIEEYKESAKDSEDKIEELKIR.I * Jamie_Mitco_SPB_11.03954.03954.2 1.8387 0.1467 99.2 1210.4321 1212.2988 6319.9 31 4.1 77.8 1 K.DIEEYKESAK.D * Jamie_Mitco_SPB_10.03378.03378.1 1.7322 0.1366 100.0 1211.94 1212.2988 6417.9 127 4.178 50.0 1 K.DIEEYKESAK.D * Jamie_Mitco_SPB_22.07714.07714.4 3.0641 0.1717 99.0 2665.2566 2668.9146 6955.7 75 4.601 26.2 1 K.DIEEYKESAKDSEDKIEELKIR.I * Jamie_Mitco_SPB_22.07763.07763.3 6.2231 0.4051 100.0 2669.5144 2668.9146 11165.9 1 7.437 38.1 1 K.DIEEYKESAKDSEDKIEELKIR.I * Jamie_Mitco_SPB_17.05817.05817.2 4.079 0.4316 100.0 2230.6921 2232.496 8999.4 1 7.596 63.9 1 R.SKDIKQKDEQISDLTQNLK.L * Jamie_Mitco_SPB_16.05763.05763.3 4.803 0.3228 100.0 2234.3342 2232.496 8338.1 1 6.176 44.4 1 R.SKDIKQKDEQISDLTQNLK.L * Jamie_Mitco_SPB_17.05765.05765.2 3.2928 0.2444 100.0 1661.6921 1660.8217 2638.5 1 4.722 73.1 1 K.QKDEQISDLTQNLK.L * Jamie_Mitco_SPB_21.07279.07279.1 2.109 0.0668 100.0 1404.82 1404.5168 5555.0 17 3.887 50.0 1 K.DEQISDLTQNLK.L * Jamie_Mitco_SPB_21.07252.07252.2 3.4936 0.2287 100.0 1404.9122 1404.5168 7792.4 1 5.021 81.8 1 K.DEQISDLTQNLK.L * Jamie_Mitco_SPB_37.13231.13231.2 2.2571 0.1966 99.5 2546.9321 2547.776 6354.4 1 4.295 38.1 1 K.DEQISDLTQNLKLQEDEISSLK.S * Jamie_Mitco_SPB_28.10023.10023.2 4.1035 0.3419 100.0 1747.2922 1746.9554 7754.5 1 7.142 75.0 1 K.LQEDEISSLKSIIDR.Y * Jamie_Mitco_SPB_24.08352.08352.2 2.5335 0.0631 99.2 1767.9722 1769.0537 5061.0 228 3.131 42.3 1 K.SIIDRYKKDFNQLK.S * Jamie_Mitco_SPB_50.17871.17871.4 5.7959 0.3407 100.0 4102.2163 4101.609 9144.3 1 5.066 22.7 1 K.SIIDRYKKDFNQLKSEQSNIQHDLNLQILNLENK.L * Jamie_Mitco_SPB_38.13678.13678.4 4.1584 0.2632 100.0 3514.8564 3516.9358 9340.6 207 4.87 18.5 1 R.YKKDFNQLKSEQSNIQHDLNLQILNLENK.L * Jamie_Mitco_SPB_41.14553.14553.2 4.2555 0.346 100.0 2498.872 2498.7551 8846.0 1 6.343 37.5 1 K.DFNQLKSEQSNIQHDLNLQIL.N * Jamie_Mitco_SPB_43.15363.15363.3 4.4508 0.2059 100.0 3098.9644 3097.4116 10633.4 1 4.556 29.0 1 K.DFNQLKSEQSNIQHDLNLQILNLENK.L * Jamie_Mitco_SPB_57.20356.20356.4 6.0764 0.388 100.0 4153.6963 4154.577 9614.4 1 6.341 25.0 1 K.DFNQLKSEQSNIQHDLNLQILNLENKLIESEDELK.S * Jamie_Mitco_SPB_57.20460.20460.3 5.4175 0.3076 100.0 4155.2046 4154.577 10012.3 1 6.138 27.2 1 K.DFNQLKSEQSNIQHDLNLQILNLENKLIESEDELK.S * Jamie_Mitco_SPB_56.19896.19896.4 4.4483 0.1944 100.0 4968.177 4969.474 9751.5 1 3.94 17.5 1 K.DFNQLKSEQSNIQHDLNLQILNLENKLIESEDELKSLRDSQK.I * Jamie_Mitco_SPB_34.11938.11938.2 6.07 0.3951 100.0 2351.372 2351.5786 9925.0 1 7.417 57.9 1 K.SEQSNIQHDLNLQILNLENK.L * Jamie_Mitco_SPB_34.11991.11991.3 3.2522 0.1017 95.3 2351.6643 2351.5786 6806.9 17 3.36 34.2 1 K.SEQSNIQHDLNLQILNLENK.L * Jamie_Mitco_SPB_54.19146.19146.3 3.1024 0.158 97.2 3409.1643 3408.7441 5600.6 27 3.175 24.1 1 K.SEQSNIQHDLNLQILNLENKLIESEDELK.S * Jamie_Mitco_SPB_57.20335.20335.4 4.6973 0.2361 100.0 3766.2166 3765.1692 8779.9 77 4.216 19.9 1 K.SEQSNIQHDLNLQILNLENKLIESEDELKSLR.D * Jamie_Mitco_SPB_35.12310.12310.2 3.2024 0.3362 100.0 1874.0721 1875.0831 6609.4 1 5.844 53.3 1 L.NLENKLIESEDELKSL.R * Jamie_Mitco_SPB_30.10452.10452.2 4.9119 0.327 100.0 2031.1322 2031.2706 7440.2 1 6.624 68.8 1 L.NLENKLIESEDELKSLR.D * Jamie_Mitco_SPB_29.10389.10389.3 5.3385 0.2817 100.0 2033.0343 2031.2706 8100.9 1 5.787 51.6 1 L.NLENKLIESEDELKSLR.D * Jamie_Mitco_SPB_37.13086.13086.4 6.2983 0.4091 100.0 3405.8965 3402.7832 9872.9 1 6.815 29.6 2 L.NLENKLIESEDELKSLRDSQKIEIENWK.R * Jamie_Mitco_SPB_16.05572.05572.2 3.5056 0.279 100.0 1433.6522 1432.614 7589.5 1 5.392 86.4 1 K.LIESEDELKSLR.D * Jamie_Mitco_SPB_15.05355.05355.3 2.8674 0.2869 100.0 1889.1244 1891.0856 3730.2 8 4.561 40.0 1 K.LIESEDELKSLRDSQK.I * Jamie_Mitco_SPB_27.09394.09394.3 5.53 0.2679 100.0 2805.8943 2804.1265 8530.2 1 5.872 37.5 1 K.LIESEDELKSLRDSQKIEIENWK.R * Jamie_Mitco_SPB_16.05691.05691.3 2.6508 0.0784 91.5 1390.1344 1390.5358 5361.1 6 3.308 47.5 1 R.DSQKIEIENWK.R * Jamie_Mitco_SPB_17.05809.05809.3 3.4391 0.2902 100.0 2852.3643 2854.1033 8437.4 37 4.803 25.0 1 R.KYNNLSLENDRLLTEKESASDKER.E * Jamie_Mitco_SPB_25.08767.08767.4 3.7893 0.2496 100.0 3552.9365 3551.8926 6637.3 1 4.75 22.4 1 K.YNNLSLENDRLLTEKESASDKEREISILNR.K * Jamie_Mitco_SPB_16.05513.05513.2 3.4361 0.3488 100.0 2020.6522 2022.2806 5700.2 1 6.128 56.7 1 R.KLDEMDKEKWNLQESK.E * Jamie_Mitco_SPB_16.05409.05409.3 3.6471 0.222 100.0 2024.7544 2022.2806 7257.3 9 4.667 40.0 1 R.KLDEMDKEKWNLQESK.E * Jamie_Mitco_SPB_16.05415.05415.3 4.5458 0.2516 100.0 2280.4443 2279.57 6629.2 1 5.502 48.5 2 R.KLDEMDKEKWNLQESKEK.Y * Jamie_Mitco_SPB_12.04261.04261.2 3.6683 0.1656 100.0 1747.3322 1745.8467 4826.7 1 4.079 76.9 1 R.REKEELNENSNNIR.I * Jamie_Mitco_SPB_11.03873.03873.2 3.597 0.3895 100.0 1588.2322 1589.6592 3782.7 1 7.031 83.3 3 R.EKEELNENSNNIR.I * Jamie_Mitco_SPB_12.04023.04023.1 1.617 0.069 98.4 1589.48 1589.6592 2691.1 2 3.357 50.0 1 R.EKEELNENSNNIR.I * Jamie_Mitco_SPB_11.03771.03771.3 2.9548 0.0945 95.3 1592.1543 1589.6592 5211.3 6 3.453 43.8 2 R.EKEELNENSNNIR.I * Jamie_Mitco_SPB_23.07980.07980.2 2.5832 0.0147 96.4 2065.3123 2066.3188 8054.0 1 3.745 46.9 1 R.IKKNYLSEITSLQEENR.R * Jamie_Mitco_SPB_28.09989.09989.3 4.6682 0.3384 100.0 2206.8542 2205.4473 8691.7 1 5.564 45.6 1 R.RKDNDSTMQLNDIISYYK.L * Jamie_Mitco_SPB_30.10709.10709.2 3.3462 0.0064 99.2 2050.392 2049.2598 7072.8 1 3.172 65.6 1 R.KDNDSTMQLNDIISYYK.L * Jamie_Mitco_SPB_38.13491.13491.2 3.588 0.4319 100.0 1919.5922 1921.0858 8483.0 1 8.823 66.7 1 K.DNDSTMQLNDIISYYK.L * Jamie_Mitco_SPB_20.07125.07125.2 5.287 0.5181 100.0 2053.3323 2054.1777 8614.5 1 9.157 76.5 1 R.KGEHSLNISLPDDDELDR.D * Jamie_Mitco_SPB_27.09414.09414.3 4.4227 0.5085 100.0 3350.0044 3353.5425 11097.3 1 8.63 31.5 2 R.KGEHSLNISLPDDDELDRDYYNSHVYTR.Y * Jamie_Mitco_SPB_27.09489.09489.4 6.8306 0.35 100.0 3351.9365 3353.5425 4694.2 1 6.586 35.8 1 R.KGEHSLNISLPDDDELDRDYYNSHVYTR.Y * Jamie_Mitco_SPB_13.04655.04655.1 1.8731 0.2843 100.0 1317.28 1318.388 4277.7 1 5.757 61.1 1 R.DYYNSHVYTR.Y YNL225C 50 61 66.3% 581 67400 6.0 U CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" * Jamie_Mitco_SPB_35.12363.12363.2 2.5872 0.268 100.0 1668.6921 1669.8517 8195.7 1 5.47 62.5 1 M.TDFDLMNFPFHER.L * Jamie_Mitco_SPB_31.10941.10941.3 4.9121 0.4487 100.0 3377.3342 3377.4758 3914.7 1 6.963 31.2 1 R.LDS*PVS*ENGEIKDGEPIPQNWLNENHVGK.S * Jamie_Mitco_SPB_50.17793.17793.2 4.0972 0.2606 100.0 2420.9521 2420.6936 9688.4 1 5.846 47.5 2 K.SILPLFVNPEDVINCNFSNAR.D * Jamie_Mitco_SPB_55.19761.19761.2 4.7459 0.4246 100.0 2500.0122 2500.6936 6670.3 1 6.983 57.5 2 K.SILPLFVNPEDVINCNFS*NAR.D * Jamie_Mitco_SPB_30.10533.10533.2 3.6662 0.1438 96.8 1897.6721 1897.0203 8482.6 1 4.596 63.3 1 L.FVNPEDVINCNFSNAR.D * Jamie_Mitco_SPB_15.05121.05121.3 5.0904 0.4241 100.0 2164.7944 2166.2983 9782.5 1 7.433 44.1 1 R.DSYEENKSPSMDQMNYAR.N * Jamie_Mitco_SPB_15.05116.05116.2 3.5749 0.3476 100.0 2165.2322 2166.2983 6455.3 1 6.499 55.9 1 R.DSYEENKSPSMDQMNYAR.N * Jamie_Mitco_SPB_15.05313.05313.2 2.3379 0.0835 99.2 1381.6122 1380.4468 6691.4 2 3.742 65.0 1 K.SPS*MDQMNYAR.N * Jamie_Mitco_SPB_13.04326.04326.2 3.2781 0.4105 100.0 1734.3722 1734.8632 6100.4 1 6.844 67.9 1 R.NTSYQESPGLQERPK.N * Jamie_Mitco_SPB_13.04509.04509.3 2.068 0.2075 94.3 1815.5944 1814.8632 5007.4 90 4.537 39.3 1 R.NTS*YQESPGLQERPK.N * Jamie_Mitco_SPB_6.01833.01833.2 2.4897 0.1273 99.6 1695.9521 1696.901 6610.0 10 4.158 53.6 1 K.NEKDKSPIGTDVHKK.D * Jamie_Mitco_SPB_7.02278.02278.2 2.7129 0.2674 100.0 1197.5322 1197.3335 5435.8 30 5.168 65.0 1 K.DKSPIGTDVHK.K * Jamie_Mitco_SPB_1.00014.00014.2 2.833 0.2972 100.0 1276.9122 1277.3335 4097.5 2 5.118 70.0 2 K.DKS*PIGTDVHK.K * Jamie_Mitco_SPB_1.00008.00008.3 2.5977 0.1484 96.6 1405.6444 1405.5076 6789.0 5 4.001 47.7 1 K.DKS*PIGTDVHKK.D * Jamie_Mitco_SPB_16.05445.05445.1 2.2221 0.1454 100.0 1282.47 1283.4294 3856.1 8 5.105 60.0 1 K.DVPNFIHSTPR.E * Jamie_Mitco_SPB_17.05890.05890.1 1.4681 0.1288 100.0 1362.44 1363.4294 2641.5 328 4.069 45.0 1 K.DVPNFIHST*PR.E * Jamie_Mitco_SPB_14.04918.04918.3 3.6407 0.2327 100.0 2885.3643 2886.9226 7649.9 1 4.595 27.9 1 R.ANEQASAQPTDEHTSPDISIEDCNGAK.I * Jamie_Mitco_SPB_20.06951.06951.3 3.1553 0.3376 100.0 1599.2344 1597.8113 3317.8 4 7.435 45.8 1 K.IFLQNSLSKEDFR.M * Jamie_Mitco_SPB_17.05831.05831.2 3.2678 0.1126 92.5 1334.5721 1332.4967 4343.2 1 3.821 81.8 1 A.NSLQKELEAATK.S * Jamie_Mitco_SPB_25.08967.08967.3 5.5364 0.35 100.0 2801.1843 2803.1826 7222.2 1 7.395 33.7 1 K.SNDKTLDNKKKIEEQTVLIENLTK.D * Jamie_Mitco_SPB_21.07560.07560.2 4.7431 0.1921 100.0 1787.7722 1787.1069 9193.8 1 6.333 78.6 4 K.KKIEEQTVLIENLTK.D * Jamie_Mitco_SPB_40.14362.14362.4 3.6611 0.1173 97.5 3089.5764 3088.6277 8404.6 9 3.46 24.7 1 K.KKIEEQTVLIENLTKDLSLNKEMLEK.A * Jamie_Mitco_SPB_21.07455.07455.2 4.1728 0.2494 100.0 1658.6122 1658.9329 8400.3 1 5.967 80.8 1 K.KIEEQTVLIENLTK.D * Jamie_Mitco_SPB_40.14326.14326.4 5.0561 0.2398 100.0 2961.0166 2960.4536 11138.8 1 5.035 31.9 1 K.KIEEQTVLIENLTKDLSLNKEMLEK.A * Jamie_Mitco_SPB_26.09345.09345.2 4.3002 0.1909 100.0 1531.0922 1530.7588 7567.5 1 5.888 87.5 1 K.IEEQTVLIENLTK.D * Jamie_Mitco_SPB_45.16095.16095.4 3.5797 0.1088 96.4 3702.9766 3704.225 6486.4 28 3.624 20.4 1 K.IEEQTVLIENLTKDLSLNKEMLEKANDTIQTK.H * Jamie_Mitco_SPB_22.07845.07845.3 4.6588 0.2951 100.0 2191.2544 2192.4895 10370.7 1 6.549 37.5 2 K.DLSLNKEMLEKANDTIQTK.H * Jamie_Mitco_SPB_22.07786.07786.1 2.7529 0.2581 100.0 1326.55 1327.5236 4083.1 1 5.938 68.2 1 K.HTALLSLTDSLR.K * Jamie_Mitco_SPB_23.08062.08062.2 2.7179 0.3303 100.0 1326.7322 1327.5236 3299.4 1 7.232 77.3 1 K.HTALLSLTDSLR.K * Jamie_Mitco_SPB_66.23554.23554.2 4.3074 0.4726 100.0 2904.1921 2906.2585 9031.8 1 8.38 50.0 2 R.KAELFEIPIGILFFDLYDSEENSSK.L * Jamie_Mitco_SPB_67.23920.23920.3 5.7546 0.2497 100.0 2907.3542 2906.2585 10329.1 1 7.346 34.4 2 R.KAELFEIPIGILFFDLYDSEENSSK.L * Jamie_Mitco_SPB_64.22977.22977.4 4.8069 0.2583 100.0 3884.8564 3883.387 8948.4 1 4.938 24.5 2 R.KAELFEIPIGILFFDLYDSEENSSKLDHILQEK.Y * Jamie_Mitco_SPB_61.21732.21732.4 7.4616 0.4698 100.0 4498.177 4499.1167 9537.8 1 8.532 22.5 1 R.KAELFEIPIGILFFDLYDSEENSSKLDHILQEKYPNIK.G * Jamie_Mitco_SPB_74.26393.26393.2 3.4919 0.3393 100.0 2777.9722 2778.0845 12134.9 1 6.178 34.8 1 K.AELFEIPIGILFFDLYDSEENSSK.L * Jamie_Mitco_SPB_17.05826.05826.1 2.4408 0.3094 100.0 1524.49 1525.6245 3900.7 1 6.649 62.5 1 K.GFLCASQQEELSR.I * Jamie_Mitco_SPB_22.07569.07569.4 3.0832 0.1775 99.6 2118.7366 2120.327 3930.9 1 3.901 40.2 1 R.FKNAKAEAEDLRNELENK.K * Jamie_Mitco_SPB_22.07744.07744.3 2.9989 0.1588 98.7 2119.3743 2120.327 7342.1 1 4.127 39.7 1 R.FKNAKAEAEDLRNELENK.K * Jamie_Mitco_SPB_30.10750.10750.3 5.2365 0.3748 100.0 3118.5244 3120.551 5951.5 1 6.544 34.0 1 R.FKNAKAEAEDLRNELENKKIEIQTMR.E * Jamie_Mitco_SPB_15.05229.05229.2 3.7664 0.2108 100.0 1531.0122 1531.6195 6594.5 1 4.941 75.0 1 K.AEAEDLRNELENK.K * Jamie_Mitco_SPB_15.05157.05157.3 2.9848 0.2716 100.0 1532.8444 1531.6195 2756.6 1 4.676 50.0 1 K.AEAEDLRNELENK.K * Jamie_Mitco_SPB_23.07959.07959.4 3.6867 0.1591 100.0 2532.3364 2531.8438 3721.1 42 3.953 28.3 1 K.AEAEDLRNELENKKIEIQTMR.E * Jamie_Mitco_SPB_22.07669.07669.3 4.2517 0.0941 99.6 2535.0244 2531.8438 8298.7 2 3.776 33.8 2 K.AEAEDLRNELENKKIEIQTMR.E * Jamie_Mitco_SPB_8.02649.02649.2 2.3845 0.2203 99.7 1230.3322 1232.3794 3468.5 1 4.049 80.0 1 R.EKNNTLIGTNK.T * Jamie_Mitco_SPB_13.04475.04475.1 1.9154 0.0876 100.0 1038.99 1039.1829 4698.1 16 3.496 71.4 1 K.ILCDKFDK.L * Jamie_Mitco_SPB_11.03735.03735.2 2.2627 0.0392 95.6 1711.6522 1713.9255 6392.7 108 3.445 46.2 1 K.SKEKYETSLKDKEK.M * Jamie_Mitco_SPB_5.01474.01474.2 1.9881 0.0263 92.9 1241.9321 1241.3837 4300.9 24 3.076 72.2 1 K.YETSLKDKEK.M * Jamie_Mitco_SPB_14.04930.04930.2 2.4402 0.1105 99.5 1239.8322 1240.4167 3193.8 5 3.425 72.2 1 R.QVYSQEMNLK.K * Jamie_Mitco_SPB_25.08807.08807.2 3.4378 0.3904 100.0 1772.5922 1773.9575 7991.1 1 6.859 73.1 1 K.KFTDQAYYDFMSTR.R * Jamie_Mitco_SPB_13.04357.04357.1 1.4369 0.214 100.0 1252.6 1253.3751 3848.4 5 5.135 50.0 1 R.MDSIDHHLER.C * Jamie_Mitco_SPB_20.07131.07131.2 2.9134 0.1205 99.7 1555.9122 1556.7246 5240.1 1 3.678 86.4 1 R.CLDHLYDHILEK.M YAL047C 26 27 59.0% 622 72105 5.1 U SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" * Jamie_Mitco_SPB_33.11681.11681.2 3.3522 0.4597 100.0 2934.872 2935.9753 7105.6 1 8.223 48.1 1 R.NNDNTGDDDDSEFTNSMDSGMSIPSLR.D * Jamie_Mitco_SPB_35.12384.12384.2 3.1872 0.331 100.0 3015.0723 3015.9753 6059.2 1 6.617 40.4 1 R.NNDNTGDDDDSEFTNS*MDSGMSIPSLR.D * Jamie_Mitco_SPB_32.11419.11419.3 3.3769 0.1926 100.0 3628.6443 3627.7324 8987.2 1 5.213 22.7 1 R.NNDNTGDDDDSEFTNSMDSGMSIPSLRDSMTTR.S * Jamie_Mitco_SPB_88.31609.31609.4 4.8549 0.264 100.0 6086.9365 6088.5854 8233.1 1 5.147 15.7 1 K.EVEYQDTLQFVQENLENSESIVNTINHLLSFILTHFNEQDENAHLLDKEER.E * Jamie_Mitco_SPB_16.05634.05634.2 2.7107 0.4167 100.0 2450.5322 2452.6426 7061.5 1 6.499 47.4 1 F.ILTHFNEQDENAHLLDKEER.E * Jamie_Mitco_SPB_43.15321.15321.2 3.9627 0.1618 100.0 2001.1122 1999.1761 9133.8 1 4.264 59.4 1 R.ETLEETLELSSDYVLEK.M * Jamie_Mitco_SPB_29.10253.10253.2 3.7002 0.2702 100.0 2118.0522 2117.1907 7060.9 2 5.032 50.0 1 K.EEFLSLAQSS*PAGSQLESR.D * Jamie_Mitco_SPB_21.07230.07230.2 2.9491 0.3153 100.0 1464.1721 1463.6738 5223.3 1 5.449 62.5 1 T.SLPISAVESRFEK.T * Jamie_Mitco_SPB_49.17547.17547.3 3.6869 0.0634 95.8 2332.0444 2330.5542 4478.0 20 3.828 38.2 1 R.FEKT*LDT*QLEIVIEILHK.E * Jamie_Mitco_SPB_67.24019.24019.4 5.1519 0.1006 100.0 3440.4966 3436.93 7783.1 14 4.524 24.1 1 R.FEKTLDTQLEIVIEILHKEYDQFINSIR.L * Jamie_Mitco_SPB_76.27054.27054.3 3.6683 0.1178 97.4 3114.8342 3112.4636 7275.3 1 3.938 31.2 1 K.TLDT*QLEIVIEILHKEYDQFINSIR.L * Jamie_Mitco_SPB_30.10483.10483.2 4.9808 0.2689 100.0 2615.612 2614.823 8709.4 1 5.716 50.0 1 K.LNEQSHLLDSLELEENSSSVIEK.Q * Jamie_Mitco_SPB_35.12281.12281.4 4.5613 0.1846 100.0 3934.0566 3935.3342 8731.8 92 3.934 19.2 1 K.LNEQSHLLDSLELEENSSSVIEKQDHLISQLKEK.I * Jamie_Mitco_SPB_19.06839.06839.2 3.5241 0.3955 100.0 1486.5521 1487.6934 7554.1 1 7.312 83.3 1 K.IESQSVLINNLEK.L * Jamie_Mitco_SPB_19.06492.06492.2 3.4493 0.1806 100.0 1457.2122 1457.7104 5404.7 1 4.713 86.4 1 I.NNLEKLKEDIIK.M * Jamie_Mitco_SPB_28.09730.09730.2 5.0887 0.3926 100.0 1881.2322 1882.0367 9034.1 1 7.613 75.0 2 K.LKENNWDSYINDLEK.Q * Jamie_Mitco_SPB_17.05905.05905.1 2.079 0.165 100.0 1586.79 1587.7294 6162.1 422 3.652 41.7 1 K.SEEFHVIQNQLDK.L * Jamie_Mitco_SPB_17.05859.05859.3 3.2688 0.154 100.0 1587.0243 1587.7294 5733.5 448 3.914 43.8 1 K.SEEFHVIQNQLDK.L * Jamie_Mitco_SPB_37.13302.13302.2 3.5719 0.3465 100.0 2703.5122 2704.9963 9546.5 1 6.672 50.0 1 K.SEEFHVIQNQLDKLDLENYQLK.N * Jamie_Mitco_SPB_12.04099.04099.1 2.6424 0.1446 100.0 1187.92 1188.2828 3887.1 1 4.695 77.8 1 K.NQLNTLDNQK.L * Jamie_Mitco_SPB_79.28175.28175.3 3.0269 0.2279 100.0 3606.2644 3608.2183 7685.8 62 4.028 19.8 1 K.LILSQYESNFIKFNQNLLLHLDSIFNILQK.I * Jamie_Mitco_SPB_19.06663.06663.2 2.7246 0.319 100.0 1406.7722 1407.5663 6883.5 1 5.947 72.7 1 K.ILQESSIAQFDR.K * Jamie_Mitco_SPB_103.36771.36771.3 5.3993 0.3791 100.0 5042.034 5040.6045 7764.9 1 7.447 21.6 1 K.LESLYTFIETALESIINSYISSLISMETPEQPHQQGNELTATPNK.E * Jamie_Mitco_SPB_13.04337.04337.1 2.5375 0.2117 100.0 1189.46 1189.2676 3839.1 1 4.785 72.2 1 K.ALEQENESLR.S * Jamie_Mitco_SPB_11.03801.03801.2 3.3015 0.1914 100.0 1405.1322 1404.5199 6879.3 5 4.537 72.7 1 K.ALEQENESLRSK.L * Jamie_Mitco_SPB_34.12075.12075.1 1.6157 0.0478 91.5 1326.43 1327.4368 3021.4 24 3.471 65.0 1 R.SKLFNLS*INNP.- YDL130W 2 2 56.6% 106 10668 4.0 U RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" * Jamie_Mitco_SPB_50.17730.17730.4 6.6583 0.4972 100.0 5948.7764 5949.181 4963.0 1 8.703 16.4 1 K.ALEGKDLKEILSGFHNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- * Jamie_Mitco_SPB_46.16404.16404.3 2.9539 0.1926 99.0 5092.1343 5094.179 6763.0 1 3.486 16.7 1 K.EILSGFHNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- YDL081C 2 2 55.7% 106 10908 3.9 U RPP1A SGDID:S000002239, Chr IV from 310122-309802, reverse complement, Verified ORF, "Ribosomal protein P1 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component" * Jamie_Mitco_SPB_58.20559.20559.4 4.1241 0.1898 100.0 5950.9766 5952.225 8303.5 1 4.706 15.2 1 K.ALDGQNLKDLLVNFSAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- * Jamie_Mitco_SPB_38.13492.13492.3 3.7789 0.362 100.0 4408.9146 4410.458 6056.5 1 6.44 19.3 1 F.SAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- YPL124W 14 26 54.9% 253 29280 9.5 U SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" * Jamie_Mitco_SPB_11.03939.03939.2 2.902 0.1387 99.7 1137.0721 1137.2377 5323.0 1 4.674 93.8 1 K.KFQDDTLNR.V * Jamie_Mitco_SPB_13.04587.04587.3 4.5115 0.237 100.0 1954.9443 1954.1039 7145.4 1 4.562 50.0 1 K.LREENFSSNTSELGNKK.H * Jamie_Mitco_SPB_29.10108.10108.2 2.5427 0.2109 99.7 1839.9922 1839.0326 7979.8 1 4.901 50.0 1 R.LPPPPFS*SYGMPPTNR.S * Jamie_Mitco_SPB_24.08343.08343.2 3.4451 0.3568 100.0 1892.3121 1892.0758 9815.2 1 6.134 56.7 1 T.DKFASQNVIDDQRLEI.K * Jamie_Mitco_SPB_19.06581.06581.2 2.7598 0.042 99.2 1778.4122 1776.9872 8696.8 22 3.291 46.4 1 K.FASQNVIDDQRLEIK.Y * Jamie_Mitco_SPB_24.08607.08607.2 2.9154 0.1343 99.5 1694.2922 1694.8821 9172.6 94 4.487 42.9 1 R.IVYDQGTVIDNLTSR.I * Jamie_Mitco_SPB_40.14199.14199.4 3.8239 0.1106 97.7 3106.6965 3107.4531 6128.0 1 3.379 25.0 1 R.ITRLESFILNSISDRGDKNFASLEHSR.S * Jamie_Mitco_SPB_31.10807.10807.2 3.1511 0.347 100.0 2009.7122 2009.2588 8039.4 1 5.95 65.6 1 K.TYGLQMGGLYENDMPYR.R * Jamie_Mitco_SPB_25.08782.08782.2 3.0422 0.1533 99.7 2163.8523 2165.4463 6735.3 365 4.359 35.3 1 K.TYGLQMGGLYENDMPYRR.S * Jamie_Mitco_SPB_22.07749.07749.2 3.352 0.3252 100.0 1922.4521 1923.9855 5379.6 2 6.921 66.7 3 R.SSQIHIENES*TEDILK.I * Jamie_Mitco_SPB_18.06423.06423.3 4.055 0.0334 96.6 1924.2843 1923.9855 6958.4 1 3.401 48.3 1 R.SSQIHIENES*TEDILK.I * Jamie_Mitco_SPB_31.10872.10872.2 4.1396 0.3493 100.0 1924.7122 1923.9855 7243.5 2 5.873 56.7 11 R.SSQIHIENEST*EDILK.I * Jamie_Mitco_SPB_38.13395.13395.2 3.2085 0.3482 100.0 2149.112 2150.3042 6478.8 1 5.947 58.8 1 R.SSQIHIENEST*EDILKIL.S * Jamie_Mitco_SPB_39.14022.14022.2 2.5078 0.2399 92.1 2323.3123 2324.4607 7216.9 4 4.695 39.5 1 R.SSQIHIENES*TEDILKILSS.S YLR212C 11 12 44.8% 473 52628 4.7 U TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" * Jamie_Mitco_SPB_22.07731.07731.3 3.1683 0.2314 100.0 3136.6743 3136.3152 6747.0 1 5.124 24.1 1 K.EHAIGTDGLSQLPDSSTERDDDTKPFFR.E * Jamie_Mitco_SPB_27.09408.09408.2 2.3996 0.2723 99.7 2471.9321 2471.5615 8249.6 3 5.09 32.6 1 R.NTWVASDGASAGNSWANGYDIGTR.N * Jamie_Mitco_SPB_18.06385.06385.2 3.3766 0.4132 100.0 1899.6921 1899.928 6542.3 1 7.004 58.3 1 A.SDGASAGNSWANGYDIGTR.N * Jamie_Mitco_SPB_58.20790.20790.4 5.2481 0.2531 100.0 5468.5366 5467.9326 11042.7 1 4.727 18.0 1 R.NQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPK.K * Jamie_Mitco_SPB_41.14637.14637.2 4.5492 0.3197 100.0 2323.1921 2322.5742 7773.4 1 5.053 50.0 1 R.LIEDSDATVVFDNASLLNISGK.V * Jamie_Mitco_SPB_69.24660.24660.3 3.5574 0.3058 100.0 4659.324 4661.1714 8340.8 1 5.586 18.3 1 K.GHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPR.Q * Jamie_Mitco_SPB_73.26070.26070.3 5.3688 0.3724 100.0 4962.804 4960.224 7168.1 1 5.831 21.5 2 R.EVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHK.L * Jamie_Mitco_SPB_75.26751.26751.3 4.6218 0.4879 100.0 5171.0645 5172.516 7620.5 1 9.265 19.4 1 R.EVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.- * Jamie_Mitco_SPB_72.25594.25594.3 5.1501 0.5069 100.0 4715.7544 4717.005 6477.2 1 8.071 23.2 1 Q.SLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.- * Jamie_Mitco_SPB_70.24995.24995.3 6.4677 0.455 100.0 4630.1343 4629.927 8300.1 1 7.757 25.0 1 S.LMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.- * Jamie_Mitco_SPB_68.24318.24318.3 5.8657 0.545 100.0 4515.9243 4516.767 8292.1 1 9.457 24.4 1 L.MEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.- YDR382W 2 2 43.6% 110 11050 4.1 U RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" * Jamie_Mitco_SPB_37.12979.12979.3 4.7039 0.2726 100.0 4610.574 4609.7534 8256.4 1 4.127 18.1 1 K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEESDDDMGFGLFD.