| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YIL002W-A | 14 | 15 | 98.6% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
| U | YKL042W | 33 | 43 | 81.8% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| U | YIL149C | 141 | 181 | 67.2% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| U | YNL225C | 48 | 73 | 63.9% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| U | YLR212C | 11 | 12 | 55.6% | 473 | 52628 | 4.7 | TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" |
| U | YDR356W | 48 | 53 | 53.9% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| U | YBR109C | 5 | 20 | 52.4% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.25508.25508.3 | 6.5366 | 0.5394 | 100.0% | 4108.935 | 4106.9326 | 1 | 8.622612 | 34.5% | 16 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
| * | Jamie_Mit_09102008.13006.13006.3 | 5.5928 | 0.5324 | 100.0% | 4331.034 | 4329.1924 | 1 | 8.779579 | 39.4% | 1 | K.HVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK.- | 3 |
| * | Jamie_Mit_09102008.13119.13119.4 | 4.3534 | 0.4791 | 100.0% | 4331.195 | 4329.1924 | 1 | 8.109242 | 40.0% | 1 | K.HVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK.- | 4 |
| * | Jamie_Mit_09102008.13715.13715.3 | 5.1966 | 0.3999 | 100.0% | 3366.65 | 3364.6582 | 1 | 6.8878174 | 35.3% | 1 | K.LTDAEVDDMLREVSDGSGEINIQQFAALLSK.- | 3 |
| * | Jamie_Mit_09102008.10247.10247.2 | 6.006 | 0.4644 | 100.0% | 2106.073 | 2106.0718 | 1 | 8.643935 | 56.7% | 1 | R.EVSDGSGEINIQQFAALLSK.- | 2 |
| U | YLR146W-A | 1 | 1 | 46.8% | 62 | 7078 | 4.8 | YLR146W-A SGDID:S000113566, Chr XII from 433871-434059, Uncharacterized ORF, "Putative protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.10359.10359.4 | 3.1813 | 0.369 | 90.5% | 3399.6565 | 3397.7397 | 7 | 5.633504 | 41.9% | 1 | T.TASVEHARMLQNEIQQLFAQLRDTNSQIR.C | 4 |
| U | YOR257W | 4 | 4 | 46.0% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3306.3306.2 | 2.1862 | 0.1775 | 97.3% | 1859.9722 | 1858.9398 | 4 | 4.3442397 | 57.9% | 1 | R.SSLQSGPLNSELLEEQK.Q | 2 |
| * | Jamie_Mit_09102008.3819.3819.3 | 2.8089 | 0.3327 | 100.0% | 1834.9435 | 1834.934 | 1 | 5.190229 | 54.1% | 1 | R.AFQLFDDDHTGKISIK.N | 3 |
| * | Jamie_Mit_09102008.2836.2836.2 | 4.1603 | 0.4146 | 100.0% | 1705.9122 | 1702.8862 | 1 | 7.1289306 | 73.9% | 1 | R.VAKELGETLTDEELR.A | 2 |
| * | Jamie_Mit_09102008.14077.14077.3 | 4.5266 | 0.31 | 90.0% | 4633.43 | 4631.118 | 5 | 5.6275625 | 30.0% | 1 | R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS.- | 3 |
| U | YOR373W | 21 | 25 | 42.5% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| U | YPL124W | 9 | 14 | 39.5% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.1225.1225.3 | 5.6439 | 0.3712 | 100.0% | 1953.9698 | 1952.9678 | 1 | 6.6126385 | 61.7% | 1 | K.LREENFSSNTSELGNKK.H | 3 |
| * | Jamie_Mit_09102008.1875.1875.4 | 3.0476 | 0.2478 | 99.6% | 2410.1853 | 2409.1912 | 9 | 5.4329753 | 38.8% | 2 | K.LREENFSSNTSELGNKKHYR.A | 4 |
| * | Jamie_Mit_09102008.4413.4413.2 | 2.1805 | 0.3319 | 100.0% | 1757.9104 | 1757.8685 | 1 | 5.7587204 | 57.9% | 1 | R.LPPPPFSSYGMPPTNR.S | 2 |
| * | Jamie_Mit_09102008.2618.2618.3 | 3.5498 | 0.2142 | 99.5% | 2122.102 | 2120.0986 | 1 | 4.9984756 | 60.8% | 1 | R.TDKFASQNVIDDQRLEIK.Y | 3 |
| * | Jamie_Mit_09102008.5835.5835.3 | 4.755 | 0.4573 | 100.0% | 2256.1704 | 2255.1672 | 1 | 7.569891 | 68.6% | 1 | K.YLERIVYDQGTVIDNLTSR.I | 3 |
| * | Jamie_Mit_09102008.4220.4220.2 | 6.6265 | 0.5097 | 100.0% | 1696.8849 | 1693.8761 | 1 | 9.880062 | 100.0% | 5 | R.IVYDQGTVIDNLTSR.I | 2 |
| * | Jamie_Mit_09102008.8422.8422.2 | 3.9198 | 0.3813 | 100.0% | 1763.9662 | 1763.9656 | 1 | 6.632952 | 58.3% | 1 | R.ITRLESFILNSISDR.G | 2 |
| * | Jamie_Mit_09102008.7267.7267.3 | 4.1012 | 0.4133 | 100.0% | 3106.5955 | 3105.6082 | 1 | 5.965115 | 42.9% | 1 | R.ITRLESFILNSISDRGDKNFASLEHSR.S | 3 |
| * | Jamie_Mit_09102008.7381.7381.4 | 3.2879 | 0.2382 | 99.6% | 3106.6272 | 3105.6082 | 1 | 4.7206583 | 44.6% | 1 | R.ITRLESFILNSISDRGDKNFASLEHSR.S | 4 |
| U | YAL047C | 14 | 20 | 33.9% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| U | YPL213W | 1 | 1 | 20.2% | 238 | 27193 | 7.6 | LEA1 SGDID:S000006134, Chr XVI from 150613-151329, Verified ORF, "Component of U2 snRNP; disruption causes reduced U2 snRNP levels; physically interacts with Msl1p; putative homolog of human U2A' snRNP protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.8992.8992.4 | 2.422 | 0.146 | 90.8% | 5299.4966 | 5296.6406 | 12 | 3.9332924 | 24.4% | 1 | R.LVPHLETLDFQNVTAEERKSAMSFPRQADGDTLGPVNTAIRDNGSRDK.T | 4 |
