DTASelect v2.0.16
/data/1/catclw/Projects/Jamie/2and3
/garibaldi/people-b/applications/yates/dbase/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
 -p 1 --fp 0.1 --modstat --sp --noxc --nodcn --extra -e con
true	Use criteria
0.0	Minimum peptide confidence
0.1	Peptide false positive rate
0.0	Minimum protein confidence
1.0	Protein false positive rate
1	Minimum charge state
16	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
false	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
con	Exclude protein names matching
0	Minimum modified peptides per locus
1000	Minimum redundancy for low coverage loci
1	Minimum peptides per locus

Locus	Sequence Count	Spectrum Count	Sequence Coverage	Length	MolWt	pI	Validation Status	Descriptive Name
Unique	FileName	XCorr	DeltCN	Conf%	M+H+	CalcM+H+	TotalIntensity	SpR	ZScore	IonProportion	Redundancy	Sequence
YBR109C	4	9	46.3%	147	16135	4.3	U	CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" 
*	Jamie_phos_02_itms_37.13390.13390.4	4.426	0.2932	100.0	4111.3364	4109.526	7643.0	6	4.962	18.1	1	R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q
*	Jamie_phos_02_itms_37.13402.13402.3	5.3637	0.1528	100.0	4113.6846	4109.526	7248.9	1	6.365	25.7	4	R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q
*	Jamie_phos_02_itms_36.12982.12982.3	4.4717	0.2759	100.0	3908.6042	3909.288	8187.7	1	5.357	21.3	2	L.GLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q
*	Jamie_phos_02_itms_34.12526.12526.3	6.17	0.519	100.0	3366.6243	3366.7217	8673.5	1	8.23	30.0	2	K.LTDAEVDDMLREVSDGSGEINIQQFAALLSK.-
YMR230W	1	2	20.0%	105	12738	9.1	U	RPS10B SGDID:S000004843, Chr XIII from 732413-732464,732875-733140, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10" 
YOR293W	1	2	20.0%	105	12739	8.8	U	RPS10A SGDID:S000005819, Chr XV from 867095-867146,867584-867849, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Bp and has similarity to rat ribosomal protein S10" 
	Jamie_phos_02_itms_32.11764.11764.2	3.5246	0.4251	100.0	2739.892	2740.9849	10756.3	1	8.073	32.5	2	K.TQFSWQYYYYTLTEEGVEYLR.E
YER133W	1	1	17.9%	312	35907	5.5	U	GLC7 SGDID:S000000935, Chr V from 432491-432667,433193-433954, Verified ORF, "Catalytic subunit of type 1 serine/threonine protein phosphatase, involved in many processes including glycogen metabolism, sporulation, and mitosis; interacts with multiple regulatory subunits; predominantly isolated with Sds22p" 
*	Jamie_phos_02_itms_48.17414.17414.4	2.9265	0.1703	93.0	6458.4966	6453.1533	8901.3	124	4.41	12.1	1	R.PTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRA.H
YCR031C	2	3	16.8%	137	14537	10.7	U	RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" 
YJL191W	2	3	16.7%	138	14650	10.5	U	RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" 
	Jamie_phos_02_itms_17.06120.06120.2	2.9834	0.318	100.0	2584.9922	2585.876	7399.6	5	5.436	31.8	2	R.IYASFNDTFVHVTDLSGKETIAR.V
	Jamie_phos_02_itms_17.06104.06104.3	3.1753	0.239	100.0	2585.7544	2585.876	5672.0	77	5.008	26.1	1	R.IYASFNDTFVHVTDLSGKETIAR.V
YFR031C-A	3	7	16.5%	254	27408	11.1	U	RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" 
YIL018W	3	7	16.5%	254	27408	11.1	U	RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" 
	Jamie_phos_02_itms_15.05566.05566.3	5.5868	0.4521	100.0	2493.7744	2493.8247	9330.2	1	7.59	38.1	3	R.LREEIFIANEGVHTGQFIYAGK.K
	Jamie_phos_02_itms_14.05212.05212.3	4.5231	0.3123	100.0	2622.5344	2621.9988	10737.4	1	6.488	35.2	2	R.LREEIFIANEGVHTGQFIYAGKK.A
	Jamie_phos_02_itms_13.04697.04697.3	3.7918	0.2884	100.0	2098.8542	2099.3108	5964.1	2	5.411	37.5	2	R.ASGNYVIIIGHNPDENKTR.V
YJR009C	3	4	16.3%	332	35847	7.0	U	TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " 
*	Jamie_phos_02_itms_30.10837.10837.3	5.6915	0.297	100.0	3304.8245	3304.727	10836.1	1	7.49	31.0	1	K.IATFQERDPANLPWASLNIDIAIDSTGVFK.E
*	Jamie_phos_02_itms_31.11218.11218.3	4.54	0.2307	100.0	4094.5444	4090.579	9871.4	19	4.961	19.4	1	K.IATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQK.H
	Jamie_phos_02_itms_17.06078.06078.2	4.8002	0.3681	100.0	2128.2322	2128.3484	8637.3	1	7.697	68.8	2	K.FVKLVSWYDNEYGYSTR.V