- * Jamie_Mitco_SPB_40.14153.14153.3 4.2052 0.3666 100.0 4687.8545 4689.7534 5961.1 1 6.172 19.7 1 K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- YJR053W 17 17 39.5% 574 66087 5.9 U BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" * Jamie_Mitco_SPB_41.14502.14502.2 3.0166 0.3456 100.0 3178.8323 3180.2068 8553.2 1 6.615 36.0 1 K.QADDDQDMEVDQDDEFLNDFQEFQNK.K * Jamie_Mitco_SPB_23.07989.07989.2 1.8035 0.0523 91.6 1255.5122 1256.3141 8110.6 302 2.827 61.1 1 K.NDIFAEEFDR.K * Jamie_Mitco_SPB_33.11883.11883.2 2.3625 0.1271 99.6 1477.5721 1476.691 3775.4 2 4.284 58.3 1 K.S*MPNLALVNPAIR.E * Jamie_Mitco_SPB_15.05071.05071.2 2.9124 0.2064 100.0 1428.8121 1427.465 7548.1 6 4.496 72.7 1 K.IDNDT*QDTILAK.F * Jamie_Mitco_SPB_52.18570.18570.4 4.8529 0.28 100.0 4298.8965 4299.3423 9748.4 1 5.382 21.6 1 A.KFS*SDDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F * Jamie_Mitco_SPB_57.20320.20320.3 3.3996 0.1868 100.0 4174.224 4171.1685 5844.1 3 3.828 20.8 1 K.FSS*DDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F * Jamie_Mitco_SPB_57.20236.20236.4 4.4811 0.0613 97.4 4175.7363 4171.1685 6996.7 1 3.176 19.4 1 K.FSS*DDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F * Jamie_Mitco_SPB_16.05703.05703.3 3.4852 0.3022 100.0 2672.4844 2672.7327 8924.7 427 5.218 22.8 1 F.EELEGEAIDETISSNDKESADHPR.F * Jamie_Mitco_SPB_21.07234.07234.2 2.4247 0.1652 99.5 1850.3722 1848.8773 2854.2 230 4.153 50.0 1 R.DWNTQQELDS*FKEK.R * Jamie_Mitco_SPB_10.03507.03507.2 4.0635 0.0808 99.7 1649.4521 1647.6677 5332.1 3 4.071 69.2 1 R.HCS*NQNVQLNGPAK.I * Jamie_Mitco_SPB_5.01524.01524.2 2.0681 0.0887 99.2 1153.0521 1153.237 6635.1 1 4.123 72.2 1 K.FSDVDTANRK.A * Jamie_Mitco_SPB_20.07169.07169.2 4.8991 0.41 100.0 1885.5322 1886.1766 8716.3 1 7.996 83.3 1 R.NQKVIGNMILDEQNLR.W * Jamie_Mitco_SPB_24.08313.08313.2 3.4414 0.2878 100.0 1516.0922 1515.768 7168.9 1 5.953 70.8 1 K.VIGNMILDEQNLR.W * Jamie_Mitco_SPB_54.19311.19311.2 2.065 0.0439 92.6 2761.372 2762.002 8457.4 2 3.559 31.2 1 R.WVSVS*EEEADPFAGIPEINLPPVGK.S * Jamie_Mitco_SPB_22.07771.07771.2 2.2396 0.3202 100.0 2178.1921 2179.3481 9540.3 4 5.616 36.8 1 R.TLNGTTETPEISSTFHLSSR.A * Jamie_Mitco_SPB_35.12274.12274.2 3.6033 0.4255 100.0 2355.9922 2356.5146 8126.5 1 7.051 40.0 1 R.DETIISVDEETIMDESTVNSK.R * Jamie_Mitco_SPB_11.03630.03630.1 1.5587 0.2215 100.0 1021.18 1022.16144 3858.9 92 4.257 56.2 1 R.NMVINSTKD.- YPL255W 10 10 38.4% 385 45384 6.5 U BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" * Jamie_Mitco_SPB_32.11502.11502.1 2.373 0.1659 100.0 1462.5 1462.5714 3030.9 30 4.729 54.2 1 K.DALFGTDIS*PSMK.Y * Jamie_Mitco_SPB_27.09670.09670.2 2.1044 0.0764 96.3 1754.4922 1753.9214 7038.0 45 3.011 46.4 1 K.DALFGTDISPS*MKYK.D * Jamie_Mitco_SPB_77.27400.27400.4 3.818 0.1055 97.5 4769.9766 4770.895 6812.5 367 3.224 16.2 1 R.SRYAQDDTNFS*MKFGNDSNRRSTNLSRS*NSWSGLDSTLHR.K * Jamie_Mitco_SPB_13.04583.04583.2 2.8856 0.2509 100.0 1291.2522 1291.4496 5865.0 1 5.29 80.0 1 K.LFNKDGVNEVR.R * Jamie_Mitco_SPB_17.06063.06063.2 3.1215 0.3511 100.0 1850.0721 1850.9371 3252.6 1 5.837 66.7 1 K.VLDQTISHEAELATS*R.E * Jamie_Mitco_SPB_27.09642.09642.2 4.8343 0.3969 100.0 2011.0122 2012.2671 10395.6 1 7.723 66.7 1 R.LYQEEDLKNFEIQTLK.Q * Jamie_Mitco_SPB_25.08878.08878.3 3.999 0.313 100.0 2338.5544 2338.6814 6004.4 2 5.221 36.1 1 R.LSDLELKYTNLQIEKDMQR.D * Jamie_Mitco_SPB_54.19161.19161.3 4.1677 0.1413 100.0 2058.6243 2059.2834 8245.5 77 4.192 40.6 1 R.DNYESEIHDLLLQLSLR.N * Jamie_Mitco_SPB_55.19709.19709.2 2.2444 0.2211 99.5 2059.4321 2059.2834 7777.2 8 4.593 40.6 1 R.DNYESEIHDLLLQLSLR.N * Jamie_Mitco_SPB_21.07284.07284.2 2.7148 0.2538 100.0 1574.0322 1573.4839 4906.9 1 5.132 65.4 1 R.KDTS*AGS*NIFSTGQ.- YLR457C 10 10 38.2% 319 37354 10.2 U NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" * Jamie_Mitco_SPB_14.04947.04947.2 1.9839 0.2285 99.7 1070.1522 1068.1283 5336.1 6 4.319 62.5 1 R.EYGSLDEVR.K * Jamie_Mitco_SPB_26.09083.09083.3 3.1922 0.1368 98.7 2159.3342 2159.3784 7023.0 2 4.253 36.8 1 K.IFQTIRDVFSNDNENMSK.M * Jamie_Mitco_SPB_19.06729.06729.2 3.2346 0.2598 100.0 2086.672 2085.3245 7432.6 5 5.023 46.9 1 S.KLQSLQEALNYSNEKYR.I * Jamie_Mitco_SPB_29.10441.10441.2 2.7214 0.328 100.0 2025.0322 2026.1644 5330.5 1 4.908 62.5 1 R.ILEDLLDSSNIHPS*YTK.S * Jamie_Mitco_SPB_34.12208.12208.2 3.0349 0.3559 100.0 2106.7522 2106.1643 4772.4 6 5.835 46.9 1 R.ILEDLLDS*S*NIHPSYTK.S * Jamie_Mitco_SPB_36.12795.12795.2 2.2917 0.116 99.2 2106.8323 2106.1643 7468.5 48 4.476 37.5 1 R.ILEDLLDSS*NIHPSY*TK.S * Jamie_Mitco_SPB_6.02022.02022.1 1.6987 0.1471 100.0 792.69 792.92865 3493.1 37 3.537 66.7 1 R.TMSNLAR.E * Jamie_Mitco_SPB_22.07879.07879.3 3.1418 0.1425 97.4 2383.3145 2381.562 4269.1 8 4.147 33.3 1 R.ENDEIKPLKIDLS*PS*PIRR.T * Jamie_Mitco_SPB_20.06889.06889.2 2.0964 0.083 98.5 1294.2322 1293.3911 5703.1 29 3.658 65.0 1 R.TNS*LFTSSPMK.T * Jamie_Mitco_SPB_37.13252.13252.2 1.9138 0.0808 93.7 2886.172 2885.999 6264.4 1 3.665 32.6 1 R.DGNIPEMQPLQENIS*PACPT*PPYR.S YLR146W-A 2 2 35.5% 62 7078 4.8 U YLR146W-A SGDID:S000113566, Chr XII from 433871-434059, Uncharacterized ORF, "Putative protein of unknown function" * Jamie_Mitco_SPB_43.15424.15424.2 4.4966 0.3077 100.0 1887.9722 1889.2261 5588.3 1 6.285 64.3 1 A.RMLQNEIQQLFAQLR.D * Jamie_Mitco_SPB_3.00802.00802.2 2.6691 0.2582 100.0 1102.3522 1103.2235 6721.0 2 4.693 81.2 1 Q.LRDTNSQIR.C YPL131W 8 8 35.0% 297 33715 6.8 U RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" * Jamie_Mitco_SPB_44.15789.15789.4 4.8127 0.3479 100.0 3601.3364 3599.927 5886.9 1 6.069 26.3 1 K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFKV.F * Jamie_Mitco_SPB_55.19704.19704.4 3.5495 0.1155 96.9 4543.2163 4543.0405 9129.8 91 3.318 16.7 1 K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQR.T * Jamie_Mitco_SPB_30.10612.10612.2 2.2194 0.0843 97.8 2209.0522 2208.297 6890.7 20 3.489 34.2 1 K.GVEEVEGEYELTEAVEDGPR.P * Jamie_Mitco_SPB_33.11873.11873.2 4.4106 0.2807 100.0 2582.3523 2580.7644 7045.3 1 5.522 54.5 1 K.GVEEVEGEYELTEAVEDGPRPFK.V * Jamie_Mitco_SPB_36.12881.12881.2 3.9587 0.2015 100.0 2593.7722 2591.7217 11047.9 1 4.925 52.4 1 R.SYIFGGHVSQYMEELADDDEER.F * Jamie_Mitco_SPB_55.19497.19497.3 4.9515 0.2405 100.0 3344.6042 3343.602 9811.6 1 5.445 26.9 1 R.SYIFGGHVSQYMEELADDDEERFSELFK.G * Jamie_Mitco_SPB_41.14715.14715.2 3.2627 0.3742 100.0 2653.412 2654.8035 7701.8 2 5.951 30.4 1 K.GYLADDIDADSLEDIYTSAHEAIR.A * Jamie_Mitco_SPB_11.03898.03898.2 2.3797 0.1021 99.6 1429.0322 1430.6006 6601.4 40 3.772 59.1 1 K.KFTKEQYAAESK.K YOL039W 3 3 34.9% 106 10746 4.0 U RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" * Jamie_Mitco_SPB_29.10330.10330.2 2.7879 0.2868 100.0 1545.9321 1545.727 6008.0 1 5.747 69.2 1 K.AILESVGIEIEDEK.V * Jamie_Mitco_SPB_51.18142.18142.2 4.6631 0.4664 100.0 2615.912 2616.9658 10358.5 1 7.958 39.6 1 K.AILESVGIEIEDEKVSSVLSALEGK.S * Jamie_Mitco_SPB_15.05400.05400.1 2.4629 0.2902 100.0 1333.3 1334.4229 6132.4 9 5.339 54.5 1 K.SVDELITEGNEK.L YOR373W 34 36 31.6% 851 94104 7.0 U NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" * Jamie_Mitco_SPB_29.10284.10284.2 2.6205 0.3029 100.0 3074.132 3074.1975 7736.8 2 6.322 26.9 1 K.EYESNHDFQDSNFTSQVVEPAISDSVK.K * Jamie_Mitco_SPB_15.05145.05145.3 3.2037 0.1753 100.0 2038.6444 2039.2708 8551.3 25 4.008 37.5 1 K.KPPTMTVLNNYST*VHQK.V * Jamie_Mitco_SPB_13.04593.04593.2 2.4811 0.2735 96.7 1577.2722 1577.6476 4507.2 1 5.264 56.7 1 K.VPSGFSGTTATSHQEA.Q * Jamie_Mitco_SPB_15.05290.05290.3 3.5203 0.3541 100.0 2019.9243 2020.1655 4592.7 1 5.698 34.7 1 K.VPSGFSGTTATSHQEAQWK.Q * Jamie_Mitco_SPB_122.43590.43590.2 2.644 0.0674 99.2 2020.6921 2020.1655 7848.5 303 3.963 36.1 2 K.VPSGFSGTTATSHQEAQWK.Q * Jamie_Mitco_SPB_59.21028.21028.2 3.4465 0.4068 100.0 2621.372 2622.8865 3329.3 1 6.539 43.5 1 T.ANKVPESDLIVSDLVKDLSGVLET*.N * Jamie_Mitco_SPB_34.11967.11967.2 2.9822 0.0812 99.5 1405.8322 1404.4735 5541.0 1 3.95 81.8 1 K.DLS*GVLETNTFK.R * Jamie_Mitco_SPB_10.03247.03247.2 3.7281 0.096 99.7 2173.3123 2172.152 5904.3 1 5.733 55.6 1 K.NNNNNNNNNNNNSININNK.D * Jamie_Mitco_SPB_19.06567.06567.3 4.6199 0.3899 100.0 2377.4644 2378.6523 6287.6 1 6.569 41.7 1 K.KPPLNTISPGQLGYQFNHTHGA.W * Jamie_Mitco_SPB_10.03520.03520.2 1.9926 0.1897 99.5 870.1722 872.05255 5319.9 4 3.759 85.7 1 K.APSILDKK.A * Jamie_Mitco_SPB_16.05536.05536.2 2.8656 0.3466 100.0 2336.892 2338.401 6692.9 5 5.991 36.8 1 K.KIQEEENLANSDDTPLDT*PK.F * Jamie_Mitco_SPB_16.05512.05512.2 3.0909 0.2429 100.0 2418.892 2418.401 7802.7 2 5.405 39.5 1 K.KIQEEENLANSDDT*PLDT*PK.F * Jamie_Mitco_SPB_29.10332.10332.3 4.402 0.3093 100.0 3125.0044 3124.385 8926.2 1 5.083 29.8 1 K.KIQEEENLANSDDTPLDTPKFNDLFTK.N * Jamie_Mitco_SPB_30.10801.10801.3 4.5483 0.1375 100.0 3205.1943 3204.385 10611.4 1 4.557 30.8 1 K.KIQEEENLANSDDTPLDT*PKFNDLFTK.N * Jamie_Mitco_SPB_34.12013.12013.3 4.0271 0.1735 100.0 3285.9844 3284.385 4331.6 4 4.502 26.9 1 K.KIQEEENLANS*DDT*PLDTPKFNDLFTK.N * Jamie_Mitco_SPB_32.11257.11257.3 3.5875 0.1354 99.0 3286.0745 3284.385 5992.1 1 3.802 27.9 1 K.KIQEEENLANSDDT*PLDT*PKFNDLFTK.N * Jamie_Mitco_SPB_18.06333.06333.2 2.8527 0.1876 99.7 2209.872 2210.2268 8832.1 1 4.894 47.2 1 K.IQEEENLANSDDTPLDT*PK.F * Jamie_Mitco_SPB_18.06361.06361.3 3.5142 0.152 100.0 2290.0444 2290.2268 7227.7 1 4.432 38.9 1 K.IQEEENLANS*DDTPLDT*PK.F * Jamie_Mitco_SPB_18.06363.06363.2 4.9124 0.3147 100.0 2292.0723 2290.2268 9303.0 1 6.034 58.3 2 K.IQEEENLANSDDT*PLDT*PK.F * Jamie_Mitco_SPB_37.13237.13237.2 2.5208 0.2884 100.0 3154.112 3156.211 7646.1 1 4.996 28.0 1 K.IQEEENLANS*DDTPLDT*PKFNDLFTK.N * Jamie_Mitco_SPB_38.13329.13329.3 5.0641 0.3767 100.0 3154.9744 3156.211 10449.5 3 6.781 29.0 1 K.IQEEENLANSDDT*PLDT*PKFNDLFTK.N * Jamie_Mitco_SPB_30.10479.10479.4 4.2769 0.2764 100.0 3425.3364 3424.6592 7279.9 14 4.955 23.0 1 K.IQEEENLANSDDTPLDTPKFNDLFTKNGTR.A * Jamie_Mitco_SPB_13.04648.04648.2 2.5019 0.115 99.5 1313.9122 1313.4532 5914.3 479 4.183 54.5 1 R.SISNSNLLEAHK.K * Jamie_Mitco_SPB_52.18611.18611.4 5.0915 0.2695 100.0 4154.0566 4150.5835 6659.5 1 5.909 22.4 1 K.LKTFPAERVEDITSISEVNTS*FNETEKQLISILTSK.L * Jamie_Mitco_SPB_60.21276.21276.3 3.729 0.1318 99.3 3987.6843 3989.25 4624.5 3 4.274 20.5 1 K.TFPAERVEDITSIS*EVNTS*FNETEKQLISILTSK.L * Jamie_Mitco_SPB_30.10773.10773.2 3.3687 0.4817 100.0 2301.912 2303.2659 7225.5 2 6.91 41.7 1 R.VEDITSIS*EVNTS*FNETEK.Q * Jamie_Mitco_SPB_57.20418.20418.2 1.9637 0.1031 96.4 2537.4922 2535.724 9489.7 14 3.324 28.6 1 K.QLISILTSKLSGSPS*YDSDWEK.I * Jamie_Mitco_SPB_16.05412.05412.1 2.711 0.2387 100.0 1470.3 1471.52 5547.5 1 4.989 66.7 1 K.LSGSPSYDSDWEK.I * Jamie_Mitco_SPB_17.05983.05983.1 2.2776 0.3611 100.0 1550.83 1551.52 3400.7 3 5.435 54.2 1 K.LSGS*PSYDSDWEK.I * Jamie_Mitco_SPB_30.10608.10608.2 2.5457 0.0066 95.6 2277.112 2276.5535 9822.8 26 3.211 38.2 1 K.LQNYKLDDQFTFPYQNLK.I * Jamie_Mitco_SPB_30.10684.10684.2 3.7134 0.2529 100.0 1630.5322 1629.8094 6716.0 1 5.42 70.8 1 K.LDDQFTFPYQNLK.I * Jamie_Mitco_SPB_22.07716.07716.1 2.0475 0.2584 100.0 1271.91 1272.4435 5514.0 4 4.811 55.0 1 R.DFTHLPVDLSK.E * Jamie_Mitco_SPB_22.07804.07804.2 2.6252 0.0957 99.5 1272.5521 1272.4435 6888.8 1 4.601 70.0 1 R.DFTHLPVDLSK.E * Jamie_Mitco_SPB_10.03276.03276.1 2.041 0.2504 100.0 912.34 913.02136 3758.7 14 4.597 64.3 1 R.NNPITTPR.H YLR150W 3 3 23.4% 273 29995 9.7 U STM1 SGDID:S000004140, Chr XII from 440468-441289, Verified ORF, "Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations" * Jamie_Mitco_SPB_14.04864.04864.2 3.4954 0.336 100.0 1887.2922 1887.9952 5642.6 1 6.811 61.1 1 A.AEIAEDAAEAEDAGKPKTA.Q * Jamie_Mitco_SPB_29.10349.10349.3 4.4312 0.316 100.0 2865.1443 2864.1443 7410.4 1 5.701 35.4 1 K.TAQLSLQDYLNQQANNQFNKVPEAK.K * Jamie_Mitco_SPB_20.06970.06970.3 4.9137 0.3997 100.0 2492.5144 2491.801 10088.7 1 6.893 34.5 1 K.KVELDAERIETAEKEAYVPATK.V YBL003C 1 2 22.0% 132 13989 10.7 U HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " YDR225W 1 2 22.0% 132 13989 10.7 U HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " Jamie_Mitco_SPB_103.36739.36739.2 5.8402 0.5148 100.0 2946.7722 2947.4014 10145.8 1 9.586 44.6 2 R.IGSGAPVYLTAVLEYLAAEILELAGNAAR.D YPL144W 1 1 20.9% 148 16573 7.9 U YPL144W SGDID:S000006065, Chr XVI from 280479-280925, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_29.10308.10308.3 2.8154 0.2264 99.6 3619.8542 3623.9402 8876.3 1 5.136 22.5 1 R.DRHINLKS*GGS*NVVGIPLLDTKDDRIRDMAR.H YNL188W 7 7 20.8% 433 50653 9.3 U KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" * Jamie_Mitco_SPB_31.10821.10821.2 3.9266 0.2053 100.0 1885.0122 1885.936 8902.6 5 4.951 64.3 1 K.IDEDNIENELQFT*PK.I * Jamie_Mitco_SPB_25.08928.08928.3 3.4816 0.2745 100.0 2844.1743 2846.17 6720.9 120 4.617 26.0 1 R.KQLGKPLPLPYLNS*PNSDSTPTLQR.K * Jamie_Mitco_SPB_36.12731.12731.2 3.0023 0.2954 100.0 2291.2122 2291.4795 6682.2 2 5.183 39.5 1 K.PLPLPYLNS*PNSDSTPTLQR.K * Jamie_Mitco_SPB_45.15886.15886.2 2.7003 0.1648 99.7 2372.8323 2371.4795 7970.1 1 3.942 39.5 1 K.PLPLPYLNS*PNS*DSTPTLQR.K * Jamie_Mitco_SPB_16.05457.05457.2 4.498 0.1699 100.0 1465.3722 1465.6433 7999.7 1 5.002 81.8 1 R.KEEVFTDEVLQK.K * Jamie_Mitco_SPB_38.13365.13365.3 5.8015 0.2659 100.0 2414.1243 2413.754 8933.1 1 5.521 42.1 1 K.FQAQRDPLQILQSEIEMHTK.K * Jamie_Mitco_SPB_29.10383.10383.3 3.7507 0.2105 100.0 2104.0745 2105.3904 6487.2 95 4.947 32.4 1 K.KLDTIIELLKDDTDSKEK.R YMR142C 3 3 20.1% 199 22525 11.1 U RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" Jamie_Mitco_SPB_15.05259.05259.2 3.0955 0.2292 100.0 1334.8121 1334.4313 6556.0 1 5.253 75.0 1 R.NQEIFDANVQR.L * Jamie_Mitco_SPB_37.13099.13099.2 3.2946 0.0579 99.5 2954.2322 2955.2512 9336.1 1 7.266 35.7 1 R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A * Jamie_Mitco_SPB_37.13036.13036.3 4.1837 0.1198 99.6 2957.3044 2955.2512 7966.3 4 3.784 27.7 1 R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A YMR255W 1 1 19.7% 188 21571 9.8 U GFD1 SGDID:S000004868, Chr XIII from 778000-778566, Verified ORF, "Coiled-coiled protein of unknown function, identified as a high-copy suppressor of a dbp5 mutation" * Jamie_Mitco_SPB_95.34061.34061.4 3.5882 0.2099 100.0 4032.4165 4029.41 6383.8 23 3.531 18.1 1 K.KPPHSQGKISPVSES*LAINPFSQKAT*EISPPPVSPSK.M YLR075W 2 2 19.5% 221 25361 10.0 U RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" * Jamie_Mitco_SPB_57.20506.20506.3 4.4219 0.26 100.0 3359.9644 3357.7083 12833.6 1 5.067 25.9 1 K.KATVDEFPLCVHLVSNELEQLSSEALEAAR.I * Jamie_Mitco_SPB_26.09077.09077.2 3.2818 0.183 100.0 1640.1322 1639.851 5664.4 2 5.872 62.5 1 K.WGFTNLDRPEYLK.K Reverse_YLR218C 1 1 18.7% 150 17253 8.6 U YLR218C SGDID:S000004208, Chr XII from 573920-573468, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_64.22979.22979.3 3.1417 0.0996 92.0 3262.7043 3262.7485 6699.5 1 3.516 27.8 1 K.YYESTEGTESMVLRGTKAQWLKEKGKIK.G YDR450W 3 3 18.5% 146 17038 10.3 U RPS18A SGDID:S000002858, Chr IV from 1359913-1359959,1360395-1360788, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins" YML026C 3 3 18.5% 146 17038 10.3 U RPS18B SGDID:S000004488, Chr XIII from 223828-223782,223380-222987, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins" Jamie_Mitco_SPB_15.05374.05374.3 4.0278 0.2538 100.0 2265.2644 2263.3826 4111.5 1 5.038 34.2 1 R.QNDITDGKDYHTLANNVESK.L Jamie_Mitco_SPB_14.04775.04775.2 2.7908 0.2741 100.0 1391.0922 1391.4802 5236.3 7 5.203 68.2 1 K.DYHTLANNVESK.L Jamie_Mitco_SPB_8.02761.02761.2 1.8302 0.0392 93.8 916.2522 917.00977 6128.0 45 3.172 75.0 1 K.LRDDLER.L Reverse_YBR162W-A 1 1 18.5% 65 7365 10.3 U YSY6 SGDID:S000002158, Chr II from 565226-565423, Verified ORF, "Protein whose expression suppresses a secretory pathway mutation in E. coli; has similarity to the mammalian RAMP4 protein involved in secretion" * Jamie_Mitco_SPB_17.05920.05920.2 2.6866 0.0587 99.1 1717.4922 1716.8081 5456.0 125 2.901 50.0 1 K.KKGY*KRY*KENNK.N Reverse_YHR062C 1 1 18.4% 293 32224 9.7 U RPP1 SGDID:S000001104, Chr VIII from 223760-222879, reverse complement, Verified ORF, "Subunit of both RNase MRP, which cleaves pre-rRNA, and nuclear RNase P, which cleaves tRNA precursors to generate mature 5' ends" * Jamie_Mitco_SPB_49.17412.17412.4 3.4504 0.1002 95.1 5921.4966 5926.717 10770.5 108 3.173 14.2 1 K.NRLRGNLLVLS*ALDGMAKSCRDSPLGLNKILST*VGLINRCELPSMAGSGIVIGR.S YGL075C 4 4 18.3% 387 44585 8.3 U MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" * Jamie_Mitco_SPB_66.23598.23598.2 3.4292 0.1664 100.0 3118.7722 3118.4395 6834.8 1 4.593 35.2 1 R.EILENAFIGVDSIPSDFIVSMNLNS*PSK.F * Jamie_Mitco_SPB_9.02997.02997.2 2.1436 0.1921 99.5 1424.2922 1425.4551 4972.2 13 3.954 62.5 1 K.NKNTEGAGIST*PR.K * Jamie_Mitco_SPB_39.13927.13927.2 2.0226 0.0663 95.1 1661.3322 1661.8981 7860.2 344 3.415 42.3 1 R.LQLSWWENSGILSK.I * Jamie_Mitco_SPB_77.27623.27623.2 2.2016 0.1519 99.6 2092.0122 2092.269 6840.3 31 4.0 40.0 1 K.IVWFFEDQTDLETEYR.S YHL033C 2 2 16.0% 256 28125 10.0 U RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" YLL045C 2 2 16.0% 256 28112 10.0 U RPL8B SGDID:S000003968, Chr XII from 48628-47858, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" Jamie_Mitco_SPB_70.25153.25153.2 2.0706 0.1384 99.2 2196.0723 2196.5298 8365.2 117 3.68 30.0 1 -.MAPGKKVAPAPFGAKST*KSNK.T Jamie_Mitco_SPB_24.08328.08328.2 3.1719 0.1321 99.7 2016.2722 2017.2438 6727.5 6 4.243 44.7 1 K.TSAVAALTEVRAEDEAALAK.L YOR096W 1 1 14.7% 190 21622 9.8 U RPS7A SGDID:S000005622, Chr XV from 505794-505937,506339-506767, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Bp; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" * Jamie_Mitco_SPB_64.22800.22800.2 2.4616 0.2083 99.7 3083.7122 3085.4785 10753.8 2 5.615 27.8 1 K.ILSQAPTELELQVAQAFVELENSSPELK.A YJR082C 1 1 14.2% 113 12895 6.4 U EAF6 SGDID:S000003842, Chr X from 582169-581828, reverse complement, Uncharacterized ORF, "Esa1p-associated factor, subunit of the NuA4 acetyltransferase complex" * Jamie_Mitco_SPB_26.09334.09334.2 2.5666 0.0456 98.9 2017.4521 2016.082 7578.1 1 3.908 53.3 1 R.EQEDTFDNLQQEIYDK.E YLR061W 1 1 14.0% 121 13693 6.2 U RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" * Jamie_Mitco_SPB_28.09873.09873.2 2.644 0.2355 99.7 2074.372 2073.0845 7960.8 2 4.225 50.0 1 R.LAFYQVTPEEDEEEDEE.