| U | Reverse_YKL016C | 1 | 1 | 20.1% | 174 | 19810 | 9.0 | ATP7 SGDID:S000001499, Chr XI from 407632-407108, reverse complement, Verified ORF, "Subunit d of the stator stalk of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.20592.20592.4 | 2.634 | 0.1401 | 91.8% | 3739.3948 | 3739.058 | 31 | 3.74094 | 25.4% | 1 | R.KKFSSLQTATSGTIRLSSIVKAWDLKNAASKALSM.- | 4 |
| U | Reverse_YER104W | 1 | 1 | 19.2% | 208 | 24413 | 5.5 | RTT105 SGDID:S000000906, Chr V from 366798-367424, Verified ORF, "Protein with a role in regulation of Ty1 transposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7924.7924.3 | 2.254 | 0.2013 | 95.3% | 4808.304 | 4806.1714 | 12 | 4.252291 | 25.7% | 1 | K.YTEQKEIFALLEDDELDENNQWEMYEAMDSPLANKQAEQK.L | 3 |
| U | Reverse_YLR377C | 1 | 1 | 17.0% | 348 | 38263 | 6.0 | FBP1 SGDID:S000004369, Chr XII from 874791-873745, reverse complement, Verified ORF, "Fructose-1,6-bisphosphatase, key regulatory enzyme in the gluconeogenesis pathway, required for glucose metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.14735.14735.4 | 2.7353 | 0.1427 | 92.8% | 6523.219 | 6521.3867 | 47 | 4.500215 | 22.8% | 1 | K.DIEGSSGLWISSKDHIHSPVLDLIREGRDNVAKGGAQEMLFAMPFAEYLLRLKGNPSKK.D | 4 |
| U | YFR028C | 5 | 10 | 16.3% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17864.17864.4 | 2.3315 | 0.3044 | 99.6% | 5196.4336 | 5194.4136 | 1 | 4.61465 | 28.2% | 1 | R.VYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYR.F | 4 |
| * | Jamie_Mit_09102008.356.356.4 | 3.4699 | 0.1853 | 97.6% | 2653.2507 | 2651.2634 | 1 | 5.427044 | 51.9% | 6 | R.KGQNGSNTIEDINNNRNPTSHANR.K | 4 |
| * | Jamie_Mit_09102008.125.125.3 | 2.7599 | 0.3094 | 100.0% | 2653.2593 | 2651.2634 | 17 | 5.0692763 | 23.8% | 1 | R.KGQNGSNTIEDINNNRNPTSHANR.K | 3 |
| * | Jamie_Mit_09102008.700.700.4 | 2.6519 | 0.1248 | 90.9% | 2782.3423 | 2779.3584 | 4 | 3.619635 | 42.3% | 1 | R.KGQNGSNTIEDINNNRNPTSHANRK.V | 4 |
| * | Jamie_Mit_09102008.3554.3554.2 | 4.9179 | 0.3565 | 100.0% | 2305.112 | 2304.0413 | 1 | 6.5422044 | 88.5% | 1 | R.MEDNEPSATNINNAADDTILR.Q | 2 |
| U | YPL255W | 4 | 4 | 15.6% | 385 | 45384 | 6.5 | BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.429.429.2 | 2.6258 | 0.1976 | 98.7% | 1290.8062 | 1290.6807 | 1 | 4.254081 | 72.2% | 1 | K.LFNKDGVNEVR.R | 2 |
| * | Jamie_Mit_09102008.3280.3280.2 | 2.4824 | 0.0606 | 90.9% | 1678.751 | 1676.7549 | 17 | 4.0273137 | 50.0% | 1 | R.DLEDLCEDVREQR.E | 2 |
| * | Jamie_Mit_09102008.4422.4422.3 | 2.9526 | 0.2448 | 99.6% | 2339.1165 | 2337.2124 | 1 | 5.6490183 | 60.0% | 1 | R.LSDLELKYTNLQIEKDMQR.D | 3 |
| * | Jamie_Mit_09102008.12017.12017.3 | 5.9017 | 0.2402 | 100.0% | 2061.0583 | 2058.0508 | 1 | 5.427338 | 68.1% | 1 | R.DNYESEIHDLLLQLSLR.N | 3 |
| U | YDR050C | 1 | 1 | 15.3% | 248 | 26795 | 6.0 | TPI1 SGDID:S000002457, Chr IV from 556469-555723, reverse complement, Verified ORF, "Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2119.2119.4 | 2.1136 | 0.1649 | 90.6% | 3800.0342 | 3798.9666 | 58 | 3.8595848 | 25.4% | 1 | K.AASELRILYGGSANGSNAVTFKDKADVDGFLVGGASLK.P | 4 |
| U | YDL130W | 1 | 1 | 15.1% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4740.4740.2 | 4.3829 | 0.5433 | 100.0% | 1665.8121 | 1663.808 | 1 | 8.884825 | 90.0% | 1 | K.AAGANVDNVWADVYAK.A | 2 |
| U | YHR172W | 9 | 9 | 14.3% | 823 | 96825 | 6.4 | SPC97 SGDID:S000001215, Chr VIII from 448335-450806, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" |
| U | YBL092W | 1 | 1 | 13.8% | 130 | 14771 | 11.2 | RPL32 SGDID:S000000188, Chr II from 45975-46367, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L32 ribosomal protein; overexpression disrupts telomeric silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21547.21547.2 | 1.5605 | 0.2019 | 94.5% | 1893.3722 | 1891.222 | 28 | 4.937038 | 21.7% | 1 | R.VVILARAKALGIKVTNPK.G | 2 |
| U | YGR132C | 1 | 1 | 13.2% | 287 | 31427 | 8.2 | PHB1 SGDID:S000003364, Chr VII from 756457-755594, reverse complement, Verified ORF, "Subunit of the prohibitin complex (Phb1p-Phb2p), a 1.2 MDa ring-shaped inner mitochondrial membrane chaperone that stabilizes newly synthesized proteins; determinant of replicative life span; involved in mitochondrial segregation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17975.17975.4 | 3.2053 | 0.1867 | 97.3% | 4114.0806 | 4111.226 | 38 | 4.326883 | 40.0% | 1 | K.AEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRR.L | 4 |