YGR192C	2	4	15.7%	332	35747	7.0	U	TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " 
*	Jamie_phos_02_itms_26.09313.09313.3	4.3248	0.2501	92.6	3571.4644	3571.8762	8807.9	1	4.441	22.1	2	K.GVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPK.F
	Jamie_phos_02_itms_17.06078.06078.2	4.8002	0.3681	100.0	2128.2322	2128.3484	8637.3	1	7.697	68.8	2	K.FVKLVSWYDNEYGYSTR.V
YPL124W	2	2	15.0%	253	29280	9.5	U	SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" 
*	Jamie_phos_02_itms_14.05320.05320.3	3.8651	0.2672	100.0	2581.2544	2581.8882	8466.6	6	4.915	31.2	1	T.DKFASQNVIDDQRLEIKYLER.I
*	Jamie_phos_02_itms_16.05946.05946.2	3.5209	0.3366	90.0	2036.3121	2037.1449	6093.1	1	6.208	50.0	1	R.SSQIHIENES*TEDILKI.L
Reverse_YGR081C	1	1	14.8%	210	24069	10.0	U	SLX9 SGDID:S000003313, Chr VII from 643784-643152, reverse complement, Verified ORF, "Protein of unknown function; deletion mutant has synthetic fitness defect with an sgs1 deletion mutant" 
*	Jamie_phos_02_itms_42.15320.15320.3	2.8082	0.1175	92.0	3492.5044	3488.7515	9513.0	9	4.404	21.7	1	E.KPQHLFARPDSEIDYSEDLIGNNAVDPGFNQ.S
YHR139C	1	1	13.8%	326	34226	5.4	U	SPS100 SGDID:S000001181, Chr VIII from 379202-378222, reverse complement, Verified ORF, "Protein required for spore wall maturation; expressed during sporulation; may be a component of the spore wall" 
*	Jamie_phos_02_itms_89.32214.32214.3	1.845	0.1815	100.0	4478.6646	4475.7393	8616.1	4	4.89	13.6	1	V.VVSSGTSHNSTVASWTSVDFPVVYASDGSSGHDGSGIGFISNTSI.P
YJL177W	1	2	13.0%	184	20551	10.9	U	RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins" 
YKL180W	1	2	13.0%	184	20549	10.9	U	RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex" 
	Jamie_phos_02_itms_13.04777.04777.3	4.4404	0.4599	100.0	2701.4343	2702.0337	9106.0	1	7.512	33.7	2	R.INKYESSPSHIELVVTEKEEAVAK.A
Reverse_YPR057W	1	1	12.0%	341	39860	6.6	U	BRR1 SGDID:S000006261, Chr XVI from 672468-673493, Verified ORF, "snRNP protein component of spliceosomal snRNPs, required for pre-mRNA splicing and snRNP biogenesis; in null mutant newly-synthesized snRNAs are destabilized and 3'-end processing is slowed" 
*	Jamie_phos_02_itms_15.05368.05368.3	1.3316	0.2334	96.5	4777.5244	4779.435	4067.6	13	4.597	8.1	1	S.SKHRTRKQLNMHNKISIANTRLAEQRVSKLYEIVDPNVSSD.S
YFR028C	2	3	11.8%	551	61907	8.0	U	CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" 
*	Jamie_phos_02_itms_38.13697.13697.2	2.7374	0.3175	100.0	2521.7122	2519.7295	10529.6	1	5.204	33.3	1	R.DAGYSNADFEITIQDVVYGVWR.A
*	Jamie_phos_02_itms_30.10954.10954.4	5.8618	0.2558	100.0	4997.5767	4998.4727	10812.4	1	5.737	20.2	2	K.GLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPK.G
Reverse_YNL078W	1	1	11.1%	407	45909	9.9	U	NIS1 SGDID:S000005022, Chr XIV from 479769-480992, Verified ORF, "Protein localized in the bud neck at G2/M phase; physically interacts with septins; possibly involved in a mitotic signaling network" 
*	Jamie_phos_02_itms_5.02003.02003.4	3.6117	0.1544	93.5	5066.1367	5070.871	7314.6	98	4.485	15.2	1	M.TTPLSGPQSKPLKRSISRNRLYPPRSSTAYMQSRLFPIPTVAPDR.S
YPL131W	3	7	10.8%	297	33715	6.8	U	RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" 
*	Jamie_phos_02_itms_22.08176.08176.3	6.3388	0.4091	100.0	3499.8542	3500.7944	6384.8	1	7.335	35.0	3	K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V
*	Jamie_phos_02_itms_22.08135.08135.4	4.5164	0.1277	97.6	3501.3765	3500.7944	6274.0	6	4.625	23.9	2	K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V
*	Jamie_phos_02_itms_22.08074.08074.3	4.7342	0.4292	100.0	3488.4844	3486.7676	7151.8	1	6.547	25.0	2	L.GLDETYKGVEEVEGEYELTEAVEDGPRPFKV.F
YBL072C	1	1	10.5%	200	22490	10.7	U	RPS8A SGDID:S000000168, Chr II from 89123-88521, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Ap and has similarity to rat S8 ribosomal protein" 
YER102W	1	1	10.5%	200	22490	10.7	U	RPS8B SGDID:S000000904, Chr V from 363096-363698, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Bp and has similarity to rat S8 ribosomal protein" 