- Reverse_YFR047C 1 1 13.9% 295 32365 5.8 U BNA6 SGDID:S000001943, Chr VI from 245153-244266, reverse complement, Verified ORF, "Quinolinate phosphoribosyl transferase, required for biosynthesis of nicotinic acid from tryptophan via kynurenine pathway" * Jamie_Mitco_SPB_67.23968.23968.4 2.9688 0.0931 90.3 4882.9365 4888.3823 7606.5 64 3.156 16.7 1 K.VANTIS*GT*AWIHNDKLMVMSSLDYRHTDCGGVLMSYKELRR.L YAL005C 6 6 13.7% 642 69768 5.1 U SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" Jamie_Mitco_SPB_14.04699.04699.2 4.1855 0.3804 100.0 1677.9122 1676.6964 7247.5 1 6.707 73.3 1 K.ATAGDTHLGGEDFDNR.L Jamie_Mitco_SPB_21.07285.07285.2 2.223 0.2043 99.5 1817.5521 1817.0496 6833.1 1 4.008 46.9 1 K.LDKSQVDEIVLVGGSTR.I Jamie_Mitco_SPB_8.02673.02673.2 1.9356 0.0763 96.9 1019.3722 1018.1582 3809.6 319 3.779 68.8 1 K.ITITNDKGR.L Jamie_Mitco_SPB_32.11415.11415.3 3.7222 0.2047 100.0 3128.4844 3127.4475 5160.6 1 4.4 25.0 1 R.LSKEDIEKMVAEAEKFKEEDEKESQR.I Jamie_Mitco_SPB_32.11512.11512.4 3.5321 0.0739 93.5 3128.6565 3127.4475 8571.5 11 3.946 25.3 1 R.LSKEDIEKMVAEAEKFKEEDEKESQR.I * Jamie_Mitco_SPB_16.05693.05693.3 3.6953 0.292 100.0 2166.1743 2164.3313 4524.9 2 5.088 32.9 1 K.NTISEAGDKLEQADKDTVTK.K YGL008C 8 8 13.6% 918 99619 5.1 U PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" * Jamie_Mitco_SPB_51.18174.18174.2 4.4664 0.4157 100.0 3262.7122 3261.6104 4313.0 1 7.211 35.0 1 R.DGQLVEIPANEVVPGDILQLEDGTVIPTDGR.I Jamie_Mitco_SPB_13.04447.04447.2 2.9765 0.1659 99.7 1274.1322 1273.3855 6823.8 24 4.739 63.6 1 K.VTAVVESPEGER.I Jamie_Mitco_SPB_34.12081.12081.4 5.2655 0.377 100.0 3845.9365 3848.261 6807.9 1 5.919 22.2 1 K.GAPLFVLKTVEEDHPIPEDVHENYENKVAELASR.G Jamie_Mitco_SPB_13.04653.04653.3 3.2543 0.0935 95.1 2296.2844 2295.3806 8090.4 5 3.799 34.7 1 K.TVEEDHPIPEDVHENYENK.V Jamie_Mitco_SPB_20.07186.07186.3 5.8784 0.418 100.0 3020.1843 3022.2114 6725.3 1 8.742 40.0 1 K.TVEEDHPIPEDVHENYENKVAELASR.G Jamie_Mitco_SPB_21.07229.07229.4 4.33 0.371 100.0 3020.2566 3022.2114 7383.2 1 6.195 28.0 1 K.TVEEDHPIPEDVHENYENKVAELASR.G Jamie_Mitco_SPB_54.19427.19427.3 5.8783 0.4904 100.0 3262.6743 3263.5623 6526.1 1 7.99 31.5 1 R.LGLGGGGDMPGSELADFVENADGFAEVFPQHK.Y Jamie_Mitco_SPB_13.04528.04528.2 2.2325 7.0E-4 90.6 1548.8522 1546.6775 6650.0 3 2.96 53.3 1 K.KADTGIAVEGATDAAR.S YLR044C 3 3 13.5% 563 61495 6.2 U PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" * Jamie_Mitco_SPB_56.19860.19860.3 4.001 0.1861 100.0 3511.3442 3511.0735 7661.3 1 4.75 27.5 1 R.LKQVNVNTVFGLPGDFNLSLLDKIYEVEGMR.W * Jamie_Mitco_SPB_59.21117.21117.3 4.3074 0.2259 100.0 3324.4443 3325.883 6402.3 10 5.389 25.9 1 K.LLQTPIDMSLKPNDAESEKEVIDTILALVK.D * Jamie_Mitco_SPB_16.05487.05487.2 2.8078 0.236 100.0 1596.5521 1597.8516 4735.1 1 5.222 60.7 1 R.YGGVYVGTLSKPEVK.E YNR003C 1 1 13.2% 317 36135 5.4 U RPC34 SGDID:S000005286, Chr XIV from 635299-634346, reverse complement, Verified ORF, "RNA polymerase III subunit C34; interacts with TFIIIB70 and is a key determinant in pol III recruitment by the preinitiation complex" * Jamie_Mitco_SPB_51.18015.18015.4 3.799 0.0256 91.1 4824.4565 4825.275 8781.5 267 2.564 15.0 1 K.FQGVLES*EAQKKATMSAEEALVYSY*IEASGREGIWSKTIKAR.T Reverse_YPR110C 1 1 12.8% 335 37687 5.5 U RPC40 SGDID:S000006314, Chr XVI from 746833-745826, reverse complement, Verified ORF, "RNA polymerase subunit, common to RNA polymerase I and III" * Jamie_Mitco_SPB_99.35472.35472.4 2.9095 0.1654 96.0 5062.7363 5063.515 10087.0 102 3.517 15.9 1 R.LKALLIDPDAPVVPCDAFTTSQRGQPEFKLDRAY*VHANNY*LEK.P YGL103W 1 1 12.8% 149 16722 10.6 U RPL28 SGDID:S000003071, Chr VII from 310970-311018,311530-311930, Verified ORF, "Ribosomal protein L29 of the large (60S) ribosomal subunit, has similarity to E. coli L15 and rat L27a ribosomal proteins; may have peptidyl transferase activity; can mutate to cycloheximide resistance" * Jamie_Mitco_SPB_19.06655.06655.2 2.5833 0.3101 100.0 1878.5721 1880.1051 7832.7 1 6.504 50.0 1 K.SASKETAPVIDTLAAGYGK.I YBR213W 1 1 12.0% 274 31918 6.3 U MET8 SGDID:S000000417, Chr II from 650363-651187, Verified ORF, "Bifunctional dehydrogenase and ferrochelatase, involved in the biosynthesis of siroheme; also involved in the expression of PAPS reductase and sulfite reductase" * Jamie_Mitco_SPB_62.22257.22257.4 3.69 0.1776 100.0 3740.0964 3737.2983 7049.4 301 3.463 18.2 1 K.ILLIGGGEVGLTRLYKLIPT*GCKLTLVS*PDLHK.S YOL040C 1 1 12.0% 142 16002 10.7 U RPS15 SGDID:S000005400, Chr XV from 253575-253147, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S19 and rat S15 ribosomal proteins" * Jamie_Mitco_SPB_51.18190.18190.2 4.2788 0.3062 100.0 1955.4922 1954.2428 8227.8 1 5.673 59.4 1 R.GVDLEKLLEMSTEDFVK.L YEL066W 1 1 11.7% 179 20699 7.6 U HPA3 SGDID:S000000792, Chr V from 26667-27206, Verified ORF, "D-Amino acid N-acetyltransferase, catalyzes N-acetylation of D-amino acids through ordered bi-bi mechanism in which acetyl-CoA is first substrate bound and CoA is last product liberated; similar to Hpa2p, acetylates histones weakly in vitro" * Jamie_Mitco_SPB_24.08358.08358.2 1.7633 0.0954 92.6 2481.632 2482.7246 8508.6 34 4.011 30.0 1 K.T*VMPPEVATTTFARFIDPT*VK.L YIL148W 2 3 11.7% 128 14554 9.8 U RPL40A SGDID:S000001410, Chr IX from 68708-68715,69150-69528, Verified ORF, "Fusion protein, identical to Rpl40Bp, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" YLR167W 2 3 9.9% 152 17216 9.9 U RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" YLL039C 2 3 3.9% 381 42826 7.6 U UBI4 SGDID:S000003962, Chr XII from 65206-64061, reverse complement, Verified ORF, "Ubiquitin, becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response" YKR094C 2 3 11.7% 128 14554 9.8 U RPL40B SGDID:S000001802, Chr XI from 618392-618385,618016-617638, reverse complement, Verified ORF, "Fusion protein, identical to Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" Jamie_Mitco_SPB_12.04164.04164.2 3.0442 0.2933 100.0 1739.1122 1739.926 6525.7 1 5.681 57.1 1 K.SKIQDKEGIPPDQQR.L Jamie_Mitco_SPB_10.03565.03565.2 2.7065 0.1943 99.7 1525.1522 1524.6738 5013.1 1 4.574 70.8 2 K.IQDKEGIPPDQQR.L YMR186W 4 4 11.5% 705 80900 4.8 U HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" * Jamie_Mitco_SPB_34.11919.11919.2 3.9421 0.4944 100.0 1746.6721 1746.0593 6751.9 1 7.586 60.7 1 R.HSEFVAYPIQLLVTK.E Jamie_Mitco_SPB_23.07937.07937.2 2.3927 0.1498 99.5 1820.4922 1819.922 8161.5 1 3.836 53.6 1 R.NPSDITQEEYNAFYK.S Jamie_Mitco_SPB_84.30210.30210.3 3.4313 0.0542 91.0 3748.7644 3748.2214 9122.3 2 3.356 21.1 1 R.VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSR.E * Jamie_Mitco_SPB_34.12101.12101.2 3.0788 0.2622 100.0 2127.5322 2127.3123 7641.3 8 4.887 41.2 1 K.KLIEAFNEIAEDSEQFDK.F YGL019W 1 1 11.5% 278 32265 4.6 U CKB1 SGDID:S000002987, Chr VII from 458161-458997, Verified ORF, "Beta regulatory subunit of casein kinase 2, a Ser/Thr protein kinase with roles in cell growth and proliferation; the holoenzyme also contains CKA1, CKA2 and CKB2, the many substrates include transcription factors and all RNA polymerases" * Jamie_Mitco_SPB_68.24478.24478.4 3.9965 0.1084 99.0 3963.0566 3966.2236 7680.2 80 3.29 19.4 1 K.ELEEYVERKSKESY*ELKVFGFRINDEAVS*GPR.M Reverse_YLR078C 1 1 11.5% 244 27500 8.9 U BOS1 SGDID:S000004068, Chr XII from 286560-286558,286468-285737, reverse complement, Verified ORF, "v-SNARE (vesicle specific SNAP receptor), localized to the endoplasmic reticulum membrane and necessary for vesicular transport from the ER to the Golgi" * Jamie_Mitco_SPB_68.24419.24419.4 2.8273 0.1067 90.6 2802.6565 2797.9585 4130.4 447 3.162 22.8 1 K.QLGQY*LPLGGGNSSGEKGNASAGGVNRK.N Reverse_YNL093W 1 1 11.4% 220 24648 5.2 U YPT53 SGDID:S000005037, Chr XIV from 449870-450532, Verified ORF, "GTPase, similar to Ypt51p and Ypt52p and to mammalian rab5; required for vacuolar protein sorting and endocytosis" * Jamie_Mitco_SPB_65.23164.23164.3 3.2531 0.1018 93.8 2939.6643 2938.267 7336.1 97 3.347 24.0 1 R.TIRKTLFAAGITPEKS*EKFDDSVFR.L YNR037C 1 1 11.0% 91 10275 10.5 U RSM19 SGDID:S000005320, Chr XIV from 695329-695054, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the small subunit, has similarity to E. coli S19 ribosomal protein" * Jamie_Mitco_SPB_7.02501.02501.2 2.6631 0.1208 99.5 1103.4521 1104.3098 5896.7 49 3.92 61.1 1 R.EAMTKGTPIR.T YBR048W 1 1 10.9% 156 17749 10.8 U RPS11B SGDID:S000000252, Chr II from 332829-332873,333385-333810, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Ap and has similarity to E. coli S17 and rat S11 ribosomal proteins" YDR025W 1 1 10.9% 156 17749 10.8 U RPS11A SGDID:S000002432, Chr IV from 491511-491555,491895-492320, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins" Jamie_Mitco_SPB_17.06025.06025.2 2.8173 0.1069 99.5 1857.6322 1857.1266 6546.3 275 4.413 37.5 1 R.VQVGDIVTVGQCRPISK.T YDR172W 4 4 10.8% 685 76551 7.0 U SUP35 SGDID:S000002579, Chr IV from 808319-810376, Verified ORF, "Translation termination factor eRF3; altered protein conformation creates the [PSI(+)] prion, a dominant cytoplasmically inherited protein aggregate that alters translational fidelity and creates a nonsense suppressor phenotype" * Jamie_Mitco_SPB_31.10953.10953.2 4.5803 0.488 100.0 2069.4521 2070.1458 9209.9 1 9.255 61.8 1 K.EQEEEVDDEVVNDMFGGK.D * Jamie_Mitco_SPB_24.08521.08521.3 2.5588 0.1324 92.0 1815.7743 1813.079 4725.6 38 3.629 39.1 1 K.STMGGNLLYLTGSVDKR.T * Jamie_Mitco_SPB_25.08728.08728.2 2.6584 0.2125 99.7 1423.9321 1423.7594 6997.9 3 5.347 62.5 1 R.HINAPFMLPIAAK.M * Jamie_Mitco_SPB_48.16999.16999.2 4.3409 0.4723 100.0 3017.0122 3017.2725 9603.0 1 8.115 38.0 1 K.TAVEIQNIYNETENEVDMAMCGEQVK.L YNL210W 1 1 10.7% 270 31111 7.4 U MER1 SGDID:S000005154, Chr XIV from 250932-251744, Verified ORF, "Protein with RNA-binding motifs required for meiosis-specific mRNA splicing; required for chromosome pairing and meiotic recombination" * Jamie_Mitco_SPB_36.12768.12768.4 3.5308 0.189 100.0 3320.7366 3321.7158 6668.9 75 3.891 24.4 1 K.LNKTQITFLIGAKGTRIES*LREKS*GASIK.I YOR385W 1 1 10.3% 290 34064 8.8 U YOR385W SGDID:S000005912, Chr XV from 1065039-1065911, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_95.33846.33846.4 3.4453 0.12 96.3 3566.0964 3568.931 5225.2 166 3.732 21.8 1 K.ERQKPDQGKSKAPDFVIGHYT*RTFSDILPR.S Reverse_YLR008C 1 1 10.1% 168 17910 9.5 U PAM18 SGDID:S000003998, Chr XII from 166082-165576, reverse complement, Verified ORF, "Constituent of the mitochondrial import motor associated with the presequence translocase, along with Ssc1p, Tim44p, Mge1p, and Pam16p; stimulates the ATPase activity of Ssc1p to drive mitochondrial import; contains a J domain" * Jamie_Mitco_SPB_17.05830.05830.2 2.2883 0.0549 96.4 1789.0322 1789.9835 6691.4 216 3.018 34.4 1 K.LFATTS*KGGNLGKSISK.Y YGR215W 1 1 10.0% 110 12393 10.2 U RSM27 SGDID:S000003447, Chr VII from 922180-922512, Verified ORF, "Mitochondrial ribosomal protein of the small subunit" * Jamie_Mitco_SPB_6.02119.02119.2 1.7595 0.0802 93.2 1018.77216 1018.1582 6585.7 11 3.847 70.0 1 K.DAAATAKGKGK.K YNL126W 4 5 9.9% 846 98227 7.5 U SPC98 SGDID:S000005070, Chr XIV from 387229-389769, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" * Jamie_Mitco_SPB_23.08157.08157.3 4.213 0.4101 100.0 2218.6743 2219.4802 5747.7 2 6.552 40.8 1 K.SSGLNMENLANHEHLLSPVR.A * Jamie_Mitco_SPB_25.08877.08877.2 3.347 0.4039 100.0 1812.3522 1811.8744 4958.6 1 6.779 57.1 1 R.APSIYTEAS*FENMDR.F * Jamie_Mitco_SPB_51.18215.18215.3 4.135 0.3509 100.0 3885.6843 3885.1047 9978.6 1 6.645 25.8 2 R.ATYGEFFIAENTDTNGTDDDFIYHIPIEFNQER.V * Jamie_Mitco_SPB_25.08839.08839.2 3.186 0.2311 100.0 1808.5322 1807.9952 5326.7 2 4.903 56.7 1 R.ADLKNDGDEELFLLSK.S YAL038W 3 3 9.8% 500 54545 7.7 U CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" * Jamie_Mitco_SPB_23.08206.08206.3 2.6815 0.1462 94.3 2186.5745 2186.4705 4409.8 129 3.673 31.6 1 R.TANDVLTIREVLGEQGKDVK.I * Jamie_Mitco_SPB_43.15252.15252.3 4.3759 0.4344 100.0 2571.5044 2570.8174 7879.6 1 7.64 35.7 1 R.GVFPFVFEKEPVSDWTDDVEAR.I * Jamie_Mitco_SPB_15.05401.05401.1 1.6211 0.0309 91.8 821.01 820.964 7094.4 16 3.812 75.0 1 R.INFGIEK.A YOR078W 1 1 9.8% 214 24385 6.6 U BUD21 SGDID:S000005604, Chr XV from 472726-473370, Verified ORF, "Component of small ribosomal subunit (SSU) processosome that contains U3 snoRNA; originally isolated as bud-site selection mutant that displays a random budding pattern" * Jamie_Mitco_SPB_52.18400.18400.2 2.8328 0.0874 99.6 2358.2122 2358.6018 9599.5 27 4.34 32.5 1 K.SVNETEVTDEVIAELPEELLK.N Reverse_YDL083C 1 1 9.8% 143 15847 10.3 U RPS16B SGDID:S000002241, Chr IV from 307789-307766,307333-306926, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Ap and has similarity to E. coli S9 and rat S16 ribosomal proteins" Reverse_YMR143W 1 1 9.8% 143 15847 10.3 U RPS16A SGDID:S000004751, Chr XIII from 551927-551950,552495-552902, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Bp and has similarity to E. coli S9 and rat S16 ribosomal proteins" Jamie_Mitco_SPB_66.23545.23545.2 1.831 0.1441 98.0 1522.1122 1524.6334 5125.5 24 3.556 42.3 1 R.IAYVQS*VHGGGTVR.V YHR172W 6 7 9.4% 823 96825 6.4 U SPC97 SGDID:S000001215, Chr VIII from 448335-450806, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" * Jamie_Mitco_SPB_72.25745.25745.3 3.4109 0.3398 100.0 2713.0444 2713.2363 7878.1 1 5.568 30.4 1 R.RVQEALVVKDLLNVLIGLEGTYIR.Y * Jamie_Mitco_SPB_73.26220.26220.2 3.3197 0.378 100.0 2554.9321 2557.0488 11354.1 1 6.48 43.2 1 R.VQEALVVKDLLNVLIGLEGTYIR.Y * Jamie_Mitco_SPB_29.10120.10120.2 3.8463 0.3344 100.0 2092.2722 2092.2227 6173.9 1 6.083 53.1 2 R.YFNDYEPSDPETPIEFK.I * Jamie_Mitco_SPB_22.07859.07859.3 3.5153 0.0345 91.6 2213.2144 2210.4119 8737.7 2 2.893 36.8 1 K.DVLLRDCDSEEDKNLLFK.M * Jamie_Mitco_SPB_16.05646.05646.2 3.7386 0.1541 100.0 1615.1721 1613.6844 6256.6 1 4.7 75.0 1 R.DCDSEEDKNLLFK.M * Jamie_Mitco_SPB_32.11273.11273.2 3.2322 0.1547 99.7 2210.672 2211.3525 7740.1 1 4.383 47.1 1 R.NDNNANYDKLLQNFELER.Q Reverse_YOR180C 1 1 9.2% 271 30058 8.6 U DCI1 SGDID:S000005706, Chr XV from 675167-674352, reverse complement, Verified ORF, "Peroxisomal delta(3,5)-delta(2,4)-dienoyl-CoA isomerase, involved in fatty acid metabolism, contains peroxisome targeting signals at amino and carboxy termini" * Jamie_Mitco_SPB_90.32245.32245.4 2.81 0.1462 94.1 2839.9365 2839.9 4823.3 287 3.307 25.7 1 K.EVESTVDGDNLKNVAS*FKGGSSFY*K.G YLR441C 2 2 9.0% 255 28743 10.0 U RPS1A SGDID:S000004433, Chr XII from 1018904-1018137, reverse complement, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein" YML063W 2 2 9.0% 255 28812 10.0 U RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein" Jamie_Mitco_SPB_19.06657.06657.2 2.3035 0.13 99.6 1460.3322 1459.7294 7184.4 42 4.181 53.8 1 R.NVGKTLVNKSTGLK.S Jamie_Mitco_SPB_11.03906.03906.2 2.2984 0.1511 99.5 1043.6322 1044.196 5553.7 42 4.054 68.8 1 K.LRVDEVQGK.N Reverse_YKL196C 1 1 9.0% 200 22707 5.7 U YKT6 SGDID:S000001679, Chr XI from 75539-74937, reverse complement, Verified ORF, "Vesicle membrane protein (v-SNARE) with acyltransferase activity; involved in trafficking to and within the Golgi, endocytic trafficking to the vacuole, and vacuolar fusion; membrane localization due to prenylation at the carboxy-terminus" * Jamie_Mitco_SPB_62.22107.22107.2 2.1575 0.0868 97.3 2163.392 2165.3652 8046.5 63 3.516 35.3 1 K.DVLNDLKEGRQLVNEIT*K.H YML083C 1 1 8.9% 418 47350 9.1 U YML083C SGDID:S000004548, Chr XIII from 101050-99794, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_108.38609.38609.4 3.3639 0.0978 94.6 4401.9365 4398.8584 4800.9 19 2.941 19.0 1 R.KIPNYIGCAKTKAQLS*KVRS*GKQLIACAQEYHHPVNK.D YOR260W 1 1 8.5% 578 65700 5.0 U GCD1 SGDID:S000005786, Chr XV from 813982-815718, Verified ORF, "Gamma subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression" * Jamie_Mitco_SPB_76.27299.27299.4 2.524 0.1432 91.2 5656.9365 5652.39 6978.8 163 3.213 13.2 1 K.KINFIPSKANS*TGESLQKELLPRINGDFVILPCDFVTDIPPQVLVDQFR.N YDR005C 1 1 8.4% 395 44733 5.3 U MAF1 SGDID:S000002412, Chr IV from 458100-458095,458014-456833, reverse complement, Verified ORF, "Negative regulator of RNA polymerase III; component of several signaling pathways that repress polymerase III transcription in response to changes in cellular environment; targets the initiation factor TFIIIB" * Jamie_Mitco_SPB_52.18369.18369.4 3.2517 0.1597 98.7 3661.2166 3660.816 7339.8 303 3.106 18.8 1 R.RRSSSSISSFKSGKS*SNNNYSSGTATNNVNKRR.K YGR027C 1 1 8.3% 108 12039 10.3 U RPS25A SGDID:S000003259, Chr VII from 534462-534136, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Bp and has similarity to rat S25 ribosomal protein" YLR333C 1 1 8.3% 108 12009 10.3 U RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein" Jamie_Mitco_SPB_3.00766.00766.1 2.7003 0.243 100.0 730.17 729.85455 8994.3 1 3.998 75.0 1 K.AAAALAGGK.K YDR212W 3 3 8.1% 559 60481 6.5 U TCP1 SGDID:S000002620, Chr IV from 887227-888906, Verified ORF, "Alpha subunit of chaperonin-containing T-complex, which mediates protein folding in the cytosol; involved in maintenance of actin cytoskeleton; homolog to Drosophila melanogaster and mouse tailless complex polypeptide" * Jamie_Mitco_SPB_23.07956.07956.2 1.9963 0.0775 95.3 1824.4122 1823.9977 6682.9 48 3.271 37.5 1 R.SDTLFLGGEKISGDDIR.N * Jamie_Mitco_SPB_16.05746.05746.2 2.3644 0.0999 99.2 1402.5521 1400.4596 7530.9 1 3.232 68.2 1 R.GANDYSLDEMER.S * Jamie_Mitco_SPB_15.05232.05232.2 2.7349 0.1289 99.5 1619.1322 1617.84 7687.7 2 4.677 50.0 1 K.TLAVNAAKDSSELVAK.L YOL054W 2 2 8.1% 406 47068 4.4 U YOL054W SGDID:S000005415, Chr XV from 228612-229832, Uncharacterized ORF, "Nuclear protein, putative RNA polymerase II elongation factor; isolated as Pob3p/Spt16p-binding protein" * Jamie_Mitco_SPB_17.05961.05961.2 4.7384 0.416 100.0 1701.6921 1700.6702 6105.2 1 7.783 76.7 1 K.NSALAVADDS*DDGITR.C * Jamie_Mitco_SPB_31.10965.10965.2 3.5293 0.3145 100.0 2184.632 2185.0864 8973.3 1 5.377 50.0 1 R.DEFDEEEYS*EGELDEIR.E YGR156W 1 1 8.0% 425 46983 6.3 U PTI1 SGDID:S000003388, Chr VII from 800551-801828, Verified ORF, "Pta1p Interacting protein" * Jamie_Mitco_SPB_108.38633.38633.4 3.1431 0.1006 92.2 3943.7766 3947.498 4812.5 119 3.074 19.2 1 K.NSQKQVLQLNRDSYPFEAGLELPFEMVTEVPIPR.R Reverse_YDR473C 1 1 7.9% 469 55870 8.6 U PRP3 SGDID:S000002881, Chr IV from 1405844-1404435, reverse complement, Verified ORF, "Splicing factor, component of the U4/U6-U5 snRNP complex" * Jamie_Mitco_SPB_48.17190.17190.4 3.6052 0.1277 98.4 4405.5366 4406.9775 6732.6 11 3.495 18.1 1 K.CS*KENGVVIIIGPGDDRIRLCLGKLS*LEKSNMKLKFR.I YGR234W 1 1 7.8% 399 44646 6.3 U YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" * Jamie_Mitco_SPB_92.33097.33097.2 3.0527 0.448 100.0 3350.5522 3349.762 8685.8 1 7.807 26.7 1 K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K YBR270C 1 1 7.7% 545 61302 8.8 U YBR270C SGDID:S000000474, Chr II from 744393-742756, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_96.34411.34411.4 3.2162 0.2078 100.0 4788.2163 4783.305 9286.3 53 3.834 16.3 1 K.LFHTKS*NMSVNSLQSSLSTGHSHSNKGS*NVFSKMAKKLLPYK.P YOR230W 1 1 7.6% 437 48383 5.4 U WTM1 SGDID:S000005756, Chr XV from 770800-772113, Verified ORF, "Transcriptional repressor involved in regulation of meiosis and silencing; contains WD repeats" * Jamie_Mitco_SPB_49.17375.17375.3 3.2584 0.1241 95.9 3695.9043 3693.9995 7917.6 1 3.928 23.4 1 R.NTAAWHPVIENLVGTVDDDSLVSIYKPYTEESE.- YGR254W 1 1 7.6% 437 46816 6.6 U ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" YHR174W 1 1 7.6% 437 46914 6.0 U ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" Jamie_Mitco_SPB_71.25339.25339.2 3.1046 0.3746 100.0 3258.9521 3259.551 5134.1 1 6.709 28.1 1 R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A YDR002W 1 1 7.5% 201 22953 6.1 U YRB1 SGDID:S000002409, Chr IV from 453042-453647, Verified ORF, "Ran GTpase binding protein; involved in nuclear protein import and RNA export, ubiquitin-mediated protein degradation during the cell cycle; shuttles between the nucleus and cytoplasm; is essential; homolog of human RanBP1" * Jamie_Mitco_SPB_63.22503.22503.2 2.1553 0.0202 91.7 1859.1522 1856.9384 6872.4 84 3.196 39.3 1 K.KAEKPETKKDEEDT*K.E YGR097W 4 4 7.4% 1146 126864 9.3 U ASK10 SGDID:S000003329, Chr VII from 678699-682139, Verified ORF, "Component of the RNA polymerase II holoenzyme, phosphorylated in response to oxidative stress; has a role in destruction of Ssn8p, which relieves repression of stress-response genes" * Jamie_Mitco_SPB_21.07439.07439.2 4.0078 0.0805 99.7 2202.2922 2202.2097 8305.6 1 6.645 52.5 1 K.SSAYS*SSVSIADTYANANNAK.A * Jamie_Mitco_SPB_34.12037.12037.3 3.1373 0.0948 91.5 3368.3044 3370.4448 7069.7 362 3.274 19.8 1 R.NSVNIGSHTPCLTDS*T*FTLQDGTTTSVNLK.G * Jamie_Mitco_SPB_29.10138.10138.2 4.0697 0.361 100.0 1890.7922 1891.088 8568.7 1 7.565 68.8 1 K.VNTPAIDDYGNLITVER.R * Jamie_Mitco_SPB_12.04193.04193.2 3.7415 0.3615 100.0 1777.0922 1776.7281 4171.3 1 7.383 59.4 1 R.GNNS*AQNLTTSSSTASR.V YCL054W 3 3 7.4% 841 96485 8.0 U SPB1 SGDID:S000000559, Chr III from 31449-33974, Verified ORF, "AdoMet-dependent methyltransferase involved in rRNA processing and 60S ribosomal subunit maturation; methylates G2922 in the putative tRNA docking site of the large subunit rRNA and in the absence of snR52, U2921; suppressor of PAB1 mutants" * Jamie_Mitco_SPB_40.14383.14383.2 2.3591 0.1945 99.5 2567.912 2567.651 10336.8 3 5.265 34.1 1 K.DKDSAADADDLESELNAMYSDYK.T * Jamie_Mitco_SPB_22.07752.07752.2 4.2832 0.4209 100.0 1998.7722 1999.0111 5998.8 1 7.882 58.8 1 R.GGDNEEEWTGFNEGSLEK.K * Jamie_Mitco_SPB_46.16539.16539.2 3.0884 0.2218 100.0 2241.7522 2239.592 10105.9 1 4.479 40.0 1 R.DIDIATVEAMTLAHQLALGQK.N YCR094W 1 1 7.4% 391 44982 7.7 U CDC50 SGDID:S000000690, Chr III from 286758-287933, Verified ORF, "Endosomal protein that regulates cell polarity; similar to Ynr048wp and Lem3p" * Jamie_Mitco_SPB_16.05405.05405.4 4.3262 0.252 100.0 3349.1365 3354.7964 6484.4 454 4.197 19.6 1 K.APPLT*KEGPTSKKPPNTAFRQQRLKAWQP.I YGR054W 1 1 7.2% 642 71305 8.9 U YGR054W SGDID:S000003286, Chr VII from 596697-598625, Uncharacterized ORF, "yeast homolog of mammalian eIF2A" * Jamie_Mitco_SPB_42.14827.14827.4 3.1129 0.0968 91.5 5071.5366 5066.3457 5799.9 15 2.946 14.8 1 K.ISNKSELQIHSSVQEYISQHPSREAS*SNGNGS*KAKAGGAYKPPHAR.R YDL229W 3 3 7.2% 613 66602 5.4 U SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" YNL209W 3 3 7.2% 613 66595 5.5 U SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" Jamie_Mitco_SPB_37.13061.13061.2 4.0896 0.4546 100.0 2161.0522 2161.4138 8259.2 1 7.65 41.7 1 K.VIDVDGNPVIEVQYLEETK.T Jamie_Mitco_SPB_51.18205.18205.2 2.7246 0.083 99.6 2628.4321 2627.9084 9789.5 1 3.775 35.4 1 K.SKIEAALSDALAALQIEDPSADELR.K Jamie_Mitco_SPB_49.17431.17431.2 3.3197 0.4271 100.0 2412.5522 2412.6562 8978.2 1 8.808 43.2 1 K.IEAALSDALAALQIEDPSADELR.K YDR412W 1 1 7.2% 235 27974 9.4 U YDR412W SGDID:S000002820, Chr IV from 1294683-1295390, Uncharacterized ORF, "Protein required for cell viability" * Jamie_Mitco_SPB_40.14344.14344.3 2.6907 0.0948 90.1 2149.0745 2149.1492 5794.3 60 3.245 32.8 1 K.QS*KKFGTDEVT*FDKDSR.L YBR181C 1 1 7.2% 236 26996 10.4 U RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein" YPL090C 1 1 7.2% 236 26996 10.4 U RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein" Jamie_Mitco_SPB_15.05227.05227.2 2.7504 0.327 100.0 1900.2922 1902.1118 5633.4 2 5.556 43.8 1 K.KGEQELEGLTDTTVPKR.L Reverse_YKL077W 1 1 7.1% 392 46036 8.9 U YKL077W SGDID:S000001560, Chr XI from 291097-292275, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the vacuole" * Jamie_Mitco_SPB_59.21162.21162.3 2.7169 0.1284 91.2 3650.2144 3650.1682 9241.3 29 3.441 22.2 1 K.YSPLETY*KHNKMNKFKKMES*FKGLVRRK.K YLR340W 1 2 7.1% 312 33717 4.8 U RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" * Jamie_Mitco_SPB_55.19663.19663.2 5.4308 0.465 100.0 2474.9521 2474.773 9614.0 1 8.746 52.4 2 K.DLLAVAIAASYHYPEIEDLVDR.I YML028W 1 1 7.1% 196 21590 5.1 U TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype" * Jamie_Mitco_SPB_34.12107.12107.2 2.3269 0.3262 100.0 1564.8522 1563.7478 7540.4 1 5.269 57.7 1 R.DYGVLIEEEGVALR.G YMR001C 3 3 7.0% 705 81031 9.0 U CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" * Jamie_Mitco_SPB_14.04785.04785.2 2.7158 0.3153 100.0 1743.2722 1743.9578 5053.1 232 5.171 43.3 1 K.LVHTPIKGNT*ADLVGK.E * Jamie_Mitco_SPB_33.11589.11589.2 2.6465 0.0839 99.2 2237.412 2236.511 8315.5 84 3.562 36.1 1 R.KYT*ICGTPNYIAPEVLMGK.H * Jamie_Mitco_SPB_19.06595.06595.2 3.644 0.3883 100.0 1607.8121 1607.8627 8248.7 1 7.177 73.1 1 K.SLLLESMSSDKIQR.Q YPL127C 1 1 7.0% 258 27804 10.2 U HHO1 SGDID:S000006048, Chr XVI from 309603-308827, reverse complement, Verified ORF, "Histone H1, a linker histone required for nucleosome packaging at restricted sites; suppresses DNA repair involving homologous recombination; not required for telomeric silencing, basal transcriptional repression, or efficient sporulation" * Jamie_Mitco_SPB_79.28371.28371.2 2.378 0.0836 99.2 2015.8722 2014.1106 5473.8 80 4.079 32.4 1 K.SPTVT*AKKASSPSS*LTYK.E Reverse_YLR248W 1 1 6.9% 610 68062 5.5 U RCK2 SGDID:S000004238, Chr XII from 634254-636086, Verified ORF, "Protein kinase involved in the response to oxidative and osmotic stress; identified as suppressor of S. pombe cell cycle checkpoint mutations" * Jamie_Mitco_SPB_97.34565.34565.4 3.4139 0.1081 95.3 4370.3364 4375.8364 6565.7 138 3.066 17.1 1 K.TNKSFIQKSLGFDALKVIGIGGGGVGPTFIGEDAKT*QPDDSK.R YOR315W 1 1 6.9% 346 39021 8.1 U SFG1 SGDID:S000005842, Chr XV from 904755-905795, Verified ORF, "Nuclear protein, putative transcription factor required for growth of superficial pseudohyphae (which do not invade the agar substrate) but not for invasive pseudohyphal growth; may act together with Phd1p; potential Cdc28p substrate" * Jamie_Mitco_SPB_60.21251.21251.3 3.0989 0.1109 93.9 2932.4343 2935.189 5128.9 5 3.786 26.1 1 K.CKYSSGFIAEDTTPSKRFRLY*QAK.F YML064C 1 1 6.9% 245 27296 9.4 U TEM1 SGDID:S000004529, Chr XIII from 145876-145139, reverse complement, Verified ORF, "GTP-binding protein of the ras superfamily involved in termination of M-phase; controls actomyosin and septin dynamics during cytokinesis" * Jamie_Mitco_SPB_42.15076.15076.2 2.9365 0.1339 99.7 2111.4321 2111.313 7879.2 21 4.262 43.8 1 K.YDLLIDLDPEYQEQISR.T YDR289C 1 1 6.8% 409 46488 4.9 U RTT103 SGDID:S000002697, Chr IV from 1039503-1038274, reverse complement, Verified ORF, "Protein that interacts with exonuclease Rat1p and Rai1p and plays a role in transcription termination by RNA polymerase II, has an RPR domain (carboxy-terminal domain interacting domain); also involved in regulation of Ty1 transposition" * Jamie_Mitco_SPB_28.10024.10024.4 3.5065 0.0807 93.8 3654.9365 3656.1284 9121.3 297 3.026 21.0 1 K.WLLLQY*RDAPKVAEMWKEY*MLRPSVNTR.R YBR189W 1 1 6.7% 195 22299 10.1 U RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Bp and has similarity to E. coli S4 and rat S9 ribosomal proteins" YPL081W 1 1 6.6% 197 22443 10.0 U RPS9A SGDID:S000006002, Chr XVI from 404947-404953,405455-406041, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins" Jamie_Mitco_SPB_17.05766.05766.2 1.9753 0.1233 99.2 1732.9321 1732.7178 5761.6 253 3.545 37.5 1 K.TYSTPKRPY*ES*SR.L Reverse_YLR094C 1 1 6.6% 502 56357 8.6 U GIS3 SGDID:S000004084, Chr XII from 329239-327731, reverse complement, Verified ORF, "Protein of unknown function" * Jamie_Mitco_SPB_109.38999.38999.3 2.8935 0.1236 92.2 3813.8643 3816.2537 9099.7 98 3.35 19.5 1 R.VQSMVS*SLSPTMLSSRNENLLESDDRAKLIRTR.K Reverse_YPR074C 1 1 6.5% 680 73806 7.0 U TKL1 SGDID:S000006278, Chr XVI from 694835-692793, reverse complement, Verified ORF, "Transketolase, similar to Tkl2p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids" * Jamie_Mitco_SPB_70.25164.25164.4 3.6569 0.063 92.6 4820.3765 4815.0923 9021.2 99 3.266 15.5 1 K.S*ASEIS*SGELQPLNQRSLAIISPTHKSELSNKYAASVENGDAPR.W YOL041C 1 1 6.5% 459 51942 9.4 U NOP12 SGDID:S000005401, Chr XV from 252644-251265, reverse complement, Verified ORF, "Nucleolar protein, required for pre-25S rRNA processing; contains an RNA recognition motif (RRM) and has similarity to Nop13p, Nsr1p, and putative orthologs in Drosophila and S. pombe" * Jamie_Mitco_SPB_16.05581.05581.3 3.32 0.1572 99.0 3202.6443 3204.4663 7461.6 1 4.324 23.3 1 K.LLNEEAEAEDDKPTVTKTDETSVPLTSAAK.K YPR108W 1 1 6.5% 429 48959 5.2 U RPN7 SGDID:S000006312, Chr XVI from 742452-743741, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome, similar to another S. cerevisiae regulatory subunit, Rpn5p, as well as to mammalian proteasome subunits" * Jamie_Mitco_SPB_60.21397.21397.2 3.2431 0.3359 100.0 3227.0522 3228.4065 7475.3 1 6.986 35.2 1 K.LEEDDEGELEQAQAWINLGEYYAQIGDK.D YKL152C 1 1 6.5% 247 27609 8.8 U GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis" * Jamie_Mitco_SPB_13.04473.04473.2 2.788 0.3026 100.0 1832.3322 1832.0665 5541.6 11 5.162 46.7 1 R.HYGDLQGKDKAETLKK.F YDR036C 1 1 6.4% 500 56288 8.3 U EHD3 SGDID:S000002443, Chr IV from 524709-523207, reverse complement, Verified ORF, "Protein of unconfirmed function, plays an indirect role in endocytic membrane trafficking, member of a family of enoyl-CoA hydratase/isomerases" * Jamie_Mitco_SPB_40.14098.14098.4 3.2677 0.0747 91.3 3837.8164 3834.3796 8520.6 113 3.442 19.4 1 R.VPYPWTKKEQLFVS*QLT*SITSPKPSLPMSLLR.N Reverse_YAR031W 1 1 6.4% 298 35073 8.0 U PRM9 SGDID:S000000078, Chr I from 186830-187726, Verified ORF, "Pheromone-regulated protein with 3 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; member of DUP240 gene family" Reverse_YGL053W 1 1 8.0% 237 27250 5.1 U PRM8 SGDID:S000003021, Chr VII from 402592-403305, Verified ORF, "Pheromone-regulated protein with 2 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; forms a complex with Prp9p in the ER; member of DUP240 gene family" Jamie_Mitco_SPB_48.17231.17231.2 3.3336 0.1483 91.9 2096.3123 2095.9097 7109.0 12 4.203 44.4 1 S.SEAAENPT*GATEDNS*QADK.V YEL005C 1 1 6.4% 282 31365 6.2 U VAB2 SGDID:S000000731, Chr V from 146754-145906, reverse complement, Verified ORF, "Protein with a potential role in vacuolar function, as suggested by its ability to bind Vac8p; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * Jamie_Mitco_SPB_52.18609.18609.2 2.1091 0.0316 92.1 2070.7322 2068.421 9068.9 8 3.194 35.3 1 K.LTQAAIFNSTKYELLQVK.K YHR161C 1 1 6.3% 637 71660 7.0 U YAP1801 SGDID:S000001204, Chr VIII from 422289-420376, reverse complement, Verified ORF, "Protein involved in clathrin cage assembly; binds Pan1p and clathrin; homologous to Yap1802p, member of the AP180 protein family" * Jamie_Mitco_SPB_50.17775.17775.3 2.2453 0.2148 94.8 4488.744 4491.8296 8398.0 276 3.659 16.0 1 K.HIT*T*KLVRSLEEHLIEDDKTHNTFVPVDSSQGSAGAVVAK.S YER130C 1 1 6.3% 443 50320 5.8 U YER130C SGDID:S000000932, Chr V from 422442-421111, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_53.18937.18937.4 3.3047 0.1421 97.2 3762.0964 3759.1848 6401.1 143 3.401 23.5 1 R.FKRQEHLKRHVRSLHMCEKPFT*CHICNK.N YLR303W 1 1 6.3% 444 48672 6.4 U MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" * Jamie_Mitco_SPB_104.37212.37212.2 1.8478 0.1099 95.3 3104.132 3102.4675 9678.5 141 3.577 22.2 1 R.VSVGIEFIDDIIADFQQSFETVFAGQKP.- YDR354W 1 1 6.3% 380 41374 6.7 U TRP4 SGDID:S000002762, Chr IV from 1184738-1185880, Verified ORF, "Anthranilate phosphoribosyl transferase of the tryptophan biosynthetic pathway, catalyzes the phosphoribosylation of anthranilate, subject to the general control system of amino acid biosynthesis" * Jamie_Mitco_SPB_66.23410.23410.3 3.0175 0.1233 94.1 2683.0444 2679.817 7447.9 88 3.537 25.0 1 K.AEESIHSGNALRS*LEHFIDSVSSL.- YHR089C 1 1 6.3% 205 21480 11.5 U GAR1 SGDID:S000001131, Chr VIII from 283300-282683, reverse complement, Verified ORF, "Protein component of the H/ACA snoRNP pseudouridylase complex, involved in the modification and cleavage of the 18S pre-rRNA" * Jamie_Mitco_SPB_30.10546.10546.2 1.9324 0.1202 97.8 1479.5721 1476.852 4052.0 337 3.636 45.8 1 K.VVGPPKPKNKKKR.S YLL034C 2 2 6.2% 837 93069 5.4 U RIX7 SGDID:S000003957, Chr XII from 73145-70632, reverse complement, Verified ORF, "Putative ATPase of the AAA family, required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions" * Jamie_Mitco_SPB_66.23579.23579.4 3.996 0.1796 100.0 3883.7366 3887.1204 7949.5 148 4.022 20.3 1 K.RITSTWSKSGSVSESIT*ETDDPKTEEVKKS*KKR.S * Jamie_Mitco_SPB_62.22225.22225.2 1.946 0.0975 95.8 2125.2522 2127.4055 10309.3 4 2.901 36.1 1 K.TLLAKAVANES*RANFISIK.G YJR002W 2 2 6.2% 593 66953 4.7 U MPP10 SGDID:S000003762, Chr X from 438779-440560, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, interacts with and controls the stability of Imp3p and Imp4p, essential for viability; similar to human Mpp10p" * Jamie_Mitco_SPB_31.10954.10954.2 3.4532 0.3577 100.0 1949.1721 1949.0813 5208.9 1 6.237 70.0 1 K.DRPEDALLTEELEFDR.T * Jamie_Mitco_SPB_57.20373.20373.4 4.5367 0.1197 100.0 4248.6567 4246.7305 8819.6 16 4.154 17.6 1 K.DRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIR.R Reverse_YDR502C 2 2 6.0% 384 42256 5.4 U SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" Reverse_YLR180W 2 2 6.0% 382 41818 5.2 U SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" Jamie_Mitco_SPB_55.19559.19559.2 2.7154 0.262 96.4 2292.612 2293.455 4103.5 1 4.771 36.4 1 Y.DKGS*FAGGGVSSAGGYADVIIKR.G Jamie_Mitco_SPB_27.09635.09635.2 2.1395 0.0444 93.7 1974.4321 1974.0049 6688.1 47 3.502 31.6 1 K.GS*FAGGGVS*SAGGYADVIIK.R YJL046W 1 1 5.9% 409 47003 7.4 U YJL046W SGDID:S000003582, Chr X from 352302-353531, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_105.37463.37463.2 1.6646 0.1153 92.9 3006.0723 3005.3362 10316.5 13 3.446 26.1 1 K.FS*VKIKDKGLTIKVEKGMIY*DCDR.N Reverse_YDR347W 1 1 5.9% 321 36729 9.1 U MRP1 SGDID:S000002755, Chr IV from 1169170-1170135, Verified ORF, "Mitochondrial ribosomal protein of the small subunit; MRP1 exhibits genetic interactions with PET122, encoding a COX3-specific translational activator, and with PET123, encoding a small subunit mitochondrial ribosomal protein" * Jamie_Mitco_SPB_84.29939.29939.2 1.7879 0.1271 95.9 2387.0322 2385.4536 8952.4 144 3.262 27.8 1 R.PCEEPPTRICGQLS*S*MSFK.L YMR055C 1 1 5.9% 306 35028 8.6 U BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" * Jamie_Mitco_SPB_24.08475.08475.2 4.536 0.4148 100.0 2117.1921 2118.3948 4834.3 1 7.439 61.8 1 R.YLILSEGLPISEDKQQQR.T Reverse_YLR067C 1 1 5.8% 965 112646 9.3 U PET309 SGDID:S000004057, Chr XII from 270711-267814, reverse complement, Verified ORF, "Specific translational activator for the COX1 mRNA, also influences stability of intron-containing COX1 primary transcripts; located in the mitochondrial inner membrane" * Jamie_Mitco_SPB_82.29334.29334.4 1.989 0.2594 95.6 6681.9766 6684.5225 8688.6 4 3.654 11.2 1 K.DESLKTLLRFKHILNYGHILTDDVIKMGYSLT*RPDKFLAEVAS*NWSINDLIFGKER.L YOR019W 1 1 5.8% 730 83366 9.7 U YOR019W SGDID:S000005545, Chr XV from 368126-370318, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_59.21138.21138.4 3.7273 0.0451 91.6 4845.8965 4848.2515 6297.7 317 2.836 15.0 1 K.FRKSLIPYSS*SEEQNTTTTIKLS*SSPTSQIKFATSVKHKDGR.A Reverse_YPL155C 2 2 5.8% 706 78378 9.4 U KIP2 SGDID:S000006076, Chr XVI from 259335-257215, reverse complement, Verified ORF, "Kinesin-related motor protein involved in mitotic spindle positioning, stabilizes microtubules by targeting Bik1p to the plus end; Kip2p levels are controlled during the cell cycle" * Jamie_Mitco_SPB_21.07315.07315.2 1.6936 0.0586 91.3 916.6722 916.1087 3894.3 49 3.235 85.7 1 R.RETLGIVK.V * Jamie_Mitco_SPB_60.21363.21363.4 3.4069 0.0723 91.5 3780.9766 3786.1135 6593.8 23 3.094 20.8 1 R.PSKLGVHDRSTGVSRPKPRIT*VTISGTY*TDNKR.S Reverse_YGL026C 1 1 5.8% 707 76626 6.5 U TRP5 SGDID:S000002994, Chr VII from 448540-446417, reverse complement, Verified ORF, "Tryptophan synthase involved in tryptophan biosynthesis, regulated by the general control system of amino acid biosynthesis" * Jamie_Mitco_SPB_22.07920.07920.4 3.0558 0.1985 99.3 4450.4565 4455.836 9453.0 9 3.851 17.5 1 R.RVDEAGMFVTCT*LGFKACATATAVGHQGAGT*EAIVNKKGLR.K YBR045C 1 1 5.8% 573 65837 5.3 U GIP1 SGDID:S000000249, Chr II from 330090-328369, reverse complement, Verified ORF, "Meiosis-specific regulatory subunit of the Glc7p protein phosphatase, regulates spore wall formation and septin organization, required for expression of some late meiotic genes and for normal localization of Glc7p" * Jamie_Mitco_SPB_27.09564.09564.4 3.63 0.1161 97.2 3964.9766 3961.1365 7851.9 268 3.289 17.2 1 R.CPVVEETKKSVSDNLDKPDNNTPCFDRFHTNS*K.E Reverse_YJR054W 1 1 5.8% 497 57517 8.1 U YJR054W SGDID:S000003815, Chr X from 535970-537463, Uncharacterized ORF, "Vacuolar protein of unknown function; potential Cdc28p substrate" * Jamie_Mitco_SPB_59.21142.21142.3 3.5433 0.0454 91.0 3428.9343 3431.8767 5473.4 3 3.664 25.9 1 K.ICTYIDS*VFLALKLGNWGVVGIIY*NLVTK.F YDR052C 1 1 5.7% 704 80690 9.3 U DBF4 SGDID:S000002459, Chr IV from 560622-558508, reverse complement, Verified ORF, "Regulatory subunit of Cdc7p-Dbf4p kinase complex, required for Cdc7p kinase activity and initiation of DNA replication; phosphorylates the Mcm2-7 family of proteins; cell cycle regulated" * Jamie_Mitco_SPB_58.20854.20854.4 3.6355 0.035 90.1 4376.2563 4377.769 8612.3 2 3.041 17.1 1 K.VHNDIKITTTESPTASKKSTSTNVT*LHFNAQTAQTAQPVK.K YJL034W 2 2 5.7% 682 74468 4.9 U KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" Jamie_Mitco_SPB_8.02673.02673.2 1.9356 0.0763 96.9 1019.3722 1018.1582 3809.6 319 3.779 68.8 1 S.ITITNDKGR.L Jamie_Mitco_SPB_32.11187.11187.2 3.5332 0.4128 100.0 3273.372 3272.1096 8337.2 1 7.36 34.5 1 K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.- YER122C 1 1 5.7% 493 55094 8.2 U GLO3 SGDID:S000000924, Chr V from 404348-402867, reverse complement, Verified ORF, "ADP-ribosylation factor GTPase activating protein (ARF GAP), involved in ER-Golgi transport; shares functional similarity with Gcs1p" * Jamie_Mitco_SPB_53.18953.18953.3 3.3827 0.1921 100.0 3248.2744 3249.3513 7394.5 3 3.68 25.0 1 R.IAERY*GTQKAISS*DQLFGRGSFDEAANR.E YNR055C 1 1 5.6% 586 65348 5.8 U HOL1 SGDID:S000005338, Chr XIV from 730187-728427, reverse complement, Verified ORF, "Putative ion transporter similar to the major facilitator superfamily of transporters; mutations in membrane-spanning domains permit nonselective cation uptake" * Jamie_Mitco_SPB_65.23199.23199.4 4.6233 0.2507 100.0 3806.7766 3803.082 8323.7 160 4.166 18.2 1 V.DLSETAEFEVNNEEEVTIPETRELIDGSKEHLK.P YHR004C 1 1 5.6% 446 50642 8.9 U NEM1 SGDID:S000001046, Chr VIII from 113089-111749, reverse complement, Verified ORF, "Protein of the nuclear envelope required for the spherical shape of the nucleus; required for normal sporulation" * Jamie_Mitco_SPB_73.26063.26063.4 3.8289 0.1957 100.0 3003.2566 2998.3206 4742.5 120 3.871 24.3 1 K.S*VLNT*QKKKKLVIDLDETLIHSASR.S Reverse_YGL211W 1 1 5.6% 359 39987 8.8 U NCS6 SGDID:S000003179, Chr VII from 92516-93595, Uncharacterized ORF, "Protein with a role in urmylation and in invasive and pseudohyphal growth; inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" * Jamie_Mitco_SPB_21.07425.07425.3 3.6106 0.0853 95.8 2322.2944 2320.4788 6801.6 1 4.12 35.5 1 K.S*RKIPSGS*SQTIIATSKELR.A YER083C 1 1 5.6% 285 31493 9.5 U GET2 SGDID:S000000885, Chr V from 327027-326170, reverse complement, Verified ORF, "Subunit of the GET complex; required for meiotic nuclear division and for the retrieval of HDEL proteins from the Golgi to the ER in an ERD2 dependent fashion; may be involved in cell wall function" * Jamie_Mitco_SPB_40.14181.14181.2 2.0295 0.0582 93.6 1778.3322 1779.0121 9539.6 64 3.237 36.7 1 R.RQKKFSNGGASSRLNK.I YMR129W 4 4 5.5% 1337 151652 6.7 U POM152 SGDID:S000004736, Chr XIII from 527803-531816, Verified ORF, "Nuclear pore membrane glycoprotein; may be involved in duplication of nuclear pores and nuclear pore complexes during S-phase;" * Jamie_Mitco_SPB_17.06028.06028.2 1.8399 0.0576 93.7 1207.1122 1206.2139 5561.5 18 3.651 68.8 1 R.YNVFNDT*PR.G * Jamie_Mitco_SPB_94.33498.33498.2 1.6485 0.1019 90.7 3460.6921 3459.9177 7453.2 12 3.49 22.4 1 R.SIAIVFEEIKNWISDIPYVISLSYTDAQDK.S * Jamie_Mitco_SPB_39.13780.13780.2 2.1544 0.0345 93.3 1926.5122 1925.1913 7492.9 22 2.851 43.8 1 R.DIPSAAFNFFEPIKEAK.I * Jamie_Mitco_SPB_30.10714.10714.2 4.2312 0.4177 100.0 2166.4722 2167.247 7308.4 1 7.346 55.9 1 R.TDQYTIDNIDSENFSFEK.L YER021W 1 1 5.5% 523 60393 5.6 U RPN3 SGDID:S000000823, Chr V from 196947-198518, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control" * Jamie_Mitco_SPB_47.16647.16647.3 3.6038 0.0705 93.9 3466.9143 3468.6685 4243.3 1 3.832 28.6 1 K.INHEDGFIETTELLNIYDSEDPQQVFDER.I Reverse_YPL118W 1 1 5.5% 344 39445 10.0 U MRP51 SGDID:S000006039, Chr XVI from 326627-327661, Verified ORF, "Mitochondrial ribosomal protein of the large subunit; MRP51 exhibits genetic interactions with mutations in the COX2 and COX3 mRNA 5'-untranslated leader sequences" * Jamie_Mitco_SPB_87.31320.31320.2 2.3145 0.2892 99.7 2097.612 2095.4277 6137.5 1 5.015 44.4 1 K.HNNAVQAIRSRGLLEALTM.- YFR032C 1 1 5.5% 289 31865 6.7 U YFR032C SGDID:S000001928, Chr VI from 222947-222078, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_19.06822.06822.2 2.1211 0.0269 91.8 1947.1522 1947.9207 5610.5 48 3.244 43.3 1 K.LHVPYEADS*TPDT*DVK.K YLR196W 1 1 5.4% 576 63803 4.6 U PWP1 SGDID:S000004186, Chr XII from 543970-545700, Verified ORF, "Protein with WD-40 repeats involved in rRNA processing; associates with trans-acting ribosome biogenesis factors; similar to beta-transducin superfamily" * Jamie_Mitco_SPB_12.04117.04117.4 2.8312 0.1056 90.1 3694.6965 3696.1606 6122.8 63 3.145 21.1 1 K.LWDVFTNRSVRKSFKSELENVQARAKEEAQK.I Reverse_YHR168W 1 1 5.4% 499 55536 9.1 U MTG2 SGDID:S000001211, Chr VIII from 440379-441878, Verified ORF, "Putative GTPase, member of the Obg family; peripheral protein of the mitochondrial inner membrane that associates with the large ribosomal subunit; required for mitochondrial translation, possibly via a role in ribosome assembly" * Jamie_Mitco_SPB_40.14209.14209.2 2.2542 0.0437 95.1 2893.9722 2894.131 5708.6 27 2.88 25.0 1 K.KRHSGSSVS*LNVATSGLISRLTANNDK.R Reverse_YJR076C 1 1 5.3% 415 47649 5.0 U CDC11 SGDID:S000003837, Chr X from 576515-575268, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM" * Jamie_Mitco_SPB_85.30598.30598.2 1.6639 0.0987 90.5 2685.632 2686.0068 11635.4 157 3.231 26.2 1 R.DIDEMILKKNLKLEDRTLS*DSK.S YDR432W 1 1 5.3% 414 45407 5.5 U NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" * Jamie_Mitco_SPB_60.21282.21282.2 3.0857 0.3724 100.0 2437.0923 2438.6501 8572.6 1 6.777 40.5 1 R.DFDGTGALEFPSEEILVEALER.L YGR048W 1 1 5.3% 361 39810 6.2 U UFD1 SGDID:S000003280, Chr VII from 589830-590915, Verified ORF, "Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol" * Jamie_Mitco_SPB_85.30436.30436.3 2.7914 0.099 91.3 2242.8843 2245.3738 4079.3 94 3.094 31.9 1 K.SSEQNFQGQGISLRKS*NKR.K Reverse_YDR183W 1 1 5.2% 230 26623 5.2 U PLP1 SGDID:S000002591, Chr IV from 829580-830272, Verified ORF, "Protein with a possible role in folding of beta-tubulin; has similarity to phosducins, which are GTPase inhibitors" * Jamie_Mitco_SPB_23.08220.08220.2 2.4618 0.0354 98.5 1610.7122 1610.7214 8201.8 43 2.837 54.5 1 R.TT*LY*RKALNELK.E YGL068W 1 1 5.2% 194 20650 9.2 U MNP1 SGDID:S000003036, Chr VII from 375090-375674, Verified ORF, "Protein associated with the mitochondrial nucleoid; putative mitochondrial ribosomal protein with similarity to E. coli L7/L12 ribosomal protein; required for normal respiratory growth" * Jamie_Mitco_SPB_22.07839.07839.2 1.6192 0.0889 91.0 1119.5721 1119.1736 5497.2 378 3.23 50.0 1 K.ENVAKDDAEK.I Reverse_YLR144C 1 1 5.1% 779 88403 5.4 U ACF2 SGDID:S000004134, Chr XII from 432017-429678, reverse complement, Verified ORF, "Intracellular beta-1,3-endoglucanase, expression is induced during sporulation; may have a role in cortical actin cytoskeleton assembly" * Jamie_Mitco_SPB_29.10272.10272.4 3.0946 0.1208 94.3 4363.8164 4358.657 7833.6 110 3.307 17.5 1 K.S*SNES*SCVPPQVNARPPLPPPGRNTTGGPRNPVPPPIAQR.S Reverse_YOR204W 1 1 5.1% 604 65553 7.8 U DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" * Jamie_Mitco_SPB_71.25549.25549.4 3.424 0.1248 96.6 3414.3765 3417.4346 5338.5 41 3.074 20.6 1 R.S*SGWGGASAGGAKRYDRNNNRGFGGRRSNS*R.S YDR142C 1 1 5.1% 375 42323 8.3 U PEX7 SGDID:S000002549, Chr