| U | Reverse_YLR068W | 1 | 1 | 13.2% | 151 | 18190 | 10.3 | FYV7 SGDID:S000004058, Chr XII from 271009-271464, Verified ORF, "Protein of unknown function, required for survival upon exposure to K1 killer toxin; involved in processing the 35S rRNA primary transcript to generate the 20S and 27SA2 pre-rRNA transcripts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.26840.26840.4 | 2.1155 | 0.169 | 91.3% | 2364.1978 | 2363.261 | 38 | 3.828479 | 34.7% | 1 | K.PEKEPVAYGEDKLAKLYEKR.L | 4 |
| U | Reverse_YJL122W | 1 | 1 | 12.6% | 175 | 19287 | 10.0 | YJL122W SGDID:S000003658, Chr X from 189636-190163, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7361.7361.2 | 2.2079 | 0.1249 | 94.4% | 2443.359 | 2442.263 | 6 | 3.8106146 | 40.0% | 1 | K.NQFYLDLAVSKIEGSKSNVSSR.A | 2 |
| U | YMR001C | 5 | 5 | 12.5% | 705 | 81031 | 9.0 | CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.6437.6437.2 | 2.3854 | 0.1664 | 98.9% | 1546.7745 | 1544.7749 | 7 | 4.438209 | 47.4% | 1 | K.LGNIFFDSNYNLK.I | 2 |
| * | Jamie_Mit_09102008.10207.10207.3 | 2.382 | 0.3448 | 100.0% | 4071.8674 | 4070.8713 | 1 | 5.6370306 | 30.5% | 1 | R.GTFPPSIPSTVMSEAPNFEDIPEEQSLVNFKDCMEK.S | 3 |
| * | Jamie_Mit_09102008.2771.2771.2 | 4.3797 | 0.4938 | 100.0% | 1606.8447 | 1606.8474 | 1 | 7.4650173 | 86.4% | 1 | K.SLLLESMSSDKIQR.Q | 2 |
| * | Jamie_Mit_09102008.4645.4645.2 | 1.9359 | 0.2286 | 98.8% | 1205.613 | 1204.6366 | 1 | 4.707545 | 73.3% | 1 | R.HLEVVDFFAK.Y | 2 |
| * | Jamie_Mit_09102008.2603.2603.2 | 2.4901 | 0.1396 | 96.4% | 1786.8478 | 1785.8447 | 1 | 4.161867 | 75.0% | 1 | K.YGEIPGYPESNFREK.L | 2 |
| U | Reverse_YDR273W | 1 | 1 | 12.3% | 365 | 40162 | 4.8 | DON1 SGDID:S000002681, Chr IV from 1010170-1011267, Verified ORF, "Meiosis-specific component of the spindle pole body, part of the leading edge protein (LEP) coat, forms a ring-like structure at the leading edge of the prospore membrane during meiosis II" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22351.22351.4 | 2.4859 | 0.1515 | 92.1% | 4746.2876 | 4743.2095 | 50 | 3.8311214 | 22.8% | 1 | K.ADAAFLGCSDTGFASKYGGDDKAPLRDASDRQAEPVETNGGQNKR.E | 4 |
| U | contaminant_NRL_1IKFH | 1 | 1 | 12.3% | 228 | 24756 | 8.3 | owl|| Immunoglobulin igg1-kappa antibody fragment fab complexed With... |
| U | contaminant_NRL_1INDH | 1 | 1 | 13.1% | 213 | 22638 | 8.5 | owl|| Cha255 immunoglobulin fab' fragment (igg1-lambda) complex With... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.7860.7860.2 | 3.7074 | 0.4774 | 100.0% | 2863.4417 | 2860.4587 | 4 | 7.8956175 | 44.8% | 1 | K.TTPPSVYPLAPGSAAQTNSMVTLGCLVK.G | 2 |
| U | YEL034W | 1 | 1 | 11.5% | 157 | 17114 | 5.0 | HYP2 SGDID:S000000760, Chr V from 85676-86149, Verified ORF, "Translation initiation factor eIF-5A, promotes formation of the first peptide bond; similar to and functionally redundant with Anb1p; undergoes an essential hypusination modification; expressed under aerobic conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.20646.20646.2 | 1.9336 | 0.1669 | 95.2% | 2054.2085 | 2051.0596 | 12 | 4.2044344 | 47.1% | 1 | K.LEDLSPSTHNMEVPVVKR.N | 2 |
| U | YMR055C | 2 | 2 | 11.4% | 306 | 35028 | 8.6 | BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4675.4675.3 | 2.4568 | 0.2437 | 97.9% | 2120.1296 | 2117.1243 | 1 | 5.100064 | 46.8% | 1 | R.YLILSEGLPISEDKQQQR.T | 3 |
| * | Jamie_Mit_09102008.5861.5861.2 | 3.5116 | 0.2667 | 100.0% | 1907.1056 | 1906.1053 | 3 | 5.259999 | 50.0% | 1 | R.YLALLKLGPPSTTIYQK.I | 2 |
| U | YBR047W | 1 | 1 | 11.4% | 175 | 20513 | 7.6 | YBR047W SGDID:S000000251, Chr II from 331831-332358, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13817.13817.2 | 1.7871 | 0.2322 | 97.8% | 2366.612 | 2366.3784 | 13 | 4.646139 | 50.0% | 1 | K.IRTVRHFSNIKPVLSKEVSR.R | 2 |
| U | Reverse_YLR218C | 1 | 1 | 11.3% | 150 | 17253 | 8.6 | YLR218C SGDID:S000004208, Chr XII from 573920-573468, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2721.2721.2 | 2.6243 | 0.1295 | 96.3% | 2062.826 | 2060.9412 | 4 | 3.8852632 | 43.5% | 1 | K.SIRTDWVDPDEDEQVEK.Y | 2 |
| U | YGL153W | 1 | 1 | 10.6% | 341 | 38420 | 4.9 | PEX14 SGDID:S000003121, Chr VII from 216278-217303, Verified ORF, "Peroxisomal membrane protein that is a central component of the peroxisomal protein import machinery, interacts with PTS1 (Pex5p) and PTS2 (Pex7p) peroxisomal matrix protein signal recognition factors and membrane receptor Pex13p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.26491.26491.3 | 2.3225 | 0.1777 | 93.4% | 4136.4546 | 4135.1367 | 7 | 3.5585613 | 24.7% | 1 | R.DWKDYFVMATATAGLLYGAYEVTRRYVIPNILPEAK.S | 3 |