	Jamie_phos_02_itms_14.05052.05052.3	3.6919	0.3052	100.0	2352.1443	2352.6555	8003.4	1	5.767	36.2	1	R.ALRIETGNFSWASEGISKKTR.I
Reverse_YLR003C	1	1	9.3%	291	33394	8.2	U	YLR003C SGDID:S000003993, Chr XII from 157729-156854, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_phos_03_itms_14.06129.06129.2	1.0177	0.2077	90.2	3072.7522	3070.5896	3413.5	33	4.678	11.5	1	F.LKVCNKGGNLSRYVDAVRINSMSFVIK.K
YGR027C	1	1	9.3%	108	12039	10.3	U	RPS25A SGDID:S000003259, Chr VII from 534462-534136, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Bp and has similarity to rat S25 ribosomal protein" 
YLR333C	1	1	9.3%	108	12009	10.3	U	RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein" 
	Jamie_phos_02_itms_15.05371.05371.2	1.667	0.2725	100.0	1136.2922	1137.3213	8613.6	31	5.468	66.7	1	R.YVSVSVLVDR.L
YDR418W	1	1	9.1%	165	17823	9.4	U	RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
YEL054C	1	1	9.1%	165	17823	9.4	U	RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
	Jamie_phos_02_itms_18.06600.06600.2	3.2829	0.1886	97.5	1710.7722	1708.912	5628.3	1	4.966	57.1	1	K.HSGNIQLDEIIEIAR.Q
YJL063C	1	1	8.8%	238	26945	9.8	U	MRPL8 SGDID:S000003599, Chr X from 316391-315675, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" 
*	Jamie_phos_03_itms_30.11947.11947.3	2.2181	0.229	96.7	2579.8442	2576.0813	8876.2	118	4.533	27.5	1	D.NRKLMKRLFSEIAPRYLERPG.G
YKR017C	1	1	8.7%	551	63569	6.1	U	YKR017C SGDID:S000001725, Chr XI from 472992-471337, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; contains a RING finger motif" 
*	Jamie_phos_03_itms_38.14913.14913.4	3.3971	0.1829	100.0	5833.7363	5837.4937	5708.3	230	5.195	13.5	1	I.LLQHYDWNEERLLEVWTEKMDELLVELGLSTTANIKKDNDYNSHFREV.E
YNL121C	1	1	8.6%	617	70123	5.4	U	TOM70 SGDID:S000005065, Chr XIV from 400539-398686, reverse complement, Verified ORF, "Component of the TOM (translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially directed proteins; acts as a receptor for incoming precursor proteins" 
*	Jamie_phos_02_itms_30.10876.10876.4	3.6888	0.0716	96.6	5852.7764	5851.76	8875.4	147	4.54	13.8	1	S.NLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL.S
YMR100W	1	1	8.5%	620	72251	6.9	U	MUB1 SGDID:S000004706, Chr XIII from 466299-468161, Verified ORF, "Protein of unknown function, deletion causes multi-budding phenotype; has similarity to Aspergillus nidulans samB gene" 
*	Jamie_phos_03_itms_51.19538.19538.4	1.8489	0.2082	94.6	6239.3765	6237.3926	4917.2	132	4.487	8.7	1	F.LGRIVPKQDDVIWSLQLLAFVSKYTYMKSTLQNVELVESLSFRSMAYKIKQRI.S
Reverse_YOR209C	1	1	8.2%	429	49019	6.9	U	NPT1 SGDID:S000005735, Chr XV from 737726-736437, reverse complement, Verified ORF, "Nicotinate phosphoribosyltransferase, acts in the salvage pathway of NAD+ biosynthesis; required for silencing at rDNA and telomeres and has a role in silencing at mating-type loci; localized to the nucleus" 
*	Jamie_phos_03_itms_33.13095.13095.3	2.9044	0.2068	92.5	4210.6445	4206.841	10699.2	45	4.469	19.9	1	T.IAKEVNLSDSYCIIKSFKPLKLVDHYHHSIKKTYE.V
YFR024C-A	1	1	8.2%	451	48547	6.1	U	LSB3 SGDID:S000002968, Chr VI from 203421-203375,203256-201948, reverse complement, Verified ORF, "Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization" 
*	Jamie_phos_03_itms_29.11722.11722.3	2.6029	0.2538	100.0	3935.9644	3937.4937	10766.3	6	4.86	18.1	1	G.GVAAVFAYSKSKGLFAGVSVEGSAIIERREANRKFYG.D
YGR159C	1	1	7.7%	414	44535	4.9	U	NSR1 SGDID:S000003391, Chr VII from 807661-806417, reverse complement, Verified ORF, "Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis" 
*	Jamie_phos_02_itms_35.12583.12583.3	4.0896	0.328	100.0	3536.8442	3536.8762	4189.4	1	6.016	29.8	1	K.FGDTPSEPSDTLFLGNLSFNADRDAIFELFAK.H
Reverse_YER021W	1	1	7.6%	523	60393	5.6	U	RPN3 SGDID:S000000823, Chr V from 196947-198518, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control" 
*	Jamie_phos_02_itms_71.25715.25715.4	3.088	0.2214	98.7	4508.8965	4507.1055	10999.7	35	4.739	17.1	1	T.KKETNVSYFSAPYSNRLEASGPVSSKHNSTIFKLLNKKFS.S