IV from 741595-740468, reverse complement, Verified ORF, "Peroxisomal signal receptor for the N-terminal nonapeptide signal (PTS2) of peroxisomal matrix proteins; WD repeat protein; defects in human homolog cause lethal rhizomelic chondrodysplasia punctata (RCDP)" * Jamie_Mitco_SPB_106.37975.37975.2 1.7936 0.0876 92.7 2246.412 2245.7266 6266.1 5 3.013 33.3 1 R.PLEIT*KMVDPLNAIILKKK.S YHR061C 1 1 5.1% 314 35238 6.5 U GIC1 SGDID:S000001103, Chr VIII from 222480-221536, reverse complement, Verified ORF, "Protein of unknown function involved in initiation of budding and cellular polarization, interacts with Cdc42p via the Cdc42/Rac-interactive binding (CRIB) domain" * Jamie_Mitco_SPB_86.30660.30660.2 1.9668 0.081 95.1 1734.9321 1737.8204 6497.8 13 3.479 40.0 1 K.T*NPSSPSVSSFSGKFK.P YLL002W 1 1 5.0% 436 50096 9.4 U RTT109 SGDID:S000003925, Chr XII from 146290-147600, Verified ORF, "Protein with a role in regulation of Ty1 transposition" * Jamie_Mitco_SPB_27.09473.09473.2 1.831 0.069 90.9 2517.3123 2517.7585 7675.2 28 3.649 26.2 1 K.PAIRSYKKISPELISAAS*T*PAR.T YBR118W 1 1 5.0% 458 50033 9.0 U TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" YPR080W 1 1 5.0% 458 50033 9.0 U TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" Jamie_Mitco_SPB_18.06210.06210.2 3.6864 0.3976 100.0 2550.412 2551.793 5661.5 1 7.825 43.2 1 K.SVEMHHEQLEQGVPGDNVGFNVK.N YNL037C 1 1 5.0% 360 39324 9.0 U IDH1 SGDID:S000004982, Chr XIV from 559003-557921, reverse complement, Verified ORF, "Subunit of mitochondrial NAD(+)-dependent isocitrate dehydrogenase, which catalyzes the oxidation of isocitrate to alpha-ketoglutarate in the TCA cycle" * Jamie_Mitco_SPB_25.08752.08752.2 3.4019 0.211 100.0 1900.3121 1900.0062 7025.4 184 4.258 38.2 1 R.DIGGSSSTTDFTNEIINK.L YJR011C 1 1 5.0% 261 30473 6.4 U YJR011C SGDID:S000003772, Chr X from 459340-458555, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_5.01771.01771.2 2.1389 0.0719 97.1 1489.4122 1490.4778 4048.6 426 3.937 41.7 1 R.ESNEST*VSSLQTK.L YGL100W 1 1 4.9% 349 39123 5.6 U SEH1 SGDID:S000003068, Chr VII from 313237-314286, Verified ORF, "Nuclear pore protein that is part of the evolutionarily conserved Nup84p complex (Nup84p, Nup85p, Nup120p, Nup145p, and Seh1p); homologous to Sec13p" * Jamie_Mitco_SPB_86.30951.30951.2 1.759 0.0848 91.0 2158.4321 2159.1504 7287.8 307 3.395 31.2 1 K.TVKLWEEDPDQEECS*GR.R YJR123W 1 1 4.9% 225 25039 8.6 U RPS5 SGDID:S000003884, Chr X from 651816-652493, Verified ORF, "Protein component of the small (40S) ribosomal subunit, the least basic of the non-acidic ribosomal proteins; phosphorylated in vivo; essential for viability; has similarity to E. coli S7 and rat S5 ribosomal proteins" * Jamie_Mitco_SPB_24.08529.08529.2 2.3395 0.1706 99.5 1266.0122 1265.4087 7252.4 2 4.643 75.0 1 K.DASLVDYVQVR.Q YBR247C 1 1 4.8% 483 55137 4.9 U ENP1 SGDID:S000000451, Chr II from 714450-712999, reverse complement, Verified ORF, "Protein associated with U3 and U14 snoRNAs, required for pre-rRNA processing and 40S ribosomal subunit synthesis; localized in the nucleus and concentrated in the nucleolus" * Jamie_Mitco_SPB_15.05155.05155.3 3.9757 0.1243 99.6 2693.5745 2693.7693 8703.8 1 4.274 31.8 1 R.EKESQVEDMQDDEPLANEQNTSR.G Reverse_YOR163W 1 1 4.8% 188 21572 8.1 U DDP1 SGDID:S000005689, Chr XV from 642741-643307, Verified ORF, "Diadenosine polyphosphate hydrolase, member of the MutT family of nucleotide hydrolases with high specificity for diadenosine hexa- and pentaphosphates, required for efficient hydrolysis of diphosphorylated inositol polyphosphates" * Jamie_Mitco_SPB_21.07377.07377.2 1.9064 0.0523 94.8 1211.6921 1211.2737 3980.3 169 3.389 75.0 1 K.AETYS*YLKR.H YKR095W 5 5 4.7% 1875 218454 5.2 U MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" * Jamie_Mitco_SPB_12.04230.04230.2 1.8694 0.1911 99.2 2189.7722 2191.3599 4448.2 298 4.375 38.2 1 R.KLDDLTEEKKETQSNQQR.T * Jamie_Mitco_SPB_15.05242.05242.2 3.3011 0.2293 100.0 1952.7122 1951.9928 5400.8 1 5.474 52.9 1 R.LSSITDEADEDNENLSAK.S * Jamie_Mitco_SPB_34.11961.11961.3 4.4211 0.2277 100.0 3208.8245 3208.544 6380.1 1 4.797 29.6 1 R.IEELQKELEELKTSVPNEDASYSNVTIK.Q * Jamie_Mitco_SPB_9.02928.02928.1 1.5658 0.0463 91.7 1033.31 1034.1112 5117.4 3 2.945 62.5 1 R.IEDLSSQNK.L * Jamie_Mitco_SPB_19.06490.06490.2 2.2402 0.0978 99.2 2078.8523 2080.2993 6615.4 93 3.903 40.0 1 R.KKEELEKEFEEKVEER.I Reverse_YOR038C 1 1 4.7% 875 98445 8.3 U HIR2 SGDID:S000005564, Chr XV from 405387-402760, reverse complement, Verified ORF, "Non-essential transcriptional corepressor involved in the cell cycle-regulated transcription of histone H2A, H2B, H3, and H4 genes; recruits Swi-Snf complexes to histone gene promoters; promotes heterochromatic gene silencing with Asf1p" * Jamie_Mitco_SPB_81.29139.29139.4 3.8661 0.2629 92.3 4931.4966 4926.5786 8456.6 7 4.563 16.7 1 K.S*AKDITIESLKDFT*KHRFLLIKNENSLLVFLIGLNIDYKVD.T YJL165C 1 1 4.6% 855 95455 8.4 U HAL5 SGDID:S000003701, Chr X from 109454-106887, reverse complement, Verified ORF, "Putative protein kinase; overexpression increases sodium and lithium tolerance, whereas gene disruption increases cation and low pH sensitivity and impairs potassium uptake, suggesting a role in regulation of Trk1p and/or Trk2p transporters" * Jamie_Mitco_SPB_25.08919.08919.3 2.5273 0.1403 91.2 4209.4146 4205.73 4710.0 1 3.244 19.7 1 K.NGNNDELMKNDGKNIPQIVNPNAAVGVEELKLINALSEK.I YOR272W 1 1 4.6% 460 51359 7.0 U YTM1 SGDID:S000005798, Chr XV from 832810-834192, Verified ORF, "Constituent of 66S pre-ribosomal particles, required for maturation of the large ribosomal subunit" * Jamie_Mitco_SPB_14.04951.04951.2 3.6257 0.3323 100.0 2377.632 2378.379 6510.8 1 6.948 47.5 1 K.LTSQQQAQEDDDDEVNIEDGK.T Reverse_YBL076C 1 1 4.5% 1072 122983 6.1 U ILS1 SGDID:S000000172, Chr II from 84259-81041, reverse complement, Verified ORF, "Cytoplasmic isoleucine-tRNA synthetase, target of the G1-specific inhibitor reveromycin A" * Jamie_Mitco_SPB_81.28996.28996.4 3.0453 0.1722 97.4 5529.4165 5524.397 9016.2 273 3.782 13.8 1 R.GDKGYKALVAEPIYEKLRLY*ISESLFPTFPAMARVFTFLADFLSNLAK.L YBR133C 2 4 4.5% 827 95153 6.4 U HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" * Jamie_Mitco_SPB_58.20592.20592.2 3.2583 0.0545 99.5 2654.5923 2652.9177 8411.7 1 3.144 38.6 2 K.KLDNDDTPSYIGLLSSWLELESR.D * Jamie_Mitco_SPB_17.05844.05844.2 2.9298 0.1954 99.7 1705.7522 1703.8058 8955.4 1 4.44 61.5 2 R.HEDLEEDVPEVHVR.V YMR075W 1 1 4.5% 684 78836 8.8 U YMR075W SGDID:S000004680, Chr XIII from 413981-416035, Uncharacterized ORF, "Nuclear protein of unknown function" * Jamie_Mitco_SPB_51.18156.18156.4 3.3935 0.0697 91.7 3337.7766 3336.307 8265.7 60 3.409 21.1 1 -.MDTSKKDTTRSPS*HSNS*SSPSSSSLSSSSSK.E YKL060C 1 1 4.5% 359 39621 5.8 U FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" * Jamie_Mitco_SPB_28.09945.09945.2 3.3381 0.3428 100.0 1902.6721 1903.065 8676.6 1 6.816 50.0 1 K.VNLDTDCQYAYLTGIR.D YBR127C 1 1 4.4% 517 57749 5.1 U VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" * Jamie_Mitco_SPB_21.07356.07356.3 3.5706 0.1885 100.0 2801.2144 2801.8071 4978.9 1 4.002 33.0 1 K.ILDEFYDRARDDADEDEEDPDTR.S Reverse_YDL161W 1 1 4.4% 454 52352 5.9 U ENT1 SGDID:S000002320, Chr IV from 167715-169079, Verified ORF, "Epsin-like protein involved in endocytosis and actin patch assembly and functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus" * Jamie_Mitco_SPB_61.21759.21759.2 1.763 0.1256 95.3 2241.4521 2244.2102 9414.2 7 3.777 31.6 1 R.SASIARQLDDDNEDS*RGTGR.R YFL024C 1 1 4.3% 832 96738 8.7 U EPL1 SGDID:S000001870, Chr VI from 90343-87845, reverse complement, Verified ORF, "Component of NuA4, which is an essential histone H4/H2A acetyltransferase complex; homologous to Drosophila Enhancer of Polycomb" * Jamie_Mitco_SPB_41.14439.14439.4 3.9312 0.0925 97.2 3761.9766 3761.7964 6507.1 99 3.162 19.0 1 R.RSGSRSAHDDGLDSFSKGDSGAGASAGS*SNSRFRHR.K Reverse_YMR204C 1 1 4.3% 420 47315 8.2 U INP1 SGDID:S000004817, Chr XIII from 671324-670062, reverse complement, Verified ORF, "Peripheral membrane protein of peroxisomes involved in peroxisomal inheritance" * Jamie_Mitco_SPB_77.27688.27688.2 1.822 0.0824 92.5 2076.672 2074.2612 7771.0 11 3.328 35.3 1 K.SHIS*PAAIPINLVPAT*RR.I YPR115W 1 1 4.2% 1083 120395 9.3 U YPR115W SGDID:S000006319, Chr XVI from 754875-758126, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_49.17377.17377.4 2.2904 0.1733 91.3 5519.0967 5516.0996 5362.3 245 3.988 14.1 1 R.VGYLLKKTESSKSFTKGYFVLTTNY*LHEFKSS*DFFLDSKSPRSKNK.P YGR147C 1 1 4.2% 288 32804 9.9 U NAT2 SGDID:S000003379, Chr VII from 786925-786059, reverse complement, Verified ORF, "N alpha-acetyl-transferase, transfers acetyl group from acetyl coenzyme A to the N-terminal methionine residues of proteins" * Jamie_Mitco_SPB_12.04185.04185.2 1.5912 0.1135 92.1 1464.6122 1462.837 4904.8 13 3.385 54.5 1 K.LLQRFGIDLMKK.Q YHR203C 1 1 4.2% 261 29410 10.1 U RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" YJR145C 1 1 4.2% 261 29410 10.1 U RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" Jamie_Mitco_SPB_18.06133.06133.3 2.6579 0.1284 95.8 1236.8944 1238.3885 4939.8 42 4.101 45.0 1 R.HDGGFDLVHIK.D YOL115W 1 1 4.1% 584 66031 5.5 U PAP2 SGDID:S000005475, Chr XV from 101474-103228, Verified ORF, "Catalytic subunit of TRAMP (Trf4/Pap2p-Mtr4p-Air1p/2p), a nuclear poly (A) polymerase complex involved in RNA quality control; catalyzes polyadenylation of unmodified tRNAs, and snoRNA and rRNA precursors; disputed role as a DNA polymerase" * Jamie_Mitco_SPB_44.15673.15673.2 1.7333 0.1287 95.2 2930.0322 2931.3242 8930.7 92 3.838 23.9 1 R.DFKDERGLVLNKAIIENENYHKKR.S YOL155C 1 1 4.0% 967 94705 4.3 U YOL155C SGDID:S000005515, Chr XV from 31605-28702, reverse complement, Uncharacterized ORF, "ORF" * Jamie_Mitco_SPB_93.33455.33455.4 3.6704 0.5625 100.0 3576.8164 3581.299 4837.5 11 3.051 20.2 1 A.TESGSSASGSSSATESGSSVS*GSSTSITSGS*SSATESGS.S YNL061W 1 1 4.0% 618 69812 5.0 U NOP2 SGDID:S000005005, Chr XIV from 510541-512397, Verified ORF, "Probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; localized to the nucleolus; constituent of 66S pre-ribosomal particles" * Jamie_Mitco_SPB_27.09622.09622.4 3.606 0.0606 92.0 2978.4165 2975.1873 8127.2 1 3.35 28.5 1 K.SRKEEEEVVEEDKDLPEVDLEELSK.A YKR093W 1 1 4.0% 601 68044 5.4 U PTR2 SGDID:S000001801, Chr XI from 615372-617177, Verified ORF, "Integral membrane peptide transporter, mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p" * Jamie_Mitco_SPB_32.11291.11291.2 2.4659 0.1491 99.5 2814.412 2814.9478 7656.8 1 4.454 34.8 1 R.YNLSPSPEDEDFEGPTEEEMQTLR.H Reverse_YPL212C 1 1 4.0% 544 62143 8.1 U PUS1 SGDID:S000006133, Chr XVI from 153148-151514, reverse complement, Verified ORF, "tRNA:pseudouridine synthase, introduces pseudouridines at positions 26-28, 34-36, 65, and 67 of tRNA; nuclear protein that appears to be involved in tRNA export; also acts on U2 snRNA" * Jamie_Mitco_SPB_9.02939.02939.3 3.0077 0.1086 92.9 2417.1543 2416.647 6989.4 69 3.676 26.2 1 K.NSEPADTLGPIGKATLFEFIS*K.Q YJR049C 1 1 4.0% 530 59469 7.2 U UTR1 SGDID:S000003810, Chr X from 528390-526798, reverse complement, Verified ORF, "NAD kinase, active as a hexamer; enhances the activity of ferric reductase (Fre1p)" * Jamie_Mitco_SPB_60.21495.21495.2 1.882 0.1048 95.5 1979.9521 1979.0275 6626.2 98 3.594 30.0 1 K.DSSLVNGNANSGGGTSINGTR.G Reverse_YPL049C 1 1 4.0% 452 49356 8.6 U DIG1 SGDID:S000005970, Chr XVI from 463836-462478, reverse complement, Verified ORF, "Regulatory protein of unknown function, constitutively-expressed, involved in the regulation of mating-specific genes and the invasive growth pathway, required for MAP-kinase imposed repression, inhibits pheromone-responsive transcription" * Jamie_Mitco_SPB_30.10492.10492.2 2.1266 0.0543 94.9 2019.4922 2018.9169 7084.2 378 3.336 29.4 1 R.DRNTSTSTS*TS*TSASRAK.T YDR385W 2 2 3.9% 842 93289 6.3 U EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" YOR133W 2 2 3.9% 842 93289 6.3 U EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" Jamie_Mitco_SPB_25.08650.08650.2 3.3962 0.0545 99.5 2147.652 2146.371 9264.8 1 3.999 52.8 1 K.STAISLYSEMSDEDVKEIK.Q Jamie_Mitco_SPB_10.03508.03508.2 3.3295 0.2144 100.0 1493.3121 1492.644 4099.6 80 4.957 46.2 1 K.TGTLTTSETAHNMK.V YMR032W 1 1 3.9% 669 76207 9.1 U HOF1 SGDID:S000004635, Chr XIII from 335297-337306, Verified ORF, "Bud neck-localized, SH3 domain-containing protein required for cytokinesis; regulates actomyosin ring dynamics and septin localization; interacts with the formins, Bni1p and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p" * Jamie_Mitco_SPB_30.10456.10456.3 4.2662 0.3739 100.0 2875.3145 2876.1533 7016.5 1 6.094 32.0 1 K.VVANPTLSLRSS*PVQLQSNVDDSVLR.Q Reverse_YHR114W 1 1 3.9% 633 71171 6.0 U BZZ1 SGDID:S000001156, Chr VIII from 338086-339987, Verified ORF, "SH3 domain protein implicated in the regulation of actin polymerization, able to recruit actin polymerization machinery through its SH3 domains, colocalizes with cortical actin patches and Las17p, interacts with type I myosins" * Jamie_Mitco_SPB_53.19027.19027.2 1.9281 0.0513 90.6 2549.4722 2548.556 9045.8 39 2.811 22.9 1 R.STNFLST*IHLPGGNGNGTSGGS*SPK.S YGR159C 1 1 3.9% 414 44535 4.9 U NSR1 SGDID:S000003391, Chr VII from 807661-806417, reverse complement, Verified ORF, "Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis" * Jamie_Mitco_SPB_16.05716.05716.3 2.9767 0.1042 95.1 1849.3744 1849.0073 6260.5 46 3.773 36.7 1 K.QKNEETEEPATIFVGR.L YML031W 1 1 3.8% 655 74134 8.3 U NDC1 SGDID:S000004493, Chr XIII from 214189-216156, Verified ORF, "Nuclear envelope protein with multiple putative transmembrane domains, required for nuclear pore complex assembly and spindle pole body duplication; required for meiosis II" * Jamie_Mitco_SPB_53.18778.18778.2 4.8611 0.494 100.0 2896.7722 2896.1233 6653.4 1 8.766 45.8 1 R.SICALGEFADWDPESMAYTAFQTQR.T YHR092C 1 1 3.8% 560 62043 6.4 U HXT4 SGDID:S000001134, Chr VIII from 288814-287132, reverse complement, Verified ORF, "High-affinity glucose transporter of the major facilitator superfamily, expression is induced by low levels of glucose and repressed by high levels of glucose" * Jamie_Mitco_SPB_18.06460.06460.3 3.5893 0.1494 99.6 2570.7244 2569.6724 9011.5 92 3.862 28.8 1 R.DDMKDFDENHEESNNYVEIPK.K YML085C 1 1 3.8% 447 49800 5.1 U TUB1 SGDID:S000004550, Chr XIII from 99400-99376,99259-97941, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules" YML124C 1 1 3.8% 445 49694 5.2 U TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p" Jamie_Mitco_SPB_26.09029.09029.2 3.2254 0.217 100.0 1851.9722 1850.9385 7463.0 1 6.096 46.9 1 K.GGEEGFSTFFHETGYGK.F Reverse_YLR063W 1 1 3.8% 365 42041 7.9 U YLR063W SGDID:S000004053, Chr XII from 264158-265255, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_23.08043.08043.2 2.6047 0.0282 98.3 1658.8322 1657.821 5998.7 88 2.98 46.2 1 K.KNVENDIKLAS*AFK.S Reverse_YKL114C 1 1 3.8% 367 41439 8.2 U APN1 SGDID:S000001597, Chr XI from 224099-222996, reverse complement, Verified ORF, "Major apurinic/apyrimidinic endonuclease, 3'-repair diesterase involved in repair of DNA damage by oxidation and alkylating agents; controls spontaneous mutations" * Jamie_Mitco_SPB_60.21324.21324.2 1.7282 0.0869 91.0 1938.2522 1939.9469 7591.5 29 3.051 42.3 1 K.DIEEQT*YQPS*VWKR.P YMR116C 1 1 3.8% 319 34805 6.2 U ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "WD repeat protein (G-beta like protein) involved in translation regulation; required for repression of Gcn4p activity in the absence of amino-acid starvation; core component of the ribosome; ortholog of mammalian RACK1" * Jamie_Mitco_SPB_19.06543.06543.2 2.3013 0.2297 99.7 1439.2122 1439.5675 5104.4 1 4.765 63.6 1 R.LWDVATGETYQR.F Reverse_YBR101C 1 1 3.8% 290 32604 5.1 U FES1 SGDID:S000000305, Chr II from 444687-443815, reverse complement, Verified ORF, "Hsp70 (Ssa1p) nucleotide exchange factor, cytosolic homolog of Sil1p, which is the nucleotide exchange factor for BiP (Kar2p) in the endoplasmic reticulum" * Jamie_Mitco_SPB_44.15688.15688.2 1.8004 0.1049 95.7 1234.0122 1233.4075 4749.3 1 3.351 65.0 1 K.TKDSAIEILSR.L Reverse_YER126C 1 1 3.8% 261 29723 10.2 U NSA2 SGDID:S000000928, Chr V from 414175-413390, reverse complement, Verified ORF, "Constituent of 66S pre-ribosomal particles, involved in 60S ribosomal subunit biogenesis" * Jamie_Mitco_SPB_14.04828.04828.2 1.6552 0.0794 90.8 1088.0322 1090.3085 7424.0 252 3.806 55.6 1 R.KQKISSSIAK.A YLL003W 4 4 3.7% 946 112978 9.8 U SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" * Jamie_Mitco_SPB_30.10686.10686.2 3.887 0.389 100.0 2194.612 2195.4314 4904.3 1 6.223 58.3 1 R.DKFVPETSPTNIPT*DVLIK.Q * Jamie_Mitco_SPB_33.11574.11574.2 4.0275 0.3805 100.0 1952.2122 1952.1687 4440.7 1 6.052 59.4 1 K.FVPETSPTNIPT*DVLIK.Q * Jamie_Mitco_SPB_39.13689.13689.2 2.6114 0.1974 99.7 2030.5521 2032.1687 7630.8 16 4.654 40.6 1 K.FVPETSPT*NIPT*DVLIK.Q * Jamie_Mitco_SPB_51.18307.18307.2 2.7652 0.0518 99.2 2037.6322 2037.1443 7896.7 1 4.297 50.0 1 R.YDLNDIS*VEVIEDLYR.Q YOR361C 1 1 3.7% 763 88130 6.0 U PRT1 SGDID:S000005888, Chr XV from 1017648-1015357, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" * Jamie_Mitco_SPB_83.29718.29718.2 3.7899 0.4607 100.0 3241.7122 3242.4683 9771.8 1 8.544 35.2 1 K.IFDVQPEDASDDFTTIEEIVEEVLEETK.E YGL249W 1 1 3.7% 704 82816 8.3 U ZIP2 SGDID:S000003218, Chr VII from 33098-35212, Verified ORF, "Meiosis-specific protein involved in normal synaptonemal complex formation and pairing between homologous chromosomes during meiosis" * Jamie_Mitco_SPB_25.08922.08922.2 1.5466 0.1576 94.6 2852.2322 2850.2139 5350.9 17 3.563 20.0 1 K.LSKCNQNVGGYSVLSGNLKENIKLGR.R Reverse_YMR279C 1 1 3.7% 540 59562 8.2 U YMR279C SGDID:S000004892, Chr XIII from 826350-824728, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_85.30516.30516.2 1.9853 0.0763 94.6 2325.2122 2327.372 6205.1 25 3.492 31.6 1 K.TSSVITT*VEEDETS*VVVKDK.A YFL021W 2 2 3.7% 510 56328 8.6 U GAT1 SGDID:S000001873, Chr VI from 95964-97496, Verified ORF, "Transcriptional activator of genes involved in nitrogen catabolite repression, member of the GATA family of DNA binding proteins; activity and localization regulated by nitrogen limitation and Ure2p" Jamie_Mitco_SPB_1.00349.00349.1 1.7944 0.0321 95.5 812.56 813.07446 4462.5 1 2.921 75.0 1 K.KKPALKK.I * Jamie_Mitco_SPB_53.18850.18850.2 1.5999 0.1242 93.4 1297.3322 1296.4691 4255.8 308 3.424 45.5 1 K.KNYTASVAASKR.K Reverse_YLR190W 1 1 3.7% 491 54817 7.6 U MMR1 SGDID:S000004180, Chr XII from 535216-536691, Verified ORF, "Phosphorylated protein of the mitochondrial outer membrane, localizes only to mitochondria of the bud; interacts with Myo2p to mediate mitochondrial distribution to buds; mRNA is targeted to the bud via the transport system involving She2p" * Jamie_Mitco_SPB_58.20711.20711.2 2.0231 0.0677 94.3 2310.5923 2309.562 7917.1 56 3.433 32.4 1 K.LMKPT*NNLFQFRIPSVS*R.M YDR179W-A 1 1 3.7% 463 53730 8.6 U YDR179W-A SGDID:S000002587, Chr IV from 819428-820819, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_65.23403.23403.2 1.8422 0.0942 93.8 2097.412 2096.363 7825.2 142 3.061 34.4 1 -.MPT*ILYNTNSSLITKYR.R Reverse_YOR056C 1 1 3.7% 459 51742 8.5 U NOB1 SGDID:S000005582, Chr XV from 431627-430248, reverse complement, Verified ORF, "Essential nuclear protein involved in proteasome maturation and synthesis of 40S ribosomal subunits; required for cleavage of the 20S pre-rRNA to generate the mature 18S rRNA" * Jamie_Mitco_SPB_8.02728.02728.3 2.7559 0.1564 96.3 1894.7644 1893.1129 7446.2 38 3.834 35.9 1 R.KQSNKSLPSAVSYRNGR.N YHR118C 1 1 3.7% 435 50296 7.9 U ORC6 SGDID:S000001160, Chr VIII from 345631-344324, reverse complement, Verified ORF, "Subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing; may be phosphorylated by Cdc28p" * Jamie_Mitco_SPB_87.31295.31295.2 1.813 0.1011 94.1 1734.6322 1733.9248 6549.7 189 3.683 40.0 1 K.RSPVKNGGRFTSSDPK.E YDR294C 1 1 3.6% 589 65566 8.0 U DPL1 SGDID:S000002702, Chr IV from 1052222-1050453, reverse complement, Verified ORF, "Dihydrosphingosine phosphate lyase, regulates intracellular levels of sphingolipid long-chain base phosphates (LCBPs), degrades phosphorylated long chain bases, prefers C16 dihydrosphingosine-l-phosphate as a substrate" * Jamie_Mitco_SPB_39.13812.13812.3 2.6337 0.1692 95.3 2614.4343 2615.992 6604.5 67 4.017 28.8 1 R.LFRWLLDSPFLRGTVEKEVT*K.V Reverse_YKL075C 1 1 3.6% 450 52088 5.1 U YKL075C SGDID:S000001558, Chr XI from 293952-292600, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" * Jamie_Mitco_SPB_74.26316.26316.2 2.1357 