| U | YNR054C | 1 | 1 | 9.5% | 316 | 36408 | 8.0 | ESF2 SGDID:S000005337, Chr XIV from 724307-723357, reverse complement, Verified ORF, "Essential nucleolar protein involved in pre-18S rRNA processing; component of the small subunit (SSU) processome; has sequence similarity to mABT1, a mouse transcription activator" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13238.13238.4 | 2.9064 | 0.3607 | 100.0% | 3307.6833 | 3304.7 | 51 | 5.8070846 | 27.9% | 1 | R.DAKLCAETLNGNIIGGKKGTFYHDDILNVK.Y | 4 |
| U | YJR053W | 4 | 4 | 9.2% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5017.5017.2 | 4.4636 | 0.4474 | 100.0% | 1786.8522 | 1785.8447 | 1 | 7.691275 | 76.2% | 1 | R.TGPFKNDIFAEEFDR.K | 2 |
| * | Jamie_Mit_09102008.4538.4538.2 | 1.9049 | 0.2802 | 98.8% | 1513.7238 | 1510.6814 | 9 | 4.990065 | 50.0% | 1 | R.DWNTQQELDSFK.E | 2 |
| * | Jamie_Mit_09102008.2473.2473.3 | 6.0832 | 0.618 | 100.0% | 2786.3308 | 2784.3188 | 1 | 10.332394 | 53.1% | 1 | R.SKSQVNTPFVSNDNDGVYQSTAAQAR.L | 3 |
| * | Jamie_Mit_09102008.2843.2843.2 | 4.1788 | 0.4606 | 100.0% | 2569.1885 | 2569.192 | 1 | 8.174934 | 65.5% | 1 | K.SQVNTPFVSNDNDGVYQSTAAQAR.L | 2 |
| U | Reverse_YKL052C | 1 | 1 | 9.2% | 292 | 32056 | 4.8 | ASK1 SGDID:S000001535, Chr XI from 340190-339312, reverse complement, Verified ORF, "Component of the DASH complex that binds to microtubules and kinetochores and is essential for chromosome segregation; phosphorylated during the cell cycle by cyclin-dependent kinases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18494.18494.2 | 1.6572 | 0.2543 | 98.4% | 2962.201 | 2959.29 | 13 | 4.628467 | 27.6% | 1 | R.SQRQITSEDQEDDAGGHGEGTLDTQER.S | 2 |
| U | YIL106W | 1 | 1 | 8.9% | 314 | 35882 | 6.6 | MOB1 SGDID:S000001368, Chr IX from 166412-166431,166517-167441, Verified ORF, "Component of the mitotic exit network; associates with and is required for the activation and Cdc15p-dependent phosphorylation of the Dbf2p kinase; required for cytokinesis and cell separation; component of the CCR4 transcriptional complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18361.18361.3 | 3.4432 | 0.2912 | 100.0% | 3392.73 | 3390.7383 | 16 | 4.592 | 32.7% | 1 | R.HFCLFAQEFELLRPADFGPLLELVMELR.D | 3 |
| U | Reverse_YPL096W | 1 | 1 | 8.8% | 363 | 42485 | 6.6 | PNG1 SGDID:S000006017, Chr XVI from 366924-368015, Verified ORF, "Conserved peptide N-glycanase required for deglycosylation of misfolded glycoproteins during proteasome-dependent degradation, localizes to the cytoplasm and nucleus, interacts with the DNA repair protein Rad23p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22933.22933.3 | 2.5732 | 0.16 | 93.3% | 3551.0645 | 3548.7903 | 32 | 3.3654013 | 26.9% | 1 | R.GRNSSKSAASVSESKTEQTKGRILEIQEQEDR.C | 3 |
| U | YIL145C | 1 | 1 | 8.7% | 309 | 35032 | 5.4 | PAN6 SGDID:S000001407, Chr IX from 77283-76354, reverse complement, Verified ORF, "Pantothenate synthase, also known as pantoate-beta-alanine ligase, required for pantothenic acid biosynthesis, deletion causes pantothenic acid auxotrophy, homologous to E. coli panC" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.14330.14330.3 | 2.4483 | 0.1882 | 95.6% | 3117.2258 | 3116.4854 | 50 | 4.000885 | 29.4% | 1 | K.ENTYTVVSIFVNPSQFAPTEDLDNYPR.T | 3 |
| U | Reverse_YBL068W | 1 | 1 | 8.6% | 327 | 35846 | 6.4 | PRS4 SGDID:S000000164, Chr II from 92412-93395, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, involved in nucleotide, histidine, and tryptophan biosynthesis; one of a five related enzymes, which are active as heteromultimeric complexes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15979.15979.2 | 1.6208 | 0.1715 | 91.2% | 2900.7322 | 2898.555 | 21 | 3.7704644 | 30.0% | 1 | K.DALAAVRKAGGADPSVLIANDFDTKRAR.I | 2 |
| U | contaminant_KERATIN13 | 4 | 4 | 8.2% | 643 | 65494 | 6.6 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5099.5099.4 | 2.4511 | 0.2212 | 96.7% | 2666.225 | 2665.4175 | 1 | 4.194756 | 53.7% | 1 | K.SREREQIKSLNNQFASFIDKVR.F | 4 |
| * | Jamie_Mit_09102008.5298.5298.4 | 4.0005 | 0.4347 | 100.0% | 2423.2905 | 2422.2842 | 1 | 6.551016 | 67.4% | 1 | R.EREQIKSLNNQFASFIDKVR.F | 4 |
| * | Jamie_Mit_09102008.5931.5931.2 | 3.0172 | 0.3155 | 100.0% | 1640.8617 | 1638.8604 | 2 | 6.556755 | 50.0% | 1 | K.SLNNQFASFIDKVR.F | 2 |