YPL057C	1	1	7.6%	382	44808	9.0	U	SUR1 SGDID:S000005978, Chr XVI from 453054-451906, reverse complement, Verified ORF, "Probable catalytic subunit of a mannosylinositol phosphorylceramide (MIPC) synthase, forms a complex with probable regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p" 
*	Jamie_phos_02_itms_69.25091.25091.2	1.6662	0.2708	96.5	3228.5322	3226.81	7513.9	202	4.828	17.9	1	T.SPLGVSNDVMGSVPRHPFFLKALKSLKHY.D
YGL145W	1	1	7.1%	701	81167	6.3	U	TIP20 SGDID:S000003113, Chr VII from 230248-232353, Verified ORF, "Peripheral membrane protein required for fusion of COPI vesicles with the ER, prohibits back-fusion of COPII vesicles with the ER, may act as a sensor for vesicles at the ER membrane" 
*	Jamie_phos_03_itms_18.07529.07529.4	1.9791	0.1617	97.6	5801.5366	5804.4507	5139.1	201	4.638	10.5	1	K.LLEAQWDTQKFASTSVGLVKCLRENSTKLYQLSLLYLPLEEETQNGDSER.P
Reverse_YPL253C	1	1	7.1%	647	75730	7.8	U	VIK1 SGDID:S000006174, Chr XVI from 73006-71063, reverse complement, Verified ORF, "Protein that forms a complex with Kar3p at the spindle pole body, possible regulator of Kar3p function in microtubule-mediated processes; required for sister chromatid cohesion; has similarity to Cik1p" 
*	Jamie_phos_02_itms_72.26215.26215.3	1.4878	0.2702	91.2	5239.554	5237.019	5915.3	246	4.377	7.8	1	C.LQTQVEESITLLKNVNKSDNLNLLFFSKTDSILKKLVLAIPTECSE.K
YGR187C	1	1	6.9%	394	44952	4.7	U	HGH1 SGDID:S000003419, Chr VII from 871421-870237, reverse complement, Verified ORF, "Protein of unknown function with similarity to human HMG1 and HMG2; localizes to the cytoplasm" 
*	Jamie_phos_03_itms_47.17911.17911.3	2.0126	0.2251	96.6	3018.0544	3020.6624	8365.8	18	4.562	20.2	1	D.IIKMIMDPEHGTRVIIQQGVTILVNLS.E
YLR244C	1	1	6.7%	387	43373	7.9	U	MAP1 SGDID:S000004234, Chr XII from 626333-625170, reverse complement, Verified ORF, "Methionine aminopeptidase, catalyzes the cotranslational removal of N-terminal methionine from nascent polypeptides; function is partially redundant with that of Map2p" 
*	Jamie_phos_03_itms_50.19107.19107.2	1.6961	0.2168	98.7	2860.9922	2863.246	6863.0	169	5.056	22.0	1	A.QFEHTLLVTEHGVEILTARNKKSPGG.P
YOR310C	1	1	6.5%	511	56956	8.9	U	NOP58 SGDID:S000005837, Chr XV from 898355-896820, reverse complement, Verified ORF, "Protein involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA" 
*	Jamie_phos_02_itms_44.15972.15972.3	4.03	0.26	100.0	3588.5942	3586.9495	11440.5	26	5.02	20.3	1	K.TAAEVSMGTEITQTDLDNINALAEQIVEFAAYR.E
YER073W	1	1	6.5%	520	56621	8.3	U	ALD5 SGDID:S000000875, Chr V from 304027-305589, Verified ORF, "Mitochondrial aldehyde dehydrogenase, involved in regulation or biosynthesis of electron transport chain components and acetate formation; activated by K+; utilizes NADP+ as the preferred coenzyme; constitutively expressed" 
*	Jamie_phos_02_itms_47.17023.17023.3	3.3251	0.3182	100.0	3673.1343	3671.0405	10712.2	231	5.226	18.9	1	A.GTVWINTYNNFHQNVPFGGFGQSGIGREMGEAAL.S
YIL094C	1	1	6.5%	371	40069	8.0	U	LYS12 SGDID:S000001356, Chr IX from 187629-186514, reverse complement, Verified ORF, "Homo-isocitrate dehydrogenase, an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine, in which homo-isocitrate is oxidatively decarboxylated to alpha-ketoadipate" 
*	Jamie_phos_02_itms_65.23564.23564.2	1.9445	0.3324	100.0	2147.0723	2148.5076	8593.3	14	5.889	30.4	1	D.GAAALVGSLGVVPSANVGPEIVIG.E
YDL030W	1	1	6.4%	530	63030	6.5	U	PRP9 SGDID:S000002188, Chr IV from 397534-399126, Verified ORF, "Subunit of the SF3a splicing factor complex, required for spliceosome assembly; acts after the formation of the U1 snRNP-pre-mRNA complex" 
*	Jamie_phos_03_itms_24.09628.09628.4	2.1318	0.2104	92.1	3857.6565	3856.4487	9075.4	85	4.396	17.7	1	D.GQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGL.D
YBR118W	1	1	6.3%	458	50033	9.0	U	TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" 
YPR080W	1	1	6.3%	458	50033	9.0	U	TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" 
	Jamie_phos_03_itms_35.13756.13756.3	3.6448	0.2942	100.0	2925.7444	2925.2898	10483.2	1	6.062	26.8	1	K.NMITGTSQADCAILIIAGGVGEFEAGISK.D