0.0977 98.1 1688.6322 1688.7638 4978.6 93 3.326 40.0 1 K.VMEDRLAT*SGASDAGK.T YLR423C 1 1 3.6% 417 48656 5.1 U ATG17 SGDID:S000004415, Chr XII from 973166-971913, reverse complement, Verified ORF, "Protein that interacts with and is required for activation of Apg1p protein kinase; involved in autophagy but not in the Cvt (cytoplasm to vacuole targeting) pathway" * Jamie_Mitco_SPB_106.37999.37999.2 1.7963 0.0986 93.6 1952.5122 1952.983 5988.0 9 3.692 42.9 1 K.IDDFSSLYT*LNY*NVK.N YCR095C 1 1 3.6% 362 41647 8.5 U YCR095C SGDID:S000000691, Chr III from 289254-288166, reverse complement, Uncharacterized ORF, "Cytoplasmic protein required for replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" * Jamie_Mitco_SPB_90.32309.32309.2 1.8933 0.0869 95.2 1594.3522 1593.8613 6600.2 22 3.584 54.2 1 R.LLTLINQIET*KVK.N YPL227C 1 1 3.6% 334 38347 8.7 U ALG5 SGDID:S000006148, Chr XVI from 121167-120163, reverse complement, Verified ORF, "UDP-glucose:dolichyl-phosphate glucosyltransferase, involved in asparagine-linked glycosylation in the endoplasmic reticulum" * Jamie_Mitco_SPB_47.16740.16740.2 1.7338 0.0752 91.0 1293.7322 1295.3049 3829.0 23 3.178 54.5 1 K.YGLFADADGAS*K.F Reverse_YMR189W 1 1 3.5% 1034 114451 7.3 U GCV2 SGDID:S000004801, Chr XIII from 637499-640603, Verified ORF, "P subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" * Jamie_Mitco_SPB_109.38910.38910.4 3.2452 0.0967 93.2 4043.8164 4040.7717 4478.1 329 3.365 16.7 1 R.KLINPPVLEEIFANLDSYGMTKLMKKVDSPSPGLHR.R YGL049C 1 1 3.5% 914 103899 7.6 U TIF4632 SGDID:S000003017, Chr VII from 409607-406863, reverse complement, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4631p" * Jamie_Mitco_SPB_39.13915.13915.4 3.3021 0.1503 97.7 3567.8965 3566.636 9322.3 96 3.475 18.3 1 K.EATPVLPANEAVKDTLTETSNEKS*T*SEAENTK.R Reverse_YDR518W 1 1 3.5% 517 58982 4.9 U EUG1 SGDID:S000002926, Chr IV from 1478598-1480151, Verified ORF, "Protein disulfide isomerase of the endoplasmic reticulum lumen, function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER" * Jamie_Mitco_SPB_105.37733.37733.2 1.7748 0.1317 96.1 2118.372 2117.4502 7619.6 118 3.892 32.4 1 K.YVNSKQEKPIEESKVIPK.A YJL081C 1 1 3.5% 489 54832 5.5 U ARP4 SGDID:S000003617, Chr X from 285187-283718, reverse complement, Verified ORF, "Nuclear actin-related protein involved in chromatin remodeling, component of chromatin-remodeling enzyme complexes" * Jamie_Mitco_SPB_33.11631.11631.2 2.8448 0.2479 100.0 2067.2122 2066.1882 8139.0 1 5.059 46.9 1 R.SIESPWNEEIVFDNETR.Y YPR163C 1 1 3.4% 436 48522 5.3 U TIF3 SGDID:S000006367, Chr XVI from 869951-868641, reverse complement, Verified ORF, "Translation initiation factor eIF-4B, has RNA annealing activity; contains an RNA recognition motif and binds to single-stranded RNA" * Jamie_Mitco_SPB_21.07386.07386.2 2.203 0.0427 95.1 1842.1921 1841.8978 6623.9 153 3.534 42.9 1 R.GS*NFQSSSRPPRRER.E Reverse_YDR383C 1 1 3.4% 238 26976 4.6 U NKP1 SGDID:S000002791, Chr IV from 1240666-1239950, reverse complement, Verified ORF, "Non-essential kinetochore protein, subunit of the Ctf19 central kinetochore complex (Ctf19p-Mcm21p-Okp1p-Mcm22p-Mcm16p-Ctf3p-Chl4p-Mcm19p-Nkp1p-Nkp2p-Ame1p-Mtw1p)" * Jamie_Mitco_SPB_16.05500.05500.2 1.9047 0.0762 97.1 879.65216 879.94507 3626.6 14 4.63 71.4 1 K.EPSNGFTK.V YDR409W 1 1 3.3% 904 100796 6.9 U SIZ1 SGDID:S000002817, Chr IV from 1289396-1292110, Verified ORF, "SUMO ligase that promotes the attachment of sumo (Smt3p; small ubiquitin-related modifier) to proteins; binds Ubc9p and may bind septins; specifically required for sumoylation of septins in vivo; localized to the septin ring" * Jamie_Mitco_SPB_85.30466.30466.4 3.2612 0.1191 95.3 3663.9766 3659.9543 7829.2 5 3.376 24.7 1 R.EDEEMGLT*T*TSTIMSLQCPISYTRMKYPSK.S Reverse_YOL130W 1 1 3.3% 859 95869 6.7 U ALR1 SGDID:S000005490, Chr XV from 74399-76978, Verified ORF, "Plasma membrane Mg(2+) transporter, expression and turnover are regulated by Mg(2+) concentration; overexpression confers increased tolerance to Al(3+) and Ga(3+) ions" * Jamie_Mitco_SPB_93.33280.33280.3 2.8913 0.1139 91.4 2974.4944 2970.019 4828.6 22 2.967 23.1 1 K.TIPS*AS*SSASLKSKNGSSATSSSMTYDR.K Reverse_YGR198W 1 1 3.3% 817 95366 5.4 U YGR198W SGDID:S000003430, Chr VII from 894698-897151, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern; YGR198W is an essential gene" * Jamie_Mitco_SPB_15.05305.05305.4 2.854 0.1284 92.4 3363.5764 3365.7395 6416.9 41 3.434 24.4 1 K.SVEIS*QFTKEMSSIIFNYWS*PNVKIKK.I Reverse_YBR044C 1 1 3.3% 573 64259 8.9 U TCM62 SGDID:S000000248, Chr II from 326058-324337, reverse complement, Verified ORF, "Protein involved in the assembly of the mitochondrial succinate dehydrogenase complex; putative chaperone" * Jamie_Mitco_SPB_61.21871.21871.2 1.8433 0.0636 90.4 2303.7122 2306.5498 7195.0 7 3.269 33.3 1 R.YIPTHLT*KVSCKTQHNGLK.R YDL022W 1 1 3.3% 391 42869 5.5 U GPD1 SGDID:S000002180, Chr IV from 411822-412997, Verified ORF, "NAD-dependent glycerol-3-phosphate dehydrogenase, key enzyme of glycerol synthesis, essential for growth under osmotic stress; expression regulated by high-osmolarity glycerol response pathway; homolog of Gpd2p" * Jamie_Mitco_SPB_11.03942.03942.2 2.3165 0.0764 99.2 1379.9521 1380.5933 6632.3 111 4.157 50.0 1 R.AISCLKGFEVGAK.G Reverse_YDL195W 1 1 3.2% 1273 138703 5.7 U SEC31 SGDID:S000002354, Chr IV from 107209-111030, Verified ORF, "Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation" * Jamie_Mitco_SPB_55.19474.19474.4 4.3316 0.0897 99.0 4633.4966 4631.077 7657.5 396 4.067 15.8 1 K.GDPTIQVLKGGFAWHAAPSPEGY*WTPAQLHFVSPKEKSEER.S Reverse_YCL061C 1 1 3.2% 1096 124326 5.3 U MRC1 SGDID:S000000566, Chr III from 22106-18816, reverse complement, Verified ORF, "S-phase checkpoint protein found at replication forks, required for DNA replication; also required for Rad53p activation during DNA replication stress, where it forms a replication-pausing complex with Tof1p and is phosphorylated by Mec1p; protein involved in replication checkpoint" * Jamie_Mitco_SPB_51.18298.18298.4 3.4553 0.1243 96.9 4089.3364 4087.19 9579.2 94 3.196 18.6 1 K.ELEEGGDYLNS*ILQTPLS*NESRDKGNNHNQEPAKK.G YLR045C 2 2 3.2% 888 100918 8.6 U STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p" * Jamie_Mitco_SPB_17.05925.05925.2 2.9845 0.1311 99.7 1864.2922 1864.0654 7318.2 3 3.953 56.7 1 K.SLSSALPFKEEEDVRR.K * Jamie_Mitco_SPB_14.04798.04798.3 2.3225 0.1231 91.4 1516.1344 1514.4655 5111.0 437 3.399 36.4 1 R.RS*S*ESIGDLPHR.V Reverse_YLR219W 1 1 3.2% 728 80530 9.1 U MSC3 SGDID:S000004209, Chr XII from 574153-576339, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; msc3 mutants are defective in directing meiotic recombination events to homologous chromatids; potential Cdc28p substrate" * Jamie_Mitco_SPB_63.22393.22393.3 2.7653 0.1077 90.8 2590.3442 2592.5718 5095.3 176 3.553 27.3 1 K.RSKNS*GLPASANDSAADTHY*VNR.K YMR294W 1 1 3.2% 373 43607 4.9 U JNM1 SGDID:S000004908, Chr XIII from 856965-858086, Verified ORF, "Component of the yeast dynactin complex, consisting of Nip100p, Jnm1p, and Arp1p; required for proper nuclear migration and spindle partitioning during mitotic anaphase B" * Jamie_Mitco_SPB_82.29487.29487.2 1.9455 0.0476 92.6 1431.9922 1433.6041 4442.1 9 3.406 50.0 1 K.QYQDSLPLLAER.M YMR205C 1 1 3.1% 959 104618 6.7 U PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" * Jamie_Mitco_SPB_67.24063.24063.3 2.7299 0.2241 99.3 3351.3245 3349.5671 7645.1 87 3.864 21.6 1 K.PTPPPAPEASAESGLSS*KVHS*YTDLAYRMK.T Reverse_YBR055C 1 1 3.1% 899 104229 8.0 U PRP6 SGDID:S000000259, Chr II from 347299-344600, reverse complement, Verified ORF, "Splicing factor, component of the U4/U6-U5 snRNP complex" * Jamie_Mitco_SPB_44.15587.15587.4 3.3921 0.1444 98.0 3098.3364 3096.2534 5702.0 285 3.36 23.5 1 K.EKT*SFGTAGRGIGPVY*GAPPEQDLFSPR.E YJL141C 1 1 3.1% 807 91245 8.4 U YAK1 SGDID:S000003677, Chr X from 150308-147885, reverse complement, Verified ORF, "Serine-threonine protein kinase that is part of a glucose-sensing system involved in growth control in response to glucose availability; translocates from the cytoplasm to the nucleus and phosphorylates Pop2p in response to a glucose signal" * Jamie_Mitco_SPB_96.34371.34371.2 1.521 0.1742 95.3 2986.0322 2986.3928 9178.1 209 3.734 22.9 1 K.VVKSRTEYLTQS*ITEAKILELLNQK.I YLR153C 2 2 3.1% 683 75492 6.7 U ACS2 SGDID:S000004143, Chr XII from 447576-445525, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform, required for growth on glucose; expressed under anaerobic conditions" * Jamie_Mitco_SPB_54.19281.19281.2 1.9258 0.0798 95.2 1345.5922 1347.5596 3969.4 293 3.988 54.5 1 K.ATHFYVAPTALR.L * Jamie_Mitco_SPB_19.06496.06496.2 1.7968 0.0536 92.7 1226.4321 1225.3054 4350.6 1 4.394 81.2 1 R.DHDGYYWIR.G YFR028C 1 1 3.1% 551 61907 8.0 U CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" * Jamie_Mitco_SPB_18.06193.06193.2 2.2445 0.0968 99.2 1806.7122 1805.917 6336.2 1 3.652 50.0 1 R.DLTMTPPS*NGHGALSAR.N Reverse_YDR363W 1 1 3.1% 456 52542 5.1 U ESC2 SGDID:S000002771, Chr IV from 1199173-1200543, Verified ORF, "Protein involved in mating-type locus silencing, interacts with Sir2p; probably functions to recruit or stabilize Sir proteins" * Jamie_Mitco_SPB_23.07949.07949.2 2.0205 0.0274 90.3 1614.2722 1614.7936 6884.1 3 3.04 53.8 1 K.SITT*SKKAEKALEK.F YKL113C 1 1 3.1% 382 43279 8.9 U RAD27 SGDID:S000001596, Chr XI from 225519-224371, reverse complement, Verified ORF, "5' to 3' exonuclease, 5' flap endonuclease, required for Okazaki fragment processing and maturation as well as for long-patch base-excision repair; member of the S. pombe RAD2/FEN1 family" * Jamie_Mitco_SPB_27.09571.09571.2 1.938 0.0811 95.6 1476.2122 1475.5583 5754.2 17 3.488 54.5 1 K.FS*EERVKSGISR.L Reverse_YGL081W 1 1 3.1% 320 36390 5.1 U YGL081W SGDID:S000003049, Chr VII from 357380-358342, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_17.06117.06117.2 2.1595 0.0592 97.8 1387.3322 1387.4125 6248.2 74 3.194 61.1 1 K.KNKS*FCT*LTK.K YMR266W 1 1 3.0% 953 107672 8.6 U YMR266W SGDID:S000004879, Chr XIII from 798517-801378, Uncharacterized ORF, "Membrane protein of unknown function; overexpression suppresses NaCl sensitivity of sro7 mutant" * Jamie_Mitco_SPB_9.02952.02952.4 3.5471 0.107 95.8 3390.3364 3387.8154 5792.3 176 3.166 20.2 1 K.AALKKIKKLNKKSPQLS*VSDNIAEY*VPDK.K Reverse_YER164W 1 1 2.9% 1468 168241 6.5 U CHD1 SGDID:S000000966, Chr V from 505387-509793, Verified ORF, "Nucleosome remodeling factor that functions in regulation of transcription elongation; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SILK complexes" * Jamie_Mitco_SPB_81.28925.28925.4 3.8946 0.1432 99.6 4432.8164 4436.0312 6323.3 288 3.428 15.9 1 K.SGIDASPSKTNLGGRLFSLLYDVRRGLHIAGPVKKSS*GTIGK.G YGR128C 1 1 2.9% 713 80191 5.2 U UTP8 SGDID:S000003360, Chr VII from 750096-747955, reverse complement, Verified ORF, "Nucleolar protein required for export of tRNAs from the nucleus; also copurifies with the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * Jamie_Mitco_SPB_14.04974.04974.2 2.2457 0.0481 95.6 2322.132 2321.327 4845.8 89 3.14 35.0 1 K.ALEDTTDTSNDHLSESDIDNK.A YPL007C 1 1 2.9% 588 67684 6.2 U TFC8 SGDID:S000005928, Chr XVI from 543845-542079, reverse complement, Verified ORF, "One of six subunits of RNA polymerase III transcription initiation factor complex (TFIIIC); part of TFIIIC TauB domain that binds BoxB promoter sites of tRNA and other genes; linker between TauB and TauA domains; human homolog is TFIIIC-90" * Jamie_Mitco_SPB_27.09505.09505.2 2.0915 0.024 90.7 1894.3722 1894.1101 6197.6 169 2.866 37.5 1 K.DNKMLTNLDSKGNLSSR.T YER165W 1 1 2.9% 577 64344 6.0 U PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" * Jamie_Mitco_SPB_31.10955.10955.2 4.5456 0.5118 100.0 2015.2122 2015.1406 6420.3 1 8.786 65.6 1 K.NINSETTDEQFQELFAK.F YKR097W 1 1 2.9% 549 60983 6.3 U PCK1 SGDID:S000001805, Chr XI from 630790-632439, Verified ORF, "Phosphoenolpyruvate carboxykinase, key enzyme in gluconeogenesis, catalyzes early reaction in carbohydrate biosynthesis, glucose represses transcription and accelerates mRNA degradation, regulated by Mcm1p and Cat8p, located in the cytosol " * Jamie_Mitco_SPB_26.09041.09041.2 1.94 0.0613 92.6 2167.1921 2169.235 6389.7 24 2.964 36.7 1 R.TWS*INRERAADYLRT*R.D YBR054W 1 1 2.9% 344 38720 9.2 U YRO2 SGDID:S000000258, Chr II from 343099-344133, Verified ORF, "Putative plasma membrane protein of unknown function, transcriptionally regulated by Haa1p; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and bud" YDR033W 1 1 3.1% 320 36191 9.2 U MRH1 SGDID:S000002440, Chr IV from 508143-509105, Verified ORF, "Protein that localizes primarily to the plasma membrane, also found at the nuclear envelope; has similarity to Hsp30p and Yro2p, which are induced during heat shock" Jamie_Mitco_SPB_1.00341.00341.2 1.8443 0.1244 98.7 1205.8522 1206.3005 6149.9 1 3.679 77.8 1 K.YNHVQTSTQK.E Reverse_YOR324C 1 1 2.8% 602 67293 9.4 U FRT1 SGDID:S000005851, Chr XV from 925035-923227, reverse complement, Verified ORF, "Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress" * Jamie_Mitco_SPB_61.21724.21724.2 2.1269 0.0483 94.0 2019.6721 2019.1814 7293.2 24 2.935 37.5 1 R.QNT*LYGLSPYVGNLSRR.D YOR198C 1 1 2.8% 470 54639 9.2 U BFR1 SGDID:S000005724, Chr XV from 720065-718653, reverse complement, Verified ORF, "Component of mRNP complexes associated with polyribosomes; implicated in secretion and nuclear segregation; multicopy suppressor of BFA (Brefeldin A) sensitivity" * Jamie_Mitco_SPB_18.06360.06360.2 2.8043 0.2408 100.0 1398.3722 1397.6982 6214.5 42 4.933 54.2 1 R.KVVADDLVLVTPK.K YBR031W 1 1 2.8% 362 39092 10.6 U RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" YDR012W 1 1 2.8% 362 39062 10.6 U RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" Jamie_Mitco_SPB_12.04224.04224.2 2.1285 0.1733 99.5 1011.21216 1011.16614 5373.9 238 4.314 66.7 1 K.AVGAHSDLLK.V Reverse_YHR080C 1 1 2.7% 1345 149679 8.7 U YHR080C SGDID:S000001122, Chr VIII from 266840-262803, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_23.08044.08044.4 3.0639 0.1148 93.7 4278.5366 4283.555 5889.6 314 3.458 17.6 1 K.HEDDNRLMARGRPSIASGRNS*IWDWIDSERGVIPS*K.D YBR255W 1 1 2.7% 694 79028 9.7 U YBR255W SGDID:S000000459, Chr II from 724451-726535, Uncharacterized ORF, "Protein of unknown function, required for normal growth rate at 15 degrees C; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * Jamie_Mitco_SPB_81.29130.29130.2 2.0267 0.062 93.7 2198.912 2197.1624 8833.4 97 3.087 36.1 1 R.RGSSNT*SGSGGKRNS*KHYR.S YGL023C 1 1 2.7% 635 70617 7.8 U PIB2 SGDID:S000002991, Chr VII from 452109-450202, reverse complement, Verified ORF, "Protein binding phosphatidylinositol 3-phosphate, involved in telomere-proximal repression of gene expression; similar to Fab1 and Vps27" * Jamie_Mitco_SPB_64.22957.22957.2 1.7162 0.1666 97.8 1784.6522 1782.5939 6593.7 314 3.711 37.5 1 K.ESSSSSTSSVS*S*SSTSK.V YFL001W 1 1 2.7% 442 50889 9.3 U DEG1 SGDID:S000001895, Chr VI from 147126-148454, Verified ORF, "Non-essential tRNA:pseudouridine synthase, introduces pseudouridines at position 38 or 39 in tRNA, important for maintenance of translation efficiency and normal cell growth, localizes to both the nucleus and cytoplasm" * Jamie_Mitco_SPB_1.00227.00227.2 1.4563 0.1495 92.6 1503.7722 1506.5438 6552.7 333 3.662 45.5 1 K.MS*KAAS*YFVGER.D YFR047C 1 1 2.7% 295 32365 5.8 U BNA6 SGDID:S000001943, Chr VI from 245153-244266, reverse complement, Verified ORF, "Quinolinate phosphoribosyl transferase, required for biosynthesis of nicotinic acid from tryptophan via kynurenine pathway" * Jamie_Mitco_SPB_6.02071.02071.2 1.9283 0.0015 90.7 1089.3121 1089.1105 5046.7 26 3.173 78.6 1 R.KT*T*PGLRR.L Reverse_YJR137C 1 1 2.6% 1442 161218 5.5 U ECM17 SGDID:S000003898, Chr X from 683200-678872, reverse complement, Verified ORF, "Sulfite reductase beta subunit, involved in amino acid biosynthesis, transcription repressed by methionine" * Jamie_Mitco_SPB_76.27171.27171.4 4.1165 0.2504 96.0 4087.6965 4090.4216 7217.4 103 4.367 19.4 1 K.NNHTTGMGGGVFVNYGEVIQT*EPNVIAVLGVDIS*LVDV.D Reverse_YEL053C 1 1 2.6% 733 84302 5.9 U MAK10 SGDID:S000000779, Chr V from 56102-53901, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type, required for replication of dsRNA virus; expression is glucose-repressible" * Jamie_Mitco_SPB_84.30241.30241.2 1.9322 0.0612 92.3 2160.2922 2159.3354 7724.1 47 2.998 30.6 1 K.KNMSHIANINSEIDNQSDK.L YDL203C 1 1 2.6% 623 69371 8.4 U YDL203C SGDID:S000002362, Chr IV from 97954-96083, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_17.06004.06004.2 2.0994 0.0481 93.6 1747.8322 1748.8939 7349.3 125 3.326 43.3 1 R.GTSSLDPSPTKEQCIK.K YGR088W 1 1 2.6% 573 65742 6.6 U CTT1 SGDID:S000003320, Chr VII from 654605-656326, Verified ORF, "Cytosolic catalase T, has a role in protection from oxidative damage by hydrogen peroxide" * Jamie_Mitco_SPB_17.05922.05922.2 2.4572 0.0782 99.2 1770.7722 1771.9652 5510.6 50 3.418 42.9 1 K.FKGIVLDEVTEVS*VR.K Reverse_YDL020C 1 1 2.6% 531 60153 5.4 U RPN4 SGDID:S000002178, Chr IV from 416705-415110, reverse complement, Verified ORF, "Transcription factor that stimulates expression of proteasome genes; Rpn4p levels are in turn regulated by the 26S proteasome in a negative feedback control mechanism; RPN4 is transcriptionally regulated by various stress responses" * Jamie_Mitco_SPB_40.14057.14057.4 2.4927 0.1492 94.8 1678.7366 1674.595 2981.1 152 3.827 34.6 1 K.SNSNT*S*SHSSLHKK.T YAL017W 1 1 2.5% 1356 152330 5.7 U PSK1 SGDID:S000000015, Chr I from 120226-124296, Verified ORF, "One of two (see also PSK2) PAS domain containing S/T protein kinases; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status" * Jamie_Mitco_SPB_78.27977.27977.4 3.5218 0.0764 94.0 3850.7766 3853.79 5280.8 182 2.393 19.2 1 K.SYTKPT*STENRNGDENQLDGDS*HSEPSLSSSPVR.S YCR077C 1 1 2.5% 796 88495 7.7 U PAT1 SGDID:S000000673, Chr III from 252624-250234, reverse complement, Verified ORF, "Topoisomerase II-associated deadenylation-dependent mRNA-decapping factor; also required for faithful chromosome transmission, maintenance of rDNA locus stability, and protection of mRNA 3'-UTRs from trimming; functionally linked to Pab1p" * Jamie_Mitco_SPB_75.26745.26745.2 1.9065 0.1115 96.4 2263.0122 2265.4917 6963.5 198 3.403 28.9 1 K.QANT*VLGKISSTLNSKNPRR.Q YOR119C 1 1 2.5% 484 56122 6.6 U RIO1 SGDID:S000005645, Chr XV from 550246-548792, reverse complement, Verified ORF, "Essential serine kinase involved in cell cycle progression and processing of the 20S pre-rRNA into mature 18S rRNA" * Jamie_Mitco_SPB_121.43463.43463.3 2.2034 0.1415 91.3 1326.9543 1329.5852 8347.0 377 3.626 43.2 1 K.RIYQSGVIPAPK.P Reverse_YPL259C 1 1 2.5% 475 53874 8.6 U APM1 SGDID:S000006180, Chr XVI from 52671-51244, reverse complement, Verified ORF, "Mu1-like medium subunit of the clathrin-associated protein complex (AP-1); binds clathrin; involved in clathrin-dependent Golgi protein sorting" * Jamie_Mitco_SPB_123.44176.44176.2 1.2972 0.2063 94.1 1298.9321 1301.3531 8347.0 278 4.193 36.4 1 K.KNT*ASSSTISPK.K YOL078W 1 1 2.4% 1176 131378 6.7 U AVO1 SGDID:S000005438, Chr XV from 181681-185211, Verified ORF, "Component of a membrane-bound complex containing the Tor2p kinase and other proteins, which may have a role in regulation of cell growth" * Jamie_Mitco_SPB_55.19767.19767.3 2.9903 0.0937 91.2 3193.2544 3194.4263 9581.1 17 3.189 21.3 1 K.NVMNTTNT*RAKSSTLHPPGARHNKKGS*K.F Reverse_YNL298W 1 1 2.4% 842 93909 9.1 U CLA4 SGDID:S000005242, Chr XIV from 68915-71443, Verified ORF, "Cdc42p activated signal transducing kinase of the PAK (p21-activated kinase) family, involved in septin ring assembly and cytokinesis; directly phosphorylates septins Cdc3p and Cdc10p; other yeast PAK family members are Ste20p and Skm1p" * Jamie_Mitco_SPB_60.21262.21262.2 2.14 0.1054 98.7 2037.8322 2038.9475 7374.5 127 3.455 34.2 1 K.SNSDSSVNLSSSSGSS*VSNR.D YDR365C 1 1 2.4% 628 72410 5.3 U ESF1 SGDID:S000002773, Chr IV from 1206373-1204487, reverse complement, Verified ORF, "Nucleolar protein involved in pre-rRNA processing; depletion causes severely decreased 18S rRNA levels" * Jamie_Mitco_SPB_14.04792.04792.2 3.1373 0.3001 100.0 1727.0521 1727.7356 5794.6 1 6.314 71.4 1 K.DLYEEGDADKDVDSR.A YER158C 1 1 2.4% 573 63712 9.8 U YER158C SGDID:S000000960, Chr V from 490573-488852, reverse complement, Uncharacterized ORF, "Protein of unknown function, has similarity to Afr1p; potentially phosphorylated by Cdc28p" * Jamie_Mitco_SPB_18.06185.06185.2 2.2833 0.0082 93.2 1543.2522 1542.5132 5588.4 