| * | Jamie_Mit_09102008.1606.1606.2 | 3.8341 | 0.2295 | 100.0% | 2384.9507 | 2383.9524 | 1 | 10.286309 | 35.9% | 1 | R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G | 2 |
| U | contaminant_INT-STD1 | 4 | 5 | 8.1% | 607 | 69271 | 6.1 | BSA |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2030.2030.2 | 3.7 | 0.286 | 100.0% | 1463.5791 | 1463.5895 | 1 | 5.6042833 | 76.2% | 2 | K.TCVADESHAGCEK.S | 2 |
| * | Jamie_Mit_09102008.3315.3315.3 | 5.7168 | 0.5736 | 100.0% | 2866.1343 | 2864.2654 | 1 | 8.839861 | 65.9% | 1 | K.TCVADESHAGCEKSLHTLFGDELCK.V | 3 |
| * | Jamie_Mit_09102008.423.423.2 | 3.516 | 0.4092 | 100.0% | 1443.6399 | 1443.6426 | 1 | 6.783226 | 85.0% | 1 | K.YICDNQDTISSK.L | 2 |
| * | Jamie_Mit_09102008.2435.2435.2 | 2.9735 | 0.3954 | 100.0% | 1440.809 | 1439.8123 | 1 | 7.769426 | 80.0% | 1 | R.RHPEYAVSVLLR.L | 2 |
| U | Reverse_YNL330C | 1 | 1 | 8.1% | 433 | 48904 | 5.5 | RPD3 SGDID:S000005274, Chr XIV from 19302-18001, reverse complement, Verified ORF, "Histone deacetylase; regulates transcription and silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9460.9460.4 | 2.779 | 0.2355 | 97.9% | 3801.3364 | 3798.695 | 49 | 4.3754663 | 35.4% | 1 | K.GRNLRAAGEMSGGGSISCYEYLGDFVPCDDGVNFK.V | 4 |
| U | YER116C | 1 | 1 | 8.0% | 274 | 30764 | 4.8 | SLX8 SGDID:S000000918, Chr V from 396168-395344, reverse complement, Verified ORF, "Protein containing a RING finger domain that forms a complex with Hex3p; mutant phenotypes and genetic interactions suggest a possible role in resolving recombination intermediates during DNA replication or repair" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5057.5057.2 | 1.6048 | 0.1624 | 90.6% | 2380.7322 | 2380.9626 | 13 | 4.121634 | 25.0% | 1 | R.ALEEDPGSDHNTSNNDSGNHDR.E | 2 |
| U | YMR242C | 2 | 2 | 7.9% | 178 | 21236 | 10.3 | RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein" |
| U | YOR312C | 2 | 2 | 8.0% | 174 | 20713 | 10.3 | RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.1098.1098.2 | 2.5106 | 0.0814 | 95.3% | 1252.6849 | 1252.6901 | 2 | 3.9896588 | 61.1% | 1 | R.RLPTESVPEPK.L | 2 | |
| Jamie_Mit_09102008.9715.9715.2 | 1.7655 | 0.1404 | 91.0% | 1515.956 | 1512.8425 | 12 | 4.1448646 | 45.0% | 1 | R.LPTESVPEPKLFR.M | 2 |
| U | Reverse_YOL041C | 1 | 1 | 7.8% | 459 | 51942 | 9.4 | NOP12 SGDID:S000005401, Chr XV from 252644-251265, reverse complement, Verified ORF, "Nucleolar protein, required for pre-25S rRNA processing; contains an RNA recognition motif (RRM) and has similarity to Nop13p, Nsr1p, and putative orthologs in Drosophila and S. pombe" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.25291.25291.4 | 2.7235 | 0.1632 | 94.8% | 4013.6165 | 4010.3328 | 5 | 4.686456 | 27.8% | 1 | K.EAQAKKFAISRKTVRGTASRQKKKKLHTSGEGKKAR.L | 4 |
| U | Reverse_YJR147W | 1 | 1 | 7.8% | 358 | 41192 | 9.0 | HMS2 SGDID:S000003908, Chr X from 704111-705187, Verified ORF, "Protein with similarity to heat shock transcription factors; overexpression suppresses the pseudohyphal filamentation defect of a diploid mep1 mep2 homozygous null mutant" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13631.13631.3 | 2.1518 | 0.1951 | 93.9% | 2924.7244 | 2921.4902 | 29 | 3.940625 | 44.7% | 1 | K.NMNNVAAVNPTAASQHAKVLSLSNINDK.Q | 3 |
| U | YLL027W | 1 | 1 | 7.6% | 250 | 27675 | 10.0 | ISA1 SGDID:S000003950, Chr XII from 87402-88154, Verified ORF, "Mitochondrial matrix protein involved in biogenesis of the iron-sulfur (Fe/S) cluster of Fe/S proteins, isa1 deletion causes loss of mitochondrial DNA and respiratory deficiency; depletion reduces growth on nonfermentable carbon sources" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7039.7039.2 | 1.7201 | 0.2377 | 97.8% | 2214.612 | 2211.4292 | 15 | 4.406915 | 35.7% | 1 | K.LRPRKALITLSPKAIKHLR.A | 2 |
| U | Reverse_YKL145W | 1 | 1 | 7.1% | 467 | 51983 | 5.5 | RPT1 SGDID:S000001628, Chr XI from 174218-175621, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and the E3 ubiquitin-protein ligase Ubr1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17137.17137.3 | 3.1222 | 0.2016 | 97.3% | 3863.9043 | 3863.9695 | 58 | 4.042953 | 21.0% | 1 | K.RRARIAFMGAETCVSRLEAGTSNPCLRSILEWR.I | 3 |
| U | Reverse_YHR064C | 1 | 1 | 6.7% | 538 | 58238 | 5.1 | SSZ1 SGDID:S000001106, Chr VIII from 227143-225527, reverse complement, Verified ORF, "Hsp70 protein that interacts with Zuo1p (a DnaJ homolog) to form a ribosome-associated complex that is bound to the ribosome via the Zuo1p subunit; also involved in pleiotropic drug resistance via sequential activation of PDR1 and PDR5" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22494.22494.3 | 2.6815 | 0.1562 | 94.2% | 3851.8384 | 3852.1064 | 71 | 3.731904 | 18.2% | 1 | K.EFPFQEAHALLAASPENIFQVIQLGIKAASAKLATK.Q | 3 |