YBR205W	1	1	5.7%	404	47482	8.7	U	KTR3 SGDID:S000000409, Chr II from 633617-634831, Verified ORF, "Putative alpha-1,2-mannosyltransferase involved in O- and N-linked protein glycosylation; member of the KRE2/MNT1 mannosyltransferase family" 
*	Jamie_phos_02_itms_31.11285.11285.2	2.1115	0.2144	91.2	2410.872	2411.738	6017.3	15	4.691	29.5	1	L.FFMSGSRSPEVPIAQGTSVSRVA.S
YHR019C	1	1	5.6%	554	62207	5.8	U	DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" 
*	Jamie_phos_02_itms_20.07337.07337.4	4.0555	0.1761	92.8	3579.2566	3579.7717	9078.6	13	4.423	21.1	1	K.DAITWLNEHDIKNEEGEDFKFGDDIAEAAER.K
YAL038W	2	11	5.6%	500	54545	7.7	U	CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" 
*	Jamie_phos_02_itms_26.09466.09466.3	5.9758	0.2809	100.0	3083.1543	3080.5486	10376.9	1	5.801	33.3	2	I.SAGRIIYVDDGVLSFQVLEVVDDKTLKV.K
*	Jamie_phos_02_itms_29.10603.10603.2	6.3102	0.3966	100.0	2269.7922	2267.581	7781.9	1	7.374	68.4	9	R.IIYVDDGVLSFQVLEVVDDK.T
YJL006C	1	1	5.6%	323	37905	8.1	U	CTK2 SGDID:S000003543, Chr X from 424024-423053, reverse complement, Verified ORF, "Beta subunit of C-terminal domain kinase I (CTDK-I), which phosphorylates the C-terminal repeated domain of the RNA polymerase II large subunit (Rpo21p) to affect both transcription and pre-mRNA 3' end processing; has similarity to cyclins" 
*	Jamie_phos_02_itms_27.09857.09857.2	2.0713	0.2565	100.0	1926.8922	1927.1156	7842.5	6	5.061	38.2	1	R.YVLSLELINGESSINSST.R
YAL067C	1	1	5.2%	593	68842	8.0	U	SEO1 SGDID:S000000062, Chr I from 9017-7236, reverse complement, Verified ORF, "Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide" 
*	Jamie_phos_03_itms_56.21364.21364.2	1.3031	0.195	91.3	3527.112	3529.0276	5326.2	24	4.688	18.3	1	R.LKWGFIPVKRQVEDLPDDLNSTEIVTISNSI.Q
YLR044C	1	1	5.2%	563	61495	6.2	U	PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" 
*	Jamie_phos_02_itms_44.15782.15782.3	3.5586	0.2086	100.0	3085.7944	3085.391	8916.8	1	5.616	28.6	1	K.EAVESADLILSVGALLSDFNTGSFSYSYK.T
YGL163C	1	1	5.1%	898	101754	9.0	U	RAD54 SGDID:S000003131, Chr VII from 196409-193713, reverse complement, Verified ORF, "DNA-dependent ATPase, stimulates strand exchange by modifying the topology of double-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; member of the SWI/SNF family" 
*	Jamie_phos_03_itms_51.19502.19502.3	1.7823	0.3324	92.9	5194.4346	5191.3115	4830.3	216	4.422	9.4	1	H.VIFVNLKPLQNELYNKLIKSREVKKVVKGVGGSQPLRAIGILKKLC.N
Reverse_YNL240C	1	1	5.1%	491	54151	7.6	U	NAR1 SGDID:S000005184, Chr XIV from 199978-198503, reverse complement, Verified ORF, "Nuclear architecture related protein; component of the cytosolic iron-sulfur (FeS) protein assembly machinery, required for maturation of cytosolic and nuclear FeS proteins; homologous to human Narf" 
*	Jamie_phos_02_itms_30.11095.11095.3	2.8327	0.242	95.6	2786.9043	2785.9578	8840.1	1	4.515	29.2	1	S.STICGSCALCDSLTISVKELQDPET.S
YGR015C	1	1	4.9%	328	37937	8.6	U	YGR015C SGDID:S000003247, Chr VII from 522080-521094, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_phos_02_itms_16.05816.05816.2	2.2723	0.2381	100.0	1723.5322	1724.1119	9036.3	3	5.072	46.7	1	F.SMGGKIALLTTLYKNI.N
YLR175W	1	1	4.6%	483	54705	8.9	U	CBF5 SGDID:S000004165, Chr XII from 506136-507587, Verified ORF, "Component of box H/ACA small nucleolar ribonucleoprotein particles (snoRNPs), probable rRNA pseudouridine synthase, binds to snoRNP Nop10p and also interacts with ribosomal biogenesis protein Nop53p" 
*	Jamie_phos_02_itms_49.17864.17864.2	2.3525	0.173	97.5	2525.132	2523.947	9585.9	112	4.995	26.2	1	Y.GAKLMIPGLLRYEEGIELYDEI.V
YNL197C	1	1	4.5%	661	71253	8.4	U	WHI3 SGDID:S000005141, Chr XIV from 269594-267609, reverse complement, Verified ORF, "RNA binding protein that binds to and sequesters the G1 cyclin CLN3 mRNA; regulates cell fate and dose-dependently inhibits passage through Start by regulating the critical cell size requirement necessary for cell cycle progression" 
*	Jamie_phos_03_itms_40.15391.15391.2	1.57	0.2471	97.6	3305.5322	3307.6594	9011.9	46	4.9	17.2	1	L.LRDNTEINEKIWGTSGIPSSINGYMSTPQP.S