112 2.952 46.2 1 K.AADANQKSES*ESPK.A YDR229W 1 1 2.4% 453 49976 5.0 U IVY1 SGDID:S000002637, Chr IV from 924779-926140, Verified ORF, "Phospholipid-binding protein that interacts with both Ypt7p and Vps33p, may partially counteract the action of Vps33p and vice versa, localizes to the rim of the vacuole as cells approach stationary phase" * Jamie_Mitco_SPB_11.03964.03964.2 2.6239 0.2373 100.0 1256.0721 1256.3116 5325.1 12 4.742 65.0 1 R.NSAEETTQTFK.Q YBR104W 1 1 2.4% 329 36555 9.3 U YMC2 SGDID:S000000308, Chr II from 449661-450650, Verified ORF, "Putative mitochondrial inner membrane transporter, member of the mitochondrial carrier (MCF) family" * Jamie_Mitco_SPB_111.39955.39955.1 1.2424 0.0864 92.6 966.8 968.14355 4559.6 221 3.229 50.0 1 K.EGIRAFFK.G YBL034C 1 1 2.3% 1513 174176 6.3 U STU1 SGDID:S000000130, Chr II from 158392-153851, reverse complement, Verified ORF, "Component of the mitotic spindle that binds to interpolar microtubules via its association with beta-tubulin (Tub2p); required for interpolar microtubules to provide an outward force on the spindle poles" * Jamie_Mitco_SPB_21.07479.07479.4 3.5937 0.2126 100.0 3811.2566 3807.017 6558.0 183 3.623 19.1 1 R.HHDSMNSVS*NSNTKDNNNVTKRKVSAPPSSTAATK.V Reverse_YDR409W 1 1 2.3% 904 100796 6.9 U SIZ1 SGDID:S000002817, Chr IV from 1289396-1292110, Verified ORF, "SUMO ligase that promotes the attachment of sumo (Smt3p; small ubiquitin-related modifier) to proteins; binds Ubc9p and may bind septins; specifically required for sumoylation of septins in vivo; localized to the septin ring" * Jamie_Mitco_SPB_53.19011.19011.2 1.9873 0.0966 96.3 2613.4722 2610.853 8671.6 130 2.838 27.5 1 K.LLEMLTIT*EEVENRLENTPER.D YBR142W 1 1 2.3% 773 87048 8.4 U MAK5 SGDID:S000000346, Chr II from 528311-530632, Verified ORF, "Essential nucleolar protein, putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits" * Jamie_Mitco_SPB_24.08401.08401.2 3.1757 0.2049 100.0 2034.2122 2034.0919 9473.9 14 4.36 47.1 1 K.LTDPSEDVDEDVDEDVLK.E YJL041W 1 1 2.3% 823 86516 6.3 U NSP1 SGDID:S000003577, Chr X from 365700-365700,365819-368289, Verified ORF, "Essential component of the nuclear pore complex, which mediates nuclear import and export" * Jamie_Mitco_SPB_14.04750.04750.4 4.3104 0.3331 100.0 2063.6165 2062.1975 7395.5 1 5.924 35.2 1 K.SDEKKDSDSSKPAFSFGTK.S YDR194C 1 1 2.3% 664 76269 9.0 U MSS116 SGDID:S000002602, Chr IV from 847941-845947, reverse complement, Verified ORF, "DEAD-box protein required for efficient splicing of mitochondrial Group I and II introns; presumed RNA helicase due to DEAD-box motif" * Jamie_Mitco_SPB_37.13037.13037.2 3.0179 0.245 100.0 1895.4122 1894.912 9218.9 2 4.228 50.0 1 D.DSEIS*FRGNKNYNNR.S YLL012W 1 1 2.3% 573 66508 6.6 U YEH1 SGDID:S000003935, Chr XII from 125533-127254, Verified ORF, "Steryl ester hydrolase, one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes" * Jamie_Mitco_SPB_13.04672.04672.2 3.0314 0.0403 99.6 1425.6921 1425.446 7298.9 42 2.949 58.3 1 R.SSSTQIEVDDESK.R YOR204W 1 1 2.3% 604 65553 7.8 U DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" * Jamie_Mitco_SPB_14.04811.04811.2 2.7819 0.2988 100.0 1658.5122 1658.7896 7013.0 1 6.455 61.5 1 R.HIVEDCDMTPVGER.Q Reverse_YDR310C 1 1 2.2% 1062 118201 6.2 U SUM1 SGDID:S000002718, Chr IV from 1084310-1081122, reverse complement, Verified ORF, "Transcriptional repressor required for repression of middle sporulation-specific genes during mitosis; regulated by the pachytene checkpoint; a dominant mutation acts as a suppressor of silencing defects of SIR2 mutations" * Jamie_Mitco_SPB_34.12099.12099.2 1.6042 0.1346 93.4 2621.892 2621.7896 7594.9 67 3.393 25.0 1 R.EY*EANEKTIAEEGSNLMSQIGVK.H YAR019C 1 1 2.2% 974 110285 8.0 U CDC15 SGDID:S000000072, Chr I from 175133-172209, reverse complement, Verified ORF, "Protein kinase of the Mitotic Exit Network that is localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p" * Jamie_Mitco_SPB_57.20482.20482.2 5.0064 0.4266 100.0 2468.3123 2467.7473 10597.8 1 7.922 57.5 1 K.EVVYENDEELNDIMAEISLLK.N Reverse_YNL243W 1 1 2.2% 968 108996 5.5 U SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" * Jamie_Mitco_SPB_36.12899.12899.2 2.0884 0.0434 93.2 2315.3523 2316.49 9392.0 104 3.196 32.5 1 R.PS*IAPEAVVPPTPTPTRAPT*R.A YDL060W 1 1 2.2% 788 90748 5.7 U TSR1 SGDID:S000002218, Chr IV from 341619-343985, Verified ORF, "Protein required for processing of 20S pre-rRNA in the cytoplasm, associates with pre-40S ribosomal particles" * Jamie_Mitco_SPB_28.10027.10027.2 2.5334 0.1318 99.5 1990.7322 1991.1156 8031.0 224 4.468 34.4 1 R.EFPDEIELEPSESAIER.L Reverse_YOR233W 1 1 2.2% 800 90088 9.5 U KIN4 SGDID:S000005759, Chr XV from 775846-778248, Verified ORF, "Nonessential protein kinase with unknown cellular role" * Jamie_Mitco_SPB_76.27059.27059.2 2.113 0.0827 96.6 2090.9321 2088.0786 5988.7 346 3.493 29.4 1 K.T*S*VVLEPAAYCPSGCSTK.M Reverse_YMR164C 1 1 2.2% 758 85050 7.8 U MSS11 SGDID:S000004774, Chr XIII from 589549-587273, reverse complement, Verified ORF, "Transcription factor involved in regulation of invasive growth and starch degradation; controls the activation of MUC1 and STA2 in response to nutritional signals" * Jamie_Mitco_SPB_100.35958.35958.2 1.7284 0.1528 96.9 1716.1721 1713.802 4590.6 11 3.409 40.6 1 K.LSANLSTKGGS*ASGNIR.S YGR178C 1 1 2.2% 722 78782 6.9 U PBP1 SGDID:S000003410, Chr VII from 853220-851052, reverse complement, Verified ORF, "Protein interacting with poly(A)-binding protein Pab1p; likely involved in control of the extent of mRNA polyadenylation; also interacts with Mkt1p to form a complex that may regulate translation of the HO mRNA" * Jamie_Mitco_SPB_24.08532.08532.2 2.1035 0.0369 92.6 1870.8522 1869.9824 7812.3 1 3.022 53.3 1 K.TFFPDEDTAIQEAQTR.F YLR342W 2 2 2.1% 1876 214849 7.2 U FKS1 SGDID:S000004334, Chr XII from 809997-815627, Verified ORF, "Catalytic subunit of 1,3-beta-D-glucan synthase, functionally redundant with alternate catalytic subunit Gsc2p; binds to regulatory subunit Rho1p; involved in cell wall synthesis and maintenance; localizes to sites of cell wall remodeling" * Jamie_Mitco_SPB_14.04987.04987.2 3.7216 0.2032 100.0 1823.6122 1821.9075 6641.7 1 4.68 60.0 1 K.AMEEANPEDTEETLNK.I * Jamie_Mitco_SPB_16.05733.05733.2 2.7401 0.145 99.5 2538.9722 2538.6814 9586.4 1 4.939 36.4 1 K.ILAEETAAYEGNENEAEKEDALK.S YML081W 1 1 2.1% 1251 141465 7.8 U YML081W SGDID:S000004546, Chr XIII from 104777-108532, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_50.17832.17832.4 3.2417 0.0751 91.4 3205.7766 3201.4265 7904.0 32 3.012 24.7 1 R.DMHRSASKFQSVS*ENISPREQMS*LFK.T Reverse_YJR151C 1 1 2.1% 1161 118359 4.4 U DAN4 SGDID:S000003912, Chr X from 715655-712170, reverse complement, Verified ORF, "Cell wall mannoprotein with similarity to Tir1p, Tir2p, Tir3p, and Tir4p; expressed under anaerobic conditions, completely repressed during aerobic growth" * Jamie_Mitco_SPB_52.18652.18652.3 2.7111 0.134 91.8 2674.1343 2675.647 7334.6 161 3.17 23.9 1 R.TPEVS*STFESVTTPEAS*STVQSSR.T YDR475C 1 1 2.1% 876 98691 9.6 U YDR475C SGDID:S000002883, Chr IV from 1410084-1407454, reverse complement, Uncharacterized ORF, "Protein of unknown function; previously annotated as two separate ORFs, YDR474C and YDR475C, which were merged as a result of corrections to the systematic reference sequence" * Jamie_Mitco_SPB_112.40103.40103.2 2.1523 0.0509 95.1 1990.7922 1991.9829 4561.1 36 3.472 32.4 1 R.REGS*ASPGRY*SSPPPASK.R YOL006C 1 1 2.1% 769 89995 8.7 U TOP1 SGDID:S000005366, Chr XV from 315387-313078, reverse complement, Verified ORF, "Topoisomerase I, nuclear enzyme that relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled DNA; functions in replication, transcription, and recombination" * Jamie_Mitco_SPB_22.07582.07582.2 2.5502 0.0396 98.3 1967.1122 1967.3219 7122.2 3 3.832 43.3 1 K.KFEKARQLKSYIDAIR.R YLR304C 1 1 2.1% 778 85368 8.1 U ACO1 SGDID:S000004295, Chr XII from 737550-735214, reverse complement, Verified ORF, "Aconitase, required for the tricarboxylic acid (TCA) cycle and also independently required for mitochondrial genome maintenance; component of the mitochondrial nucleoid; mutation leads to glutamate auxotrophy" * Jamie_Mitco_SPB_38.13360.13360.2 2.186 0.0248 92.6 1661.1921 1663.8282 7261.5 59 3.119 40.0 1 R.SASIVKDAAAHGLKS*K.T YKL104C 1 1 2.1% 717 80047 6.4 U GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" * Jamie_Mitco_SPB_30.10594.10594.2 2.5462 0.1953 99.7 1672.9521 1672.879 7572.3 22 4.003 53.6 1 R.SRGEIIDTLVDGLQR.L Reverse_YDR118W 1 1 2.1% 652 75256 5.8 U APC4 SGDID:S000002525, Chr IV from 685877-687835, Verified ORF, "Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition" * Jamie_Mitco_SPB_19.06769.06769.2 1.8638 0.1044 95.5 1543.7722 1542.6891 4178.0 293 3.104 38.5 1 K.PFVLS*ASRGDVSVK.A YMR008C 1 1 2.1% 664 71667 4.7 U PLB1 SGDID:S000004610, Chr XIII from 282584-280590, reverse complement, Verified ORF, "Phospholipase B (lysophospholipase) involved in lipid metabolism, required for deacylation of phosphatidylcholine and phosphatidylethanolamine but not phosphatidylinositol" * Jamie_Mitco_SPB_51.18161.18161.2 1.9017 0.0653 92.7 1579.3121 1579.6604 6270.1 85 3.283 42.3 1 R.EASGLSDNETEWLK.K YGL197W 1 1 2.0% 1487 167074 7.7 U MDS3 SGDID:S000003165, Chr VII from 124703-129166, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Pmd1p, for growth under alkaline conditions" * Jamie_Mitco_SPB_14.04794.04794.4 3.3001 0.0996 94.1 3335.4565 3341.4265 5668.1 169 3.797 19.5 1 R.DSHNSVGSIGFPNSMNIQGSRRSTS*GFS*PR.V Reverse_YER176W 1 1 2.0% 1121 126970 9.4 U ECM32 SGDID:S000000978, Chr V from 541685-545050, Verified ORF, "DNA dependent ATPase/DNA helicase belonging to the Dna2p- and Nam7p-like family of helicases that is involved in modulating translation termination; interacts with the translation termination factors, localized to polysomes" * Jamie_Mitco_SPB_17.05992.05992.2 2.1774 0.0149 91.1 2470.372 2471.9578 8439.7 3 3.019 40.5 1 K.WLPDGKRLVNKNGVVILGHKAR.T Reverse_YBR059C 1 1 2.0% 1108 123989 7.7 U AKL1 SGDID:S000000263, Chr II from 360185-356859, reverse complement, Verified ORF, "Ser-Thr protein kinase, member (with Ark1p and Prk1p) of the Ark kinase family; involved in endocytosis and actin cytoskeleton organization" * Jamie_Mitco_SPB_16.05431.05431.3 2.9324 0.1308 94.5 2340.7144 2340.4375 5441.7 130 4.238 27.4 1 K.ENALAEDSGITAAGY*STSKMSR.G Reverse_YCR067C 1 1 2.0% 1065 114079 4.7 U SED4 SGDID:S000000663, Chr III from 236317-233120, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p" * Jamie_Mitco_SPB_57.20376.20376.3 3.0524 0.1611 97.7 2257.7644 2260.5527 5469.7 60 3.537 28.8 1 R.PDIIRIVTPVES*SAIAAVTAR.Q YKR079C 1 1 2.0% 838 96816 5.9 U TRZ1 SGDID:S000001787, Chr XI from 588947-586431, reverse complement, Uncharacterized ORF, "tRNase Z, involved in RNA processing, has two putative nucleotide triphosphate-binding motifs (P-loop) and a conserved histidine motif, homolog of the human candidate prostate cancer susceptibility gene ELAC2" * Jamie_Mitco_SPB_34.12203.12203.2 2.2608 0.0497 95.9 2075.372 2075.413 6220.7 169 2.899 34.4 1 K.EVY*KDKIIAVKSFNVLK.N Reverse_YMR145C 1 1 2.0% 560 62774 9.3 U NDE1 SGDID:S000004753, Chr XIII from 556474-554792, reverse complement, Verified ORF, "Mitochondrial external NADH dehydrogenase, catalyzes the oxidation of cytosolic NADH; Nde1p and Nde2p are involved in providing the cytosolic NADH to the mitochondrial respiratory chain" * Jamie_Mitco_SPB_5.01558.01558.2 2.0249 0.0163 91.4 1416.8922 1417.7094 7255.5 316 2.979 55.0 1 K.IEKSLEPMWKR.L Reverse_YJL080C 1 1 1.9% 1222 134809 5.8 U SCP160 SGDID:S000003616, Chr X from 289142-285474, reverse complement, Verified ORF, "Essential RNA-binding G protein effector of mating response pathway, predominantly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins" * Jamie_Mitco_SPB_29.10289.10289.2 2.094 0.1007 97.6 2126.112 2124.3555 8142.1 8 3.099 29.5 1 K.AGLGTTLSPASPSPSPSNSVAPK.M Reverse_YJL076W 1 1 1.9% 1189 128531 7.8 U NET1 SGDID:S000003612, Chr X from 295161-298730, Verified ORF, "Core subunit of the RENT complex, which is a complex involved in nucleolar silencing and telophase exit; stimulates transcription by RNA polymerase I and regulates nucleolar structure" * Jamie_Mitco_SPB_16.05410.05410.4 3.4433 0.0473 91.1 2537.6565 2538.8179 5854.3 142 3.203 27.0 1 K.NIIKSDKVPVVS*GKLS*HLSIDK.P YBR121C 1 1 1.9% 667 75411 6.0 U GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation" * Jamie_Mitco_SPB_15.05362.05362.2 2.523 0.1636 99.5 1390.9321 1390.4436 6643.6 54 4.227 58.3 1 K.VDGVDGEVELDDK.L Reverse_YKR058W 1 1 1.9% 616 69724 4.4 U GLG1 SGDID:S000001766, Chr XI from 552412-554262, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin" * Jamie_Mitco_SPB_15.05225.05225.2 2.9695 0.0235 99.4 1535.2122 1534.8009 7232.7 149 2.892 63.6 1 K.IFNKQSWLSWPK.H YPL231W 1 1 1.8% 1887 206945 5.4 U FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" * Jamie_Mitco_SPB_60.21546.21546.3 4.2117 0.3427 100.0 4058.6643 4059.4297 6366.1 8 5.414 19.7 1 R.EAQIKDWVENELEALKLEAEEIPSEDQNEFLLER.T YKR096W 1 1 1.8% 1195 137491 5.4 U YKR096W SGDID:S000001804, Chr XI from 626435-630022, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_55.19456.19456.2 1.8831 0.1027 95.2 2429.3123 2431.3196 7116.0 139 3.117 30.0 1 K.ERKKSSNNDSSVTESST*GNS*R.N YIL112W 1 1 1.8% 1083 123556 5.7 U HOS4 SGDID:S000001374, Chr IX from 151592-154843, Uncharacterized ORF, "Subunit of the Set3 complex, which is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate" * Jamie_Mitco_SPB_48.17211.17211.2 1.9043 0.1302 97.4 2199.2122 2197.2864 6026.5 258 3.116 28.9 1 R.GSVSRSNDS*NKSSHIAVSKR.P YNL278W 1 1 1.8% 1060 118280 8.9 U CAF120 SGDID:S000005222, Chr XIV from 113271-116453, Verified ORF, "Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation" * Jamie_Mitco_SPB_82.29236.29236.2 1.9057 0.1696 99.2 2278.4922 2279.3564 9468.3 190 3.757 30.6 1 K.KDGFSQFMPS*AT*TKNPYAQ.- YOR005C 1 1 1.8% 944 108515 8.4 U DNL4 SGDID:S000005531, Chr XV from 337343-334509, reverse complement, Verified ORF, "DNA ligase required for nonhomologous end-joining (NHEJ), forms stable heterodimer with required cofactor Lif1p, catalyzes DNA ligation as part of a complex with Lif1p and Nej1p; involved in meiosis, not essential for vegetative growth" * Jamie_Mitco_SPB_40.14339.14339.2 2.0463 0.0491 93.2 2030.8922 2028.1893 7179.1 44 3.161 40.6 1 K.S*NPSYQAERSQLGLIRK.K YJR061W 1 1 1.8% 935 108427 6.6 U YJR061W SGDID:S000003822, Chr X from 550425-553232, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_26.09360.09360.2 2.1575 0.0152 91.0 2003.0922 2003.1301 6816.4 78 3.347 37.5 1 K.ELAISRS*DYAEKDLSPK.Q YGL227W 1 1 1.8% 958 108179 4.7 U VID30 SGDID:S000003196, Chr VII from 69671-72547, Verified ORF, "Protein involved in proteasome-dependent catabolite degradation of fructose-1,6-bisphosphatase (FBPase); shifts the balance of nitrogen metabolism toward the production of glutamate; localized to the nucleus and the cytoplasm" * Jamie_Mitco_SPB_57.20423.20423.2 2.563 0.1542 99.5 1967.3522 1966.9272 8798.3 166 3.534 37.5 1 K.NDNEAT*NVLS*NSGSKKK.N YDL117W 1 1 1.8% 885 100621 9.0 U CYK3 SGDID:S000002275, Chr IV from 248581-251238, Verified ORF, "SH3-domain protein located in the mother-bud neck and the cytokinetic actin ring; mutant phenotype and genetic interactions suggest a role in cytokinesis" * Jamie_Mitco_SPB_8.02830.02830.4 2.4592 0.1415 92.2 1854.9766 1856.8546 2284.3 366 3.333 30.0 1 R.NT*NIYSSSVSS*PKSPK.A Reverse_YGR145W 1 1 1.8% 707 81748 6.6 U ENP2 SGDID:S000003377, Chr VII from 781772-783895, Uncharacterized ORF, "Essential nucleolar protein of unknown function; contains WD repeats, interacts with Mpp10p and Bfr2p, and has homology to Spb1p" * Jamie_Mitco_SPB_13.04559.04559.1 1.82 0.0637 98.3 1604.07 1604.7689 3463.9 166 3.303 37.5 1 R.RNEFRPKSRGNDK.K Reverse_YBR056W 1 1 1.8% 501 57822 6.5 U YBR056W SGDID:S000000260, Chr II from 347877-349382, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_11.03773.03773.2 1.7512 0.1263 97.4 1079.5721 1080.232 7151.9 35 3.507 68.8 1 K.KASVYEARR.Q Reverse_YDR449C 1 1 1.8% 440 52418 9.0 U UTP6 SGDID:S000002857, Chr IV from 1358892-1357570, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * Jamie_Mitco_SPB_11.03847.03847.1 1.3685 0.0769 94.0 1091.02 1092.1937 7281.9 13 2.861 57.1 1 K.T*IFNLEFK.V Reverse_YDR097C 1 1 1.7% 1242 140080 5.8 U MSH6 SGDID:S000002504, Chr IV from 643832-640104, reverse complement, Verified ORF, "Protein required for mismatch repair in mitosis and meiosis, forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; potentially phosphorylated by Cdc28p" * Jamie_Mitco_SPB_50.17830.17830.4 3.0727 0.0708 90.1 2569.4966 2573.738 4116.0 219 3.172 27.5 1 K.NWAS*SPIYLTRPDYEPDSKPR.R Reverse_YKL064W 1 1 1.7% 969 109736 7.5 U MNR2 SGDID:S000001547, Chr XI from 317408-320317, Verified ORF, "Putative magnesium transporter; has similarity to Alr1p and Alr2p, which mediate influx of Mg2+ and other divalent cations" * Jamie_Mitco_SPB_44.15844.15844.2 2.0468 0.068 95.1 2037.6921 2039.4009 7252.6 33 3.391 36.7 1 R.KFKENEEMKKKESKVR.R YPL248C 1 1 1.7% 881 99403 7.2 U GAL4 SGDID:S000006169, Chr XVI from 82356-79711, reverse complement, Verified ORF, "DNA-binding transcription factor required for the activation of the GAL genes in response to galactose; repressed by Gal80p and activated by Gal3p" * Jamie_Mitco_SPB_29.10367.10367.2 2.0408 0.0987 97.1 1564.0521 1564.7356 6030.8 9 3.017 50.0 1 K.Y*VSPGSVGPSPVPLK.S Reverse_YDR311W 1 1 1.7% 642 72895 6.9 U TFB1 SGDID:S000002719, Chr IV from 1085060-1086988, Verified ORF, "Subunit of TFIIH and nucleotide excision repair factor 3 complexes, required for nucleotide excision repair, target for transcriptional activators" * Jamie_Mitco_SPB_17.05976.05976.2 2.2897 0.2499 94.1 1510.5122 1510.5571 7642.8 11 4.445 60.0 1 R.RKEEYIDADKY*.R Reverse_YCR072C 1 1 1.7% 515 57026 8.9 U RSA4 SGDID:S000000668, Chr III from 242347-240800, reverse complement, Verified ORF, "WD-repeat protein involved in ribosome biogenesis; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus" * Jamie_Mitco_SPB_7.02363.02363.2 1.9037 0.0354 93.0 986.9322 987.05444 5133.3 183 2.804 62.5 1 K.QAEEPTSPK.K YGL207W 1 1 1.6% 1035 118630 5.1 U SPT16 SGDID:S000003175, Chr VII from 98973-102080, Verified ORF, "Subunit of the heterodimeric FACT complex (Spt16p-Pob3p), facilitates RNA Polymerase II transcription elongation through nucleosomes by destabilizing and then reassembling nucleosome structure" * Jamie_Mitco_SPB_19.06555.06555.2 2.5429 0.2804 100.0 2053.372 2054.2207 7267.9 4 4.771 40.6 1 K.KVEELPYEESADNQFVR.S YLR389C 1 1 1.6% 1027 117579 6.7 U STE23 SGDID:S000004381, Chr XII from 902660-899577, reverse complement, Verified ORF, "Metalloprotease involved, with homolog Axl1p, in N-terminal processing of pro-a-factor to the mature form; member of the insulin-degrading enzyme family" * Jamie_Mitco_SPB_12.04019.04019.2 3.4945 0.3403 100.0 1791.9321 1792.8975 5911.5 3 6.334 56.7 1 K.DSTDKEINAVNSENKK.N YER032W 1 1 1.6% 876 98812 7.6 U FIR1 SGDID:S000000834, Chr V from 215062-217692, Verified ORF, "Protein involved in 3' mRNA processing, interacts with Ref2p; potential Cdc28p substrate" * Jamie_Mitco_SPB_33.11682.11682.2 2.3857 0.2663 96.9 1786.9321 1785.874 7522.4 28 4.611 42.3 1 R.QRSSKNKKPHEHT*Q.S Reverse_YOL141W 1 1 1.6% 695 78975 7.0 U PPM2 SGDID:S000005501, Chr XV from 56450-58537, Verified ORF, "Putative carboxyl methyl transferase, has similarity to Ppm1p but biochemical activity not yet demonstrated" * Jamie_Mitco_SPB_34.11910.11910.1 1.2903 0.0979 96.9 1406.7 1406.5382 3331.6 216 3.567 45.0 1 R.PTIY*KIQSGYR.Q YNL137C 1 1 1.6% 486 56356 9.6 U NAM9 SGDID:S000005081, Chr XIV from 370057-368597, reverse complement, Verified ORF, "Mitochondrial ribosomal component of the small subunit " * Jamie_Mitco_SPB_16.05567.05567.2 1.6744 0.1739 99.2 1100.6921 1100.1332 6364.8 75 3.887 64.3 1 K.WT*AKQETR.A YLL048C 1 1 1.5% 1661 189161 8.1 U YBT1 SGDID:S000003971, Chr XII from 46264-41279, reverse complement, Verified ORF, "Transporter of the ATP-binding cassette (ABC) family involved in bile acid transport; similar to mammalian bile transporters" * Jamie_Mitco_SPB_40.14377.14377.2 1.7049 0.1103 93.3 3002.3323 3005.3171 9801.4 4 3.873 27.1 1 K.RFES*ISRSPIYQHFSETLVGVTTIR.A YMR012W 1 1 1.5% 1277 145165 6.4 U CLU1 SGDID:S000004614, Chr XIII from 291133-294966, Verified ORF, "eIF3 component of unknown function; deletion causes defects in mitochondrial organization but not in growth or translation