| U | YNL207W | 1 | 1 | 6.6% | 425 | 49125 | 5.3 | RIO2 SGDID:S000005151, Chr XIV from 255354-256631, Verified ORF, "Essential serine kinase involved in the processing of the 20S pre-rRNA into mature 18S rRNA; has similarity to Rio1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2838.2838.2 | 2.1666 | 0.1194 | 93.2% | 3279.3123 | 3276.4834 | 15 | 3.6598206 | 33.3% | 1 | K.YEPKPDSSMLDTEGFGDGYKYAYPDFKR.D | 2 |
| U | YDR219C | 1 | 1 | 6.5% | 465 | 53168 | 8.7 | YDR219C SGDID:S000002627, Chr IV from 906846-905449, reverse complement, Uncharacterized ORF, "Mitochondria-associated F-box protein involved in maintenance of normal mitochondrial morphology" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15023.15023.4 | 2.3766 | 0.1613 | 92.4% | 3473.6565 | 3473.8828 | 43 | 4.1425815 | 30.4% | 1 | R.DSRPLKTKKKDNPRLKLSSSLSANDEDFRK.I | 4 |
| U | Reverse_YEL017W | 1 | 1 | 6.5% | 337 | 38235 | 5.0 | GTT3 SGDID:S000000743, Chr V from 123657-124670, Uncharacterized ORF, "Protein of unknown function with a possible role in glutathione metabolism, as suggested by computational analysis of large-scale protein-protein interaction data; GFP-fusion protein localizes to the nuclear periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22211.22211.3 | 2.0664 | 0.1934 | 93.0% | 2366.8743 | 2364.069 | 58 | 3.6688015 | 28.1% | 1 | R.SSLPKTASTEDGSQPKEDDDEK.I | 3 |
| U | Reverse_YHR081W | 1 | 1 | 6.5% | 184 | 21045 | 9.6 | LRP1 SGDID:S000001123, Chr VIII from 267540-268094, Verified ORF, "Substrate-specific nuclear cofactor for exosome activity in the processing of stable RNAs; homolog of mammalian nuclear matrix protein C1D, which is involved in regulation of DNA repair and recombination" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.142.142.2 | 2.4292 | 0.0632 | 90.9% | 1315.7722 | 1313.8381 | 25 | 3.5634573 | 55.6% | 1 | K.KGGKKKGVKDLR.K | 2 |
| U | Reverse_YKL028W | 1 | 1 | 6.4% | 482 | 54742 | 4.5 | TFA1 SGDID:S000001511, Chr XI from 385401-386849, Verified ORF, "TFIIE large subunit, involved in recruitment of RNA polymerase II to the promoter, activation of TFIIH, and promoter opening" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9663.9663.3 | 2.2874 | 0.1637 | 91.6% | 3774.7136 | 3771.8772 | 60 | 3.644785 | 27.1% | 1 | K.TLCIPCMYGNPESNKDLDDKLRQVVQHVKWK.I | 3 |
| U | Reverse_YGR280C | 1 | 1 | 6.3% | 271 | 31312 | 9.9 | PXR1 SGDID:S000003512, Chr VII from 1051731-1050916, reverse complement, Verified ORF, "Essential protein involved in rRNA and snoRNA maturation; competes with TLC1 RNA for binding to Est2p, suggesting a role in regulation of telomerase; human homolog inhibits telomerase; contains a G-patch RNA interacting domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2578.2578.3 | 2.1954 | 0.2655 | 98.3% | 2178.5708 | 2175.3564 | 29 | 4.766269 | 27.3% | 1 | K.KDKKDKKKDKKHKKHKK.H | 3 |
| U | YGL123W | 1 | 1 | 6.3% | 254 | 27450 | 10.4 | RPS2 SGDID:S000003091, Chr VII from 277623-278387, Verified ORF, "Protein component of the small (40S) subunit, essential for control of translational accuracy; has similarity to E. coli S5 and rat S2 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2609.2609.2 | 3.5445 | 0.3221 | 100.0% | 1729.8695 | 1729.8662 | 1 | 6.138856 | 56.5% | 1 | R.GYWGTNLGQPHSLATK.T | 2 |
| U | YDL169C | 1 | 1 | 6.3% | 223 | 25732 | 6.4 | UGX2 SGDID:S000002328, Chr IV from 158736-158065, reverse complement, Verified ORF, "Protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4250.4250.2 | 1.8921 | 0.183 | 95.5% | 1680.1721 | 1676.9957 | 23 | 4.898875 | 35.3% | 1 | K.MKSKTKLTRTAKQR.R | 2 |
| U | YPL212C | 1 | 1 | 6.1% | 544 | 62143 | 8.1 | PUS1 SGDID:S000006133, Chr XVI from 153148-151514, reverse complement, Verified ORF, "tRNA:pseudouridine synthase, introduces pseudouridines at positions 26-28, 34-36, 65, and 67 of tRNA; nuclear protein that appears to be involved in tRNA export; also acts on U2 snRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.25654.25654.3 | 2.9363 | 0.1527 | 95.1% | 3927.0244 | 3926.871 | 7 | 3.6384368 | 27.8% | 1 | R.DIEESKTELPGVLDEDLESKEFWEEFKKDANEK.F | 3 |