YNL182C	1	1	4.5%	555	61773	5.7	U	IPI3 SGDID:S000005126, Chr XIV from 297629-295962, reverse complement, Uncharacterized ORF, "Protein required for cell viability; computational analysis of large-scale protein-protein interaction data suggests a possible role in assembly of the ribosomal large subunit" 
*	Jamie_phos_03_itms_73.27394.27394.2	1.6945	0.288	97.5	2755.0522	2752.9946	9706.3	6	5.032	25.0	1	M.DEQVIFTTNTSGTIASVHSFEQINL.R
YER033C	1	1	4.3%	1076	119350	4.9	U	ZRG8 SGDID:S000000835, Chr V from 221286-218056, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function, transcription is induced under conditions of zinc deficiency" 
*	Jamie_phos_03_itms_28.11221.11221.3	1.7659	0.2294	98.7	5171.784	5175.3364	8217.1	4	4.738	12.2	1	N.NGDENESDNLYQKRLENGKETFNGNHGGHHDDASLGETVDNKEQFL.I
Reverse_YOR112W	1	1	4.1%	761	84769	5.4	U	YOR112W SGDID:S000005638, Chr XV from 531508-533793, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_phos_03_itms_68.25683.25683.3	1.6692	0.1199	90.2	3306.5942	3310.8994	6033.2	85	4.377	17.5	1	I.PSKDLLGPAIVTLIKNAITNVDFLEISKELG.Y
YGR254W	1	4	3.9%	437	46816	6.6	U	ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" 
YHR174W	1	4	3.9%	437	46914	6.0	U	ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" 
	Jamie_phos_02_itms_29.10546.10546.2	5.6941	0.4911	100.0	1822.6322	1823.0099	9206.4	1	9.042	68.8	4	R.SGETEDTFIADLVVGLR.T
YER001W	1	1	3.8%	762	88529	7.2	U	MNN1 SGDID:S000000803, Chr V from 153519-155807, Verified ORF, "Alpha-1,3-mannosyltransferase, integral membrane glycoprotein of the Golgi complex, required for addition of alpha1,3-mannose linkages to N-linked and O-linked oligosaccharides, one of five S. cerevisiae proteins of the MNN1 family" 
*	Jamie_phos_03_itms_53.20399.20399.2	1.1972	0.343	100.0	3441.9521	3441.6982	4963.1	68	5.063	12.5	1	E.EQRLHIDAVNTVWSHANKDNTRSFTEEEI.K
YLR166C	1	1	3.7%	871	100342	6.3	U	SEC10 SGDID:S000004156, Chr XII from 498046-495431, reverse complement, Verified ORF, "Essential 100kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeting of secretory vesicles to active sites of exocytosis" 
*	Jamie_phos_03_itms_30.12052.12052.4	2.988	0.118	92.9	3637.0964	3639.1406	6862.5	2	4.413	21.5	1	F.SEQVATQEVIHSENVIKLSKDLHTTLLTFDKL.D
Reverse_YIL030C	1	1	3.6%	1319	151454	6.3	U	SSM4 SGDID:S000001292, Chr IX from 300008-296049, reverse complement, Verified ORF, "Ubiquitin-protein ligase of the ER/nuclear envelope, required for degradation of Alpha2p and other proteins containing a Deg1 degradation signal; ssm4 mutation suppresses mRNA instability caused by an rna14 mutation" 
*	Jamie_phos_03_itms_41.15903.15903.4	2.5495	0.1429	97.5	5330.0166	5332.68	8265.5	265	4.65	14.1	1	P.ANNIDREPIDHEVEEVENEDVAHEDLTNQGETFHLIDKAIKSLCVSG.V
YJL087C	1	1	3.6%	827	95337	7.8	U	TRL1 SGDID:S000003623, Chr X from 272401-269918, reverse complement, Verified ORF, "tRNA ligase, required for tRNA splicing; composed of three essential domains containing the phosphodiesterase, polynucleotide kinase, and ligase activities required for ligation; localized at the inner membrane of the nuclear envelope" 
*	Jamie_phos_02_itms_45.16363.16363.3	2.4424	0.2187	96.6	3450.9243	3450.7886	10108.7	39	4.544	20.7	1	Q.LAAMNINRSDFARMLYTHNVTAVAEYCDDS.F
Reverse_YPR088C	1	1	3.5%	541	59624	8.6	U	SRP54 SGDID:S000006292, Chr XVI from 713026-711401, reverse complement, Verified ORF, "Signal recognition particle (SRP) subunit (homolog of mammalian SRP54); contains the signal sequence-binding activity of SRP, interacts with the SRP RNA, and mediates binding of SRP to signal receptor; contains GTPase domain" 
*	Jamie_phos_02_itms_21.07663.07663.2	2.7344	0.1036	94.3	2183.912	2182.6626	9188.4	156	4.797	33.3	1	Q.AINSLPGMKMITQMQKKFD.L
Reverse_YDR517W	1	1	3.5%	372	41119	5.3	U	GRH1 SGDID:S000002925, Chr IV from 1477229-1478347, Uncharacterized ORF, "Golgi localized protein component of the spindle assembly checkpoint; homolog of human GRASP65, which functions in postmitotic reassembly of Golgi stacks" 
*	Jamie_phos_03_itms_86.31985.31985.3	2.1968	0.1719	94.5	1630.2244	1628.8834	8316.8	69	4.487	35.4	1	P.CHKVTPIRHLFGY.G