initiation, can rescue cytokinesis and mitochondrial organization defects of the Dictyostelium cluA- mutant" * Jamie_Mitco_SPB_35.12297.12297.2 3.045 0.1156 99.5 2109.872 2110.1956 7495.3 1 3.955 47.2 1 K.DANTGEEVTEDFVNDINVK.Y YKL105C 1 1 1.5% 1132 125593 5.8 U YKL105C SGDID:S000001588, Chr XI from 242227-238829, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" * Jamie_Mitco_SPB_34.12022.12022.2 1.9164 0.0773 93.6 1846.0721 1845.9181 7535.9 40 3.573 37.5 1 K.QSS*KVLNISSSTGQNSK.S YJR030C 1 1 1.5% 745 84290 7.2 U YJR030C SGDID:S000003791, Chr X from 486110-483873, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_12.04171.04171.3 2.3105 0.1992 97.7 1276.9443 1277.4172 3831.5 229 4.089 40.0 1 R.KSSSLLSIFS*K.N YDR243C 1 1 1.5% 588 66641 8.7 U PRP28 SGDID:S000002651, Chr IV from 950278-948512, reverse complement, Verified ORF, "RNA helicase in the DEAD-box family, involved in RNA isomerization at the 5' splice site" * Jamie_Mitco_SPB_15.05327.05327.2 1.8785 0.0518 94.0 1123.3322 1123.2107 6407.5 50 3.013 68.8 1 R.FPSPT*PIQR.I Reverse_YDR501W 1 1 1.5% 521 58202 9.2 U PLM2 SGDID:S000002909, Chr IV from 1451343-1452908, Verified ORF, "Protein required for partitioning of the 2-micron plasmid" * Jamie_Mitco_SPB_4.01287.01287.1 1.1244 0.0881 90.4 821.23 819.8497 5029.3 76 3.345 42.9 1 K.GSADKGER.V YNL068C 1 1 1.4% 862 94374 9.3 U FKH2 SGDID:S000005012, Chr XIV from 498290-495702, reverse complement, Verified ORF, "Transcription factor of the forkhead family that regulates the cell cycle and pseudohyphal growth; also involved in chromatin silencing at HML and HMR; potential Cdc28p substrate" * Jamie_Mitco_SPB_28.09835.09835.2 2.0209 0.046 93.7 1369.6322 1367.4991 5867.4 429 3.548 50.0 1 K.QTGLVLDS*NVLK.S Reverse_YAL017W 1 1 1.3% 1356 152330 5.7 U PSK1 SGDID:S000000015, Chr I from 120226-124296, Verified ORF, "One of two (see also PSK2) PAS domain containing S/T protein kinases; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status" * Jamie_Mitco_SPB_70.24993.24993.2 1.8802 0.0767 92.9 1874.0322 1874.9536 6678.8 31 3.064 32.4 1 K.GSSKSDALSETSPSLS*IK.S Reverse_YHL023C 1 1 1.3% 1146 129973 6.4 U RMD11 SGDID:S000001015, Chr VIII from 62561-59121, reverse complement, Verified ORF, "Protein required for sporulation" * Jamie_Mitco_SPB_22.07669.07669.2 2.1306 0.0435 93.5 1690.3522 1687.9834 8298.7 24 2.914 42.9 1 K.NGKKTSQSPKSKLKR.V Reverse_YJR002W 1 1 1.3% 593 66953 4.7 U MPP10 SGDID:S000003762, Chr X from 438779-440560, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, interacts with and controls the stability of Imp3p and Imp4p, essential for viability; similar to human Mpp10p" * Jamie_Mitco_SPB_12.03987.03987.2 1.8744 0.0212 91.8 928.2522 930.0922 4441.4 1 2.698 78.6 1 K.QNIVTINK.A Reverse_YPL260W 1 1 1.3% 551 62780 5.1 U YPL260W SGDID:S000006181, Chr XVI from 49303-50958, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_10.03300.03300.2 2.7129 0.065 99.5 916.7522 917.00977 4831.2 1 4.718 100.0 1 K.RIDDLER.V Reverse_YJR152W 1 1 1.3% 543 60850 8.6 U DAL5 SGDID:S000003913, Chr X from 719581-721212, Verified ORF, "Allantoin permease; ureidosuccinate permease; expression is constitutive but sensitive to nitrogen catabolite repression" * Jamie_Mitco_SPB_14.04871.04871.2 1.5743 0.0757 90.9 801.71216 802.9059 4606.0 29 3.083 83.3 1 R.EAAIKDR.R YGL173C 1 1 1.2% 1528 175459 7.5 U KEM1 SGDID:S000003141, Chr VII from 180119-175533, reverse complement, Verified ORF, "5'-3' exonuclease involved in mRNA decay, evolutionarily conserved component of cytoplasmic processing (P) bodies, plays a role in microtubule-mediated processes, filamentous growth, and ribosomal RNA maturation" * Jamie_Mitco_SPB_27.09683.09683.2 2.4811 0.0835 99.2 2183.392 2183.265 7083.3 2 3.941 41.2 1 K.MDLDSINPDETEEEFQNR.V YDL019C 1 1 1.2% 1283 145796 6.8 U OSH2 SGDID:S000002177, Chr IV from 421511-417660, reverse complement, Verified ORF, "Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability" * Jamie_Mitco_SPB_32.11322.11322.2 2.2965 0.3376 100.0 1790.1322 1789.8505 9940.9 198 4.956 35.7 1 S.ELLDQAAT*FEDSTLR.T YHR082C 1 1 1.2% 1029 117082 6.6 U KSP1 SGDID:S000001124, Chr VIII from 271550-268461, reverse complement, Verified ORF, "Nonessential putative serine/threonine protein kinase of unknown cellular role; overproduction causes allele-specific suppression of the prp20-10 mutation" * Jamie_Mitco_SPB_14.05044.05044.2 2.3018 0.2766 100.0 1451.6122 1450.5997 3998.4 1 4.598 63.6 1 R.NHHVSPTNQFLR.V Reverse_YNL014W 1 1 1.2% 1044 115868 6.2 U HEF3 SGDID:S000004959, Chr XIV from 606320-609454, Verified ORF, "Translational elongation factor EF-3; paralog of YEF3 and member of the ABC superfamily; stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA by the ribosome; normally expressed in zinc deficient cells" * Jamie_Mitco_SPB_25.08947.08947.1 1.2521 0.0839 91.2 1473.58 1474.6715 3658.8 32 3.201 37.5 1 K.TTGPYQFTMNSVK.V YFR040W 1 1 1.2% 1002 114989 4.7 U SAP155 SGDID:S000001936, Chr VI from 234229-237237, Verified ORF, "Protein that forms a complex with the Sit4p protein phosphatase and is required for its function; member of a family of similar proteins including Sap4p, Sap185p, and Sap190p" * Jamie_Mitco_SPB_21.07476.07476.1 1.4354 0.2412 100.0 1562.9 1563.6665 7597.9 278 4.117 36.4 1 R.KFSNHLS*DFFQI.I Reverse_YMR086W 1 1 1.2% 960 105874 9.7 U YMR086W SGDID:S000004692, Chr XIII from 439207-442089, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" * Jamie_Mitco_SPB_39.13693.13693.2 2.2686 0.0686 99.0 1319.2322 1318.5774 7973.8 70 3.678 54.5 1 K.SLSAMVSNRKPK.G YCL051W 1 1 1.2% 583 64792 8.1 U LRE1 SGDID:S000000556, Chr III from 35865-37616, Verified ORF, "Protein involved in control of cell wall structure and stress response; inhibits Cbk1p protein kinase activity; overproduction confers resistance to cell-wall degrading enzymes" * Jamie_Mitco_SPB_7.02314.02314.1 1.1138 0.15 100.0 891.6 892.04877 4910.4 48 3.428 50.0 1 K.TRPRSFK.S YBR275C 1 1 1.1% 1916 217959 6.6 U RIF1 SGDID:S000000479, Chr II from 757101-751351, reverse complement, Verified ORF, "Protein that binds to the Rap1p C-terminus and acts synergistically with Rif2p to help control telomere length and establish telomeric silencing; deletion results in telomere elongation" * Jamie_Mitco_SPB_29.10357.10357.2 2.1064 0.0465 93.6 2375.152 2375.5112 5655.9 21 3.056 30.0 1 R.IESSPIY*RIPGSSPKPS*PSSK.P YFL008W 1 1 1.1% 1225 141280 6.5 U SMC1 SGDID:S000001886, Chr VI from 119424-123101, Verified ORF, "Subunit of the multiprotein cohesin complex, essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure" * Jamie_Mitco_SPB_9.03241.03241.2 3.2518 0.1435 94.3 1474.0322 1476.546 4637.2 2 5.117 70.8 1 I.DELSNGQRSNSIR.A Reverse_YAR009C 1 1 1.1% 1196 136732 8.6 U YAR009C SGDID:S000000067, Chr I from 164188-160598, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YHR214C-B 1 1 0.7% 1793 202816 8.3 U YHR214C-B SGDID:S000003534, Chr VIII from 549346-547931,547929-543964, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YGR161W-B 1 1 0.7% 1770 202038 8.0 U YGR161W-B SGDID:S000007370, Chr VII from 811743-813035,813037-817056, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YGR161C-D 1 1 0.7% 1755 198558 8.5 U YGR161C-D SGDID:S000007368, Chr VII from 823020-821716,821714-817752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YGR038C-B 1 1 0.7% 1755 198520 8.2 U YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YGR027W-B 1 1 0.7% 1755 198656 8.2 U YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YFL002W-A 1 1 0.7% 1770 202038 8.0 U YFL002W-A SGDID:S000002962, Chr VI from 138199-139491,139493-143512, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YER160C 1 1 0.7% 1755 198569 8.5 U YER160C SGDID:S000000962, Chr V from 498119-496818,496816-492851, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YER138C 1 1 0.7% 1755 198561 8.1 U YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR365W-B 1 1 0.7% 1755 198658 8.0 U YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR316W-B 1 1 0.7% 1755 198526 8.2 U YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR261W-B 1 1 0.7% 1770 201961 8.3 U YDR261W-B SGDID:S000007397, Chr IV from 981456-982748,982750-986769, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR261C-D 1 1 0.8% 1604 181660 7.5 U YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR210W-B 1 1 0.7% 1770 202094 8.2 U YDR210W-B SGDID:S000007393, Chr IV from 872107-873399,873401-877420, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR210C-D 1 1 0.7% 1755 198838 8.4 U YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR098C-B 1 1 0.7% 1755 198594 8.4 U YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YDR034C-D 1 1 0.7% 1770 201964 8.2 U YDR034C-D SGDID:S000007345, Chr IV from 519352-518060,518058-514039, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YCL019W 1 1 0.7% 1770 202095 8.2 U YCL019W SGDID:S000000524, Chr III from 85101-86390,86392-90414, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YBR012W-B 1 1 0.7% 1756 198868 8.5 U YBR012W-B SGDID:S000002155, Chr II from 259867-261171,261173-265138, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YBL100W-B 1 1 0.7% 1770 202214 7.7 U YBL100W-B SGDID:S000002149, Chr II from 29932-31224,31226-35245, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YBL005W-B 1 1 0.7% 1755 198968 8.2 U YBL005W-B SGDID:S000002147, Chr II from 221333-222637,222639-226601, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Jamie_Mitco_SPB_36.12777.12777.2 2.1025 0.0188 91.7 1539.0322 1539.7716 5702.6 1 2.691 58.3 1 R.FKYGVYS*ALGILK.Q YLR249W 1 1 1.1% 1044 115945 6.0 U YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" YNL014W 1 1 1.1% 1044 115869 6.2 U HEF3 SGDID:S000004959, Chr XIV from 606320-609454, Verified ORF, "Translational elongation factor EF-3; paralog of YEF3 and member of the ABC superfamily; stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA by the ribosome; normally expressed in zinc deficient cells" Jamie_Mitco_SPB_11.03666.03666.2 2.1704 0.141 99.6 1391.4722 1391.4778 3716.8 19 4.242 59.1 1 K.ATETVDNKDIER.F YHR073W 1 1 1.1% 996 113760 8.6 U OSH3 SGDID:S000001115, Chr VIII from 242584-245574, Verified ORF, "Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability" * Jamie_Mitco_SPB_19.06711.06711.2 1.9357 0.0406 92.6 1474.7922 1473.814 5066.5 133 3.184 50.0 1 K.RRKRLQGFKKR.F YIL092W 1 1 1.1% 633 71006 9.0 U YIL092W SGDID:S000001354, Chr IX from 189063-190964, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_11.03892.03892.2 1.854 0.0188 92.7 840.4322 840.96075 3406.8 24 2.974 75.0 1 K.RASNHKK.Y YOL138C 1 1 1.0% 1341 149269 7.0 U YOL138C SGDID:S000005498, Chr XV from 65349-61324, reverse complement, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_111.39635.39635.1 1.3263 0.2743 100.0 1510.61 1511.5883 7086.5 41 4.415 34.6 1 H.DFITPNSNTSTRGT.T YPL217C 1 1 1.0% 1183 135571 6.8 U BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" * Jamie_Mitco_SPB_21.07331.07331.2 2.2159 0.1861 99.5 1219.8922 1219.383 2579.8 12 4.374 68.2 1 R.FLGAGILGNDNK.T YPL019C 1 1 1.0% 835 96553 7.4 U VTC3 SGDID:S000005940, Chr XVI from 517016-514509, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" * Jamie_Mitco_SPB_8.02806.02806.2 1.7418 0.0477 91.4 1043.5122 1043.2535 5123.6 175 3.042 71.4 1 K.FINNFIFK.N Reverse_YDL148C 1 1 1.0% 810 94302 7.4 U NOP14 SGDID:S000002307, Chr IV from 190587-188155, reverse complement, Verified ORF, "Nucleolar protein, forms a complex with Noc4p that mediates maturation and nuclear export of 40S ribosomal subunits; also present in the small subunit processome complex, which is required for processing of pre-18S rRNA" * Jamie_Mitco_SPB_113.40553.40553.1 1.372 0.0805 95.5 918.33 918.97925 3353.5 28 3.27 64.3 1 K.KEEAEANK.E YKL182W 1 1 0.9% 2051 228689 5.9 U FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" * Jamie_Mitco_SPB_29.10391.10391.2 2.2552 0.0729 97.4 2256.0723 2255.4058 8494.4 2 3.828 44.4 1 K.DSLWQSEHLEAVVDQDVQR.T Reverse_YOR191W 1 1 0.9% 1619 184405 7.5 U RIS1 SGDID:S000005717, Chr XV from 692475-697334, Verified ORF, "Member of the SWI/SNF family of DNA-dependent ATPases, plays a role in antagonizing silencing during mating-type switching, contains an N-terminal domain that interacts with Sir4p and a C-terminal SNF2 domain" * Jamie_Mitco_SPB_16.05602.05602.2 2.2481 0.0115 92.4 1806.0521 1804.9912 7753.5 217 2.642 39.3 1 K.KEGMVVLESHCCAQR.L Reverse_YER008C 1 1 0.9% 1336 154694 5.4 U SEC3 SGDID:S000000810, Chr V from 171817-167807, reverse complement, Verified ORF, "Non-essential subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, Exo84p) which mediates targeting of post-Golgi vesicles to sites of active exocytosis; Sec3p specifically is a spatial landmark for secretion" * Jamie_Mitco_SPB_13.04618.04618.2 2.2197 0.076 98.9 1567.3722 1566.7948 6827.5 22 3.106 54.5 1 K.LLEDLT*NWLLKK.N Reverse_YOR330C 1 1 0.9% 1254 143502 8.8 U MIP1 SGDID:S000005857, Chr XV from 943380-939616, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial DNA polymerase" * Jamie_Mitco_SPB_44.15826.15826.2 1.6007 0.1066 92.0 1302.7722 1303.3708 4832.3 18 3.482 55.0 1 K.DTSAFFDRDTK.D YPL216W 1 1 0.9% 1102 128133 7.3 U YPL216W SGDID:S000006137, Chr XVI from 143820-147128, Uncharacterized ORF, "Hypothetical protein" * Jamie_Mitco_SPB_59.20897.20897.2 2.1015 0.0762 98.7 1312.0322 1309.5521 4162.5 5 3.146 61.1 1 K.LKRQLKTLT*K.N Reverse_YPR042C 1 1 0.9% 1075 119508 8.8 U PUF2 SGDID:S000006246, Chr XVI from 653659-650432, reverse complement, Verified ORF, "Member of the PUF protein family, which is defined by the presence of Pumilio homology domains that confer RNA binding activity; preferentially binds mRNAs encoding membrane-associated proteins" * Jamie_Mitco_SPB_11.03769.03769.2 1.772 0.0591 91.5 1018.6322 1018.1612 5113.3 24 3.172 72.2 1 R.VSSVSVGRAR.G Reverse_YPR104C 1 1 0.9% 936 103502 5.9 U FHL1 SGDID:S000006308, Chr XVI from 736431-733621, reverse complement, Verified ORF, "Putative transcriptional regulator with similarity to DNA-binding domain of Drosophila forkhead; required for rRNA processing" * Jamie_Mitco_SPB_121.43529.43529.2 1.6624 0.0726 92.1 877.97217 877.88635 6558.6 37 3.562 71.4 1 R.QNDSATNK.R YKR054C 1 1 0.8% 4092 471351 6.3 U DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" * Jamie_Mitco_SPB_61.21893.21893.4 3.5151 0.0566 91.2 4087.4565 4085.5762 8604.9 207 2.687 17.7 1 R.IFDIT*LTEENAEMQRKREDLIKLNT*EYKLKLK.N YBR136W 1 1 0.8% 2368 273340 8.3 U MEC1 SGDID:S000000340, Chr II from 505662-512768, Verified ORF, "Genome integrity checkpoint protein and PI kinase superfamily member; signal transducer required for cell cycle arrest and transcriptional responses prompted by damaged or unreplicated DNA; monitors and participates in meiotic recombination" * Jamie_Mitco_SPB_58.20561.20561.2 2.1577 0.0656 96.1 2215.0122 2216.641 6827.8 11 2.932 36.1 1 K.T*VSALALLLEYNPFLLVMK.D Reverse_YDL112W 1 1 0.8% 1436 165047 6.1 U TRM3 SGDID:S000002270, Chr IV from 258915-263225, Verified ORF, "2'-O-ribose methyltransferase, catalyzes the ribose methylation of the guanosine nucleotide at position 18 of tRNAs" * Jamie_Mitco_SPB_80.28572.28572.2 1.9793 0.0912 96.8 1512.1522 1514.7173 4700.0 29 3.14 50.0 1 K.NMEARSSRFMER.A Reverse_YNL088W 1 1 0.8% 1428 164214 7.0 U TOP2 SGDID:S000005032, Chr XIV from 457706-461992, Verified ORF, "Essential type II topoisomerase, relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone of both positively and negatively supercoiled DNA; cleaves complementary strands; localizes to axial cores in meiosis" * Jamie_Mitco_SPB_10.03425.03425.2 1.7672 0.0764 92.6 1256.5922 1256.4875 5430.3 477 2.772 55.0 1 K.FTVKTYSPGKK.Y YGL131C 1 1 0.8% 1403 163203 8.6 U SNT2 SGDID:S000003099, Chr VII from 265864-261653, reverse complement, Verified ORF, "DNA binding protein with similarity to the S. pombe Snt2 protein" * Jamie_Mitco_SPB_19.06659.06659.2 2.1115 0.0073 92.4 1229.8121 1229.2432 6415.5 204 2.783 60.0 1 R.VTGGS*DDEKIK.I Reverse_YDR464W 1 1 0.8% 1435 161596 8.9 U SPP41 SGDID:S000002872, Chr IV from 1388862-1393169, Verified ORF, "Protein involved in negative regulation of expression of spliceosome components PRP4 and PRP3" * Jamie_Mitco_SPB_16.05502.05502.2 2.1553 0.0094 93.3 1405.8922 1406.4465 5432.1 12 2.905 60.0 1 K.KELSVET*KS*PK.K Reverse_YCR073C 1 1 0.8% 1331 152717 7.7 U SSK22 SGDID:S000000669, Chr III from 246579-242584, reverse complement, Verified ORF, "MAP kinase kinase kinase of the HOG1 mitogen-activated signaling pathway; functionally redundant with, and homologous to, Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p" * Jamie_Mitco_SPB_18.06131.06131.2 2.022 0.0378 94.5 1339.5521 1340.3464 5748.4 2 2.735 72.2 1 K.FNQKS*S*DILK.L YNL250W 1 1 0.8% 1312 152568 6.1 U RAD50 SGDID:S000005194, Chr XIV from 175411-179349, Verified ORF, "Subunit of MRX complex, with Mre11p and Xrs2p, involved in processing double-strand DNA breaks in vegetative cells, initiation of meiotic DSBs, telomere maintenance, and nonhomologous end joining" * Jamie_Mitco_SPB_15.05151.05151.2 3.1376 0.0509 99.5 1163.8121 1163.27 3325.0 253 3.47 66.7 1 K.ELKDLENSSK.T YDL031W 1 1 0.8% 995 113158 9.3 U DBP10 SGDID:S000002189, Chr IV from 394214-397201, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box protein family, constituent of 66S pre-ribosomal particles; essential protein involved in ribosome biogenesis" * Jamie_Mitco_SPB_12.04053.04053.2 2.4286 0.0075 99.2 987.4522 987.11615 4131.6 53 2.878 71.4 1 K.KT*AMKAEK.L Reverse_YNL091W 1 3 0.7% 1240 141514 5.4 U NST1 SGDID:S000005035, Chr XIV from 452410-456132, Verified ORF, "Protein of unknown function, mediates sensitivity to salt stress; interacts physically with the splicing factor Msl1p and also displays genetic interaction with MSL1" * Jamie_Mitco_SPB_14.04965.04965.3 3.0705 0.0895 98.7 1216.7943 1217.3677 6872.0 181 3.109 50.0 3 K.KLREKEEER.K Reverse_YJL129C 1 1 0.7% 1235 141073 8.5 U TRK1 SGDID:S000003665, Chr X from 177224-173517, reverse complement, Verified ORF, "Component of the Trk1p-Trk2p potassium transport system; 180 kDa high affinity potassium transporter" * Jamie_Mitco_SPB_115.41268.41268.1 1.3466 0.0817 92.5 902.02 903.02625 3209.7 27 2.873 56.2 1 K.NGNIGTAKK.L Reverse_YBR033W 1 1 0.7% 919 103397 8.6 U YBR033W SGDID:S000000237, Chr II from 301944-304703, Uncharacterized ORF, "Non-essential protein of unknown function" * Jamie_Mitco_SPB_14.04840.04840.2 1.562 0.0626 90.1 808.33215 809.86005 3387.5 6 3.334 80.0 1 K.REHPDR.I YNL271C 1 1 0.6% 1953 219701 6.5 U BNI1 SGDID:S000005215, Chr XIV from 135384-129523, reverse complement, Verified ORF, "Formin, nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables, functionally redundant with BNR1" * Jamie_Mitco_SPB_121.43353.43353.2 1.9179 0.0339 91.0 1205.1522 1206.3011 7637.7 338 3.028 55.0 1 R.NSSQASNKLTR.Q Reverse_YFL033C 1 1 0.6% 1770 196530 6.5 U RIM15 SGDID:S000001861, Chr VI from 74425-69113, reverse complement, Verified ORF, "Glucose-repressible protein kinase involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; originally identified as a regulator of IME2" * Jamie_Mitco_SPB_21.07309.07309.2 1.7924 0.104 95.6 1242.4521 1240.1608 5355.7 157 3.413 50.0 1 K.MAQSGGAT*NS*R.N YNL139C 1 1 0.6% 1597 183930 7.7 U RLR1 SGDID:S000005083, Chr XIV from 365719-360926, reverse complement, Verified ORF, "Subunit of the THO complex, which is required for efficient transcription elongation and involved in transcriptional elongation-associated recombination; required for LacZ RNA expression from certain plasmids" * Jamie_Mitco_SPB_30.10578.10578.2 1.8603 0.0468 92.6 1286.3522 1284.3315 6226.3 271 3.028 55.6 1 K.KNSS*QRSQLR.F YDR507C 1 1 0.6% 1142 129858 9.2 U GIN4 SGDID:S000002915, Chr IV from 1465776-1462348, reverse complement, Verified ORF, "Protein kinase involved in bud growth and assembly of the septin ring, proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Kcc4p and Hsl1p" * Jamie_Mitco_SPB_11.03905.03905.2 2.0394 0.0027 95.2 1036.2922 1036.0066 3721.7 174 2.613 75.0 1 K.KNKRS*S*R.S Reverse_YMR229C 1 1 0.5% 1729 193133 6.2 U RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome" * Jamie_Mitco_SPB_10.03555.03555.2 1.9189 0.0327 93.8 903.1122 902.1685 3831.7 320 3.289 71.4 1 K.KVSKIKAK.V Proteins Peptide IDs Spectra Unfiltered 11040 86946 94413 Filtered 360 1078 1217 Forward matches 248 964 1101 Decoy matches 112 114 116 Forward FP rate 45.16 11.83 10.54 Classification Nonredundant Proteins Redundant Proteins Unclassified 0 0