| U | YNL167C | 1 | 1 | 6.0% | 647 | 70192 | 9.3 | SKO1 SGDID:S000005111, Chr XIV from 321361-319418, reverse complement, Verified ORF, "Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family that forms a complex with Tup1p and Ssn6p to both activate and repress transcription; cytosolic and nuclear protein involved in the osmotic and oxidative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.23442.23442.4 | 2.6119 | 0.1842 | 95.9% | 4194.591 | 4192.9443 | 36 | 4.684984 | 22.5% | 1 | K.SNTTTNNVGNSAQNIINSCYSVTNPLVINANSDTHDTNK.H | 4 |
| U | YOL095C | 1 | 1 | 5.9% | 706 | 80576 | 8.6 | HMI1 SGDID:S000005455, Chr XV from 141346-139226, reverse complement, Verified ORF, "Mitochondrial inner membrane localized ATP-dependent DNA helicase, required for the maintenance of the mitochondrial genome; not required for mitochondrial transcription" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22872.22872.3 | 2.1489 | 0.2002 | 94.8% | 5113.6543 | 5111.6675 | 59 | 4.0449586 | 16.4% | 1 | K.RTPHHFRSYKELEKVVKDYKLNNAKNNNPVIEKLVELMDNCK.V | 3 |
| U | YDR481C | 1 | 1 | 5.8% | 566 | 63004 | 5.6 | PHO8 SGDID:S000002889, Chr IV from 1420240-1418540, reverse complement, Verified ORF, "Repressible alkaline phosphatase, a glycoprotein localized to the vacuole; regulated by levels of inorganic phosphate and by a system consisting of Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22582.22582.3 | 2.5615 | 0.1884 | 95.9% | 3579.9172 | 3579.778 | 64 | 3.836207 | 22.0% | 1 | R.VVDLLMGGGRSHFYPQGEKASPYGHHGARKDGR.D | 3 |
| U | YER014W | 1 | 1 | 5.6% | 539 | 59703 | 9.3 | HEM14 SGDID:S000000816, Chr V from 182599-184218, Verified ORF, "Protoporphyrinogen oxidase, a mitochondrial enzyme that catalyzes the seventh step in the heme biosynthetic pathway, converting protoporphyrinogen IX to protoporphyrin IX" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.10309.10309.3 | 2.2419 | 0.2016 | 95.3% | 3301.9792 | 3301.7002 | 46 | 3.9799826 | 25.8% | 1 | R.RFGNNYISNNMISALLRGIYGDDVSLLSAK.R | 3 |
| U | YDR475C | 1 | 1 | 5.5% | 876 | 98691 | 9.6 | YDR475C SGDID:S000002883, Chr IV from 1410084-1407454, reverse complement, Uncharacterized ORF, "Protein of unknown function; previously annotated as two separate ORFs, YDR474C and YDR475C, which were merged as a result of corrections to the systematic reference sequence" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9748.9748.6 | 3.5109 | 0.2798 | 100.0% | 5233.761 | 5233.671 | 51 | 4.633879 | 25.4% | 1 | R.AHSMESGFEELKRVITGGAPPRHVATPQRSMLDVLDNPSSSRSKSKSR.S | 6 |
| U | Reverse_YML027W | 1 | 1 | 5.5% | 385 | 42739 | 10.3 | YOX1 SGDID:S000004489, Chr XIII from 221406-222563, Verified ORF, "Homeodomain-containing transcriptional repressor, binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13271.13271.2 | 2.0745 | 0.1794 | 95.9% | 2169.172 | 2167.2703 | 29 | 4.1388354 | 30.8% | 1 | K.SASPIIISKAASLPTLIDNKK.S | 2 |
| U | YKR023W | 1 | 1 | 5.3% | 530 | 60799 | 6.9 | YKR023W SGDID:S000001731, Chr XI from 483062-484654, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and mitochondrion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.6764.6764.3 | 2.7568 | 0.202 | 96.7% | 3497.937 | 3494.782 | 37 | 4.4856443 | 30.8% | 1 | K.SLENLHLQSKAWDYERDKKQFDRPTYVK.K | 3 |
| U | YDL229W | 3 | 3 | 5.2% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| U | YNL209W | 3 | 3 | 5.2% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.2591.2591.3 | 3.1724 | 0.184 | 97.6% | 1614.9014 | 1613.8975 | 1 | 4.3994694 | 65.1% | 1 | R.QATKDAGAISGLNVLR.I | 3 | |
| Jamie_Mit_09102008.57.57.2 | 4.0738 | 0.4953 | 100.0% | 1591.8354 | 1591.8403 | 1 | 8.24374 | 73.1% | 1 | K.STGKSSNITISNAVGR.L | 2 | |
| Jamie_Mit_09102008.47.47.3 | 3.4425 | 0.3762 | 100.0% | 1593.8384 | 1591.8403 | 2 | 5.8266325 | 59.5% | 1 | K.STGKSSNITISNAVGR.L | 3 |
| U | YKL017C | 1 | 1 | 5.1% | 683 | 78273 | 7.6 | HCS1 SGDID:S000001500, Chr XI from 406884-404833, reverse complement, Verified ORF, "Hexameric DNA polymerase alpha-associated DNA helicase A involved in lagging strand DNA synthesis; contains single-stranded DNA stimulated ATPase and dATPase activities; replication protein A stimulates helicase and ATPase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.22043.22043.4 | 2.8497 | 0.1452 | 93.9% | 4078.213 | 4076.2717 | 62 | 3.9601784 | 23.0% | 1 | R.LLDSNKRHSLDILSKKNTIVKDISQEIDKLIQENK.K | 4 |
| U | contaminant_KERATIN02 | 3 | 3 | 5.1% | 622 | 61987 | 5.2 | no description |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5307.5307.2 | 3.7167 | 0.1941 | 100.0% | 1853.9344 | 1851.9275 | 1 | 4.693866 | 86.4% | 1 | K.TLNDMRQEYEQLIAK.N | 2 |