YDR385W	1	3	3.3%	842	93289	6.3	U	EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" 
YOR133W	1	3	3.3%	842	93289	6.3	U	EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" 
	Jamie_phos_02_itms_30.11020.11020.3	4.0066	0.2855	100.0	2977.3743	2977.2573	7458.7	1	5.837	25.9	3	K.TDGNSFLINLIDSPGHVDFSSEVTAALR.V
Reverse_YDR143C	1	1	3.3%	610	65618	5.2	U	SAN1 SGDID:S000002550, Chr IV from 743869-742037, reverse complement, Verified ORF, "Ubiquitin-protein ligase, involved in the proteasome-dependent degradation of aberrant nuclear proteins; san1 mutations suppress sir4, spt16, and cdc68 mutations, suggesting a role in chromatin silencing" 
*	Jamie_phos_02_itms_26.09608.09608.2	1.9633	0.2619	93.2	1814.4722	1811.865	6910.8	40	4.732	34.2	1	L.AGDPQHGGNGIGFSPGTGNA.I
YDR349C	1	1	3.2%	596	64498	5.0	U	YPS7 SGDID:S000002757, Chr IV from 1174168-1172378, reverse complement, Verified ORF, "Putative GPI-anchored aspartic protease, located in the cytoplasm and endoplasmic reticulum" 
*	Jamie_phos_02_itms_48.17243.17243.2	1.8716	0.2338	100.0	2054.7722	2053.319	10126.7	80	5.086	30.6	1	K.FDLIPYVDPVSNAVSVGYP.I
YLR398C	1	1	3.1%	1287	146058	6.7	U	SKI2 SGDID:S000004390, Chr XII from 919019-915156, reverse complement, Verified ORF, "Putative RNA helicase, involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs; forms complex with Ski3p and Ski8p; required for repressing propagation of dsRNA viruses" 
*	Jamie_phos_03_itms_42.16191.16191.4	2.4709	0.2382	92.6	4207.177	4210.6104	7536.5	13	4.461	17.5	1	E.VDLKEVANANASNSLSITRSINHNQNSVRGSTAQLPFTPG.G
YMR186W	1	1	3.0%	705	80900	4.8	U	HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" 
YPL240C	1	1	3.0%	709	81406	4.9	U	HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p" 
	Jamie_phos_02_itms_17.06418.06418.3	4.2656	0.3768	100.0	2511.4443	2511.699	8343.4	1	5.799	38.8	1	K.TLVDITKDFELEETDEEKAER.E
YKR050W	1	1	2.9%	889	101086	9.5	U	TRK2 SGDID:S000001758, Chr XI from 527457-530126, Verified ORF, "Component of the Trk1p-Trk2p potassium transport system" 
*	Jamie_phos_03_itms_59.22467.22467.2	1.3034	0.2094	97.6	2903.152	2902.2144	8604.0	57	4.902	20.0	1	T.MTLQQRELSGSSGNAARSRSFKDNLF.R
YGR217W	1	1	2.8%	2039	234597	8.4	U	CCH1 SGDID:S000003449, Chr VII from 924699-930818, Verified ORF, "Voltage-gated calcium channel involved in calcium influx in response to mating pheromones" 
*	Jamie_phos_03_itms_58.21880.21880.4	1.6984	0.1402	95.6	7027.6963	7025.0024	7249.7	57	4.493	9.2	1	S.ESMEVKEEEKRPQQIKHYLKFVYPQKIQEYTHASLVARIRKKFFGGHRNEDTRDFKQ.F
YIR019C	1	1	2.8%	1367	136110	4.3	U	MUC1 SGDID:S000001458, Chr IX from 393672-389569, reverse complement, Verified ORF, "GPI-anchored cell surface glycoprotein required for diploid pseudohyphal formation and haploid invasive growth, transcriptionally regulated by the MAPK pathway (via Ste12p and Tec1p) and the cAMP pathway (via Flo8p)" 
*	Jamie_phos_03_itms_66.24981.24981.3	1.5982	0.1599	92.2	3662.3643	3658.7705	5703.3	18	4.389	14.2	1	S.TTESSSTPVTSSTTESSSAPVPTPSSSTTESSSAPVPT.P
Reverse_YER110C	1	1	2.8%	1113	122601	4.6	U	KAP123 SGDID:S000000912, Chr V from 382099-378758, reverse complement, Verified ORF, "Karyopherin beta, mediates nuclear import of ribosomal proteins prior to assembly into ribosomes and import of histones H3 and H4; localizes to the nuclear pore, nucleus, and cytoplasm; exhibits genetic interactions with RAI1" 
*	Jamie_phos_02_itms_57.20807.20807.2	1.8636	0.2737	97.4	3339.3323	3336.8125	8066.6	2	5.056	21.7	1	V.PRFNDFVKAFDGALAQSLSVLVELAVDQLTA.E
YDR379W	1	1	2.8%	1009	113291	7.9	U	RGA2 SGDID:S000002787, Chr IV from 1230157-1233186, Verified ORF, "GTPase-activating protein for the polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth" 
*	Jamie_phos_02_itms_48.17395.17395.2	2.0236	0.2165	97.6	3099.3323	3101.2212	9489.6	94	4.911	20.4	1	E.ETSSHARTVSIDDILNSTLEHDSNSIEE.Q
YMR287C	1	1	2.8%	969	110822	9.0	U	MSU1 SGDID:S000004900, Chr XIII from 845344-842435, reverse complement, Verified ORF, "RNase, component of the mitochondrial degradosome along with the ATP-dependent RNA helicase Suv3p; the degradosome associates with the ribosome and mediates turnover of aberrant or unprocessed RNAs" 
*	Jamie_phos_03_itms_36.14270.14270.2	2.1038	0.2095	97.4	3176.3123	3178.5964	6328.2	9	5.043	19.2	1	V.FRCYKQLPLGEVAQQQYDSMITSTKKG.I
YIL149C	4	5	2.5%	1679	195140	6.0	U	MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" 
*	Jamie_phos_02_itms_14.05101.05101.2	3.7342	0.4085	100.0	1548.6921	1549.721	7204.5	1	6.796	70.8	1	R.LVEFSNVNELQEK.N
*	Jamie_phos_02_itms_20.07163.07163.2	3.0335	0.1763	93.3	2117.632	2118.3916	9351.8	3	4.717	41.2	2	R.LVEFSNVNELQEKNVELL.N
*	Jamie_phos_02_itms_19.07052.07052.3	3.7466	0.2511	100.0	2662.5244	2661.9812	10217.4	1	6.025	34.5	1	R.LVEFSNVNELQEKNVELLNCIR.I
*	Jamie_phos_02_itms_15.05621.05621.2	4.6839	0.5009	100.0	2053.912	2054.1777	8999.0	1	8.204	50.0	1	K.AAINFSNVTDLTNNSTDGAK.I
YCR098C	1	1	2.5%	518	57322	8.5	U	GIT1 SGDID:S000000695, Chr III from 298601-297045, reverse complement, Verified ORF, "Plasma membrane permease, mediates uptake of glycerophosphoinositol and glycerophosphocholine as sources of the nutrients inositol and phosphate; expression and transport rate are regulated by phosphate and inositol availability" 
*	Jamie_phos_03_itms_81.30131.30131.3	2.0415	0.2328	98.7	1384.8544	1380.5499	4749.2	32	4.73	33.3	1	T.GKIGSVVGVECFQ.P
YDL140C	1	1	2.3%	1733	191610	5.6	U	RPO21 SGDID:S000002299, Chr IV from 210562-205361, reverse complement, Verified ORF, "RNA polymerase II largest subunit B220, part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime" 
*	Jamie_phos_03_itms_59.22322.22322.3	2.1094	0.197	97.6	4320.9844	4320.083	8686.3	6	4.622	16.4	1	V.PDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFD.E
YOR373W	1	1	2.2%	851	94104	7.0	U	NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" 
*	Jamie_phos_02_itms_15.05422.05422.2	2.802	0.3447	100.0	2142.5122	2143.2659	6204.7	1	6.827	44.4	1	R.VEDITSISEVNTSFNETEK.Q
Reverse_YIR019C	1	1	2.1%	1367	136110	4.3	U	MUC1 SGDID:S000001458, Chr IX from 393672-389569, reverse complement, Verified ORF, "GPI-anchored cell surface glycoprotein required for diploid pseudohyphal formation and haploid invasive growth, transcriptionally regulated by the MAPK pathway (via Ste12p and Tec1p) and the cAMP pathway (via Flo8p)" 
*	Jamie_phos_03_itms_21.08626.08626.2	1.6342	0.292	92.2	3322.892	3320.856	6208.7	5	4.711	19.6	1	I.LYTNENYGYLQVTGKPGTVGIIKLSWLYK.L
Reverse_YCL024W	1	1	1.9%	1037	116475	8.7	U	KCC4 SGDID:S000000529, Chr III from 79161-82274, Verified ORF, "Protein kinase of the bud neck involved in the septin checkpoint, associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p" 
*	Jamie_phos_03_itms_59.22286.22286.2	1.5446	0.2263	95.4	2356.2522	2358.801	10262.5	108	4.809	26.3	1	N.TEWVDYLSLVNPHSLLKMIV.I
Reverse_YOL081W	1	1	1.0%	3079	351669	7.1	U	IRA2 SGDID:S000005441, Chr XV from 171069-180308, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin" 
*	Jamie_phos_03_itms_24.09632.09632.2	1.605	0.2204	96.4	2920.0322	2920.122	10851.1	14	4.89	24.1	1	Q.EATYGTPTSNSPSAAAAAAAAASNLRQQLQ.T
YBL004W	1	1	1.0%	2493	287559	7.0	U	UTP20 SGDID:S000000100, Chr II from 227639-235120, Uncharacterized ORF, "Possible snoRNA-binding protein, based on computational analysis of large-scale protein-protein interaction data" 
*	Jamie_phos_03_itms_43.16593.16593.3	2.0132	0.1477	90.5	2760.5344	2757.0442	8064.8	2	4.367	25.0	1	V.PELESISKLVADLNSYSSSRMHEY.D
YPR021C	1	1	0.9%	902	104304	8.0	U	AGC1 SGDID:S000006225, Chr XVI from 603354-600646, reverse complement, Verified ORF, "Mitochondrial transporter, acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism, ornithine synthesis, and the malate-aspartate NADH shuttle" 
*	Jamie_phos_02_itms_11.04224.04224.2	1.1677	0.1936	100.0	923.15216	924.0166	3425.4	105	5.573	35.7	1	K.DKATMRSD.L
	Proteins	Peptide IDs	Spectra
Unfiltered	11461	127925	160882
Filtered	78	94	128
Forward matches	61	77	111
Decoy matches	17	17	17
Forward FP rate	27.87	22.08	15.32

Classification	Nonredundant Proteins	Redundant Proteins
Unclassified	0	0