| * | Jamie_Mit_09102008.5774.5774.2 | 5.5078 | 0.5603 | 100.0% | 1838.9733 | 1837.966 | 1 | 9.765614 | 81.0% | 1 | R.HGVQELEIELQSQLSK.K | 2 |
| * | Jamie_Mit_09102008.4953.4953.3 | 2.8979 | 0.3164 | 100.0% | 1967.9454 | 1966.0609 | 1 | 5.1922684 | 52.4% | 1 | R.HGVQELEIELQSQLSKK.A | 3 |
| U | YOR338W | 1 | 1 | 5.0% | 363 | 42109 | 9.8 | YOR338W SGDID:S000005865, Chr XV from 956893-957984, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.24904.24904.2 | 1.8416 | 0.3047 | 98.7% | 2054.4773 | 2051.2817 | 14 | 4.9041166 | 26.9% | 1 | R.KLKVVKSVVNSEALPKRR.R | 2 |
| U | YLR457C | 1 | 1 | 5.0% | 319 | 37354 | 10.2 | NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3388.3388.2 | 4.236 | 0.2615 | 100.0% | 1957.1522 | 1955.9827 | 10 | 5.491519 | 37.5% | 1 | K.LQSLQEALNYSNEKYR.I | 2 |
| U | Reverse_YPR190C | 1 | 1 | 4.9% | 654 | 74017 | 6.7 | RPC82 SGDID:S000006394, Chr XVI from 919037-917073, reverse complement, Verified ORF, "RNA polymerase III subunit C82" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15075.15075.3 | 3.1943 | 0.1642 | 96.1% | 3636.0083 | 3632.936 | 10 | 3.8250601 | 37.3% | 1 | R.SASRDATRPVEQIEVSNYRILSALTSRIDKEK.M | 3 |
| U | YNL061W | 1 | 1 | 4.9% | 618 | 69812 | 5.0 | NOP2 SGDID:S000005005, Chr XIV from 510541-512397, Verified ORF, "Probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; localized to the nucleolus; constituent of 66S pre-ribosomal particles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.25951.25951.3 | 2.7466 | 0.1877 | 95.8% | 3346.1042 | 3345.891 | 19 | 3.979739 | 24.7% | 1 | K.LVDTGLAIGKEAFTSYRGKKFHPSVKLARR.Y | 3 |
| U | Reverse_YLR330W | 1 | 1 | 4.8% | 671 | 73639 | 4.6 | CHS5 SGDID:S000004322, Chr XII from 787664-789679, Verified ORF, "Protein of unknown function, involved in chitin biosynthesis by regulating Chs3p localization, also involved in cell fusion during mating" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.27089.27089.4 | 1.8674 | 0.2786 | 97.0% | 3373.3774 | 3371.535 | 43 | 4.174616 | 14.5% | 1 | K.TSLVDDTNVEAETTEQEETVASSELSASAETK.Q | 4 |
| U | YPL256C | 1 | 1 | 4.8% | 545 | 61697 | 5.8 | CLN2 SGDID:S000006177, Chr XVI from 66614-64977, reverse complement, Verified ORF, "G1 cyclin involved in regulation of the cell cycle; activates Cdc28p kinase to promote the G1 to S phase transition; late G1 specific expression depends on transcription factor complexes, MBF (Swi6p-Mbp1p) and SBF (Swi6p-Swi4p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.6160.6160.3 | 2.7116 | 0.2165 | 97.3% | 2898.737 | 2896.4429 | 34 | 4.866957 | 37.2% | 1 | K.TWGGCNHIINNVVIPTGGRFYGPNPR.A | 3 |
| U | YAL012W | 1 | 1 | 4.8% | 394 | 42542 | 6.5 | CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2058.2058.4 | 2.396 | 0.2377 | 97.3% | 2198.0315 | 2196.228 | 11 | 4.63184 | 45.0% | 1 | K.LVWIETPTNPTLKVTDIQK.V | 4 |
| U | Reverse_YLR003C | 1 | 1 | 4.8% | 291 | 33394 | 8.2 | YLR003C SGDID:S000003993, Chr XII from 157729-156854, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21704.21704.2 | 1.3708 | 0.2133 | 92.0% | 1756.2722 | 1755.1332 | 15 | 4.7883987 | 23.8% | 1 | K.KEILKSKKQLKKQR.K | 2 |
| U | Reverse_YHR103W | 1 | 1 | 4.7% | 852 | 96398 | 8.0 | SBE22 SGDID:S000001145, Chr VIII from 320417-322975, Verified ORF, "Protein involved in the transport of cell wall components from the Golgi to the cell surface; similar in structure and functionally redundant with Sbe2p; involved in bud growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4269.4269.3 | 2.0381 | 0.1709 | 90.3% | 4140.744 | 4140.009 | 15 | 3.8185472 | 22.0% | 1 | K.SGDTTAEVITNNSASRMGNGDAGRGQTAKEMLISPFTNIK.S | 3 |
| U | YNL308C | 1 | 1 | 4.7% | 591 | 68654 | 5.1 | KRI1 SGDID:S000005252, Chr XIV from 55896-54121, reverse complement, Verified ORF, "Essential nucleolar protein required for 40S ribosome biogenesis; physically and functionally interacts with Krr1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18504.18504.3 | 2.3057 | 0.1525 | 90.8% | 3322.106 | 3321.8745 | 43 | 3.838787 | 35.7% | 1 | K.KKEKRKVNELVENALEQNKLALIEEVEK.E | 3 |
| U | Reverse_YNL119W | 1 | 1 | 4.7% | 493 | 56473 | 6.4 | NCS2 SGDID:S000005063, Chr XIV from 401042-402523, Uncharacterized ORF, "Protein with a role in urmylation and in invasive and pseudohyphal growth; inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3255.3255.4 | 2.1647 | 0.2084 | 95.6% | 2615.7092 | 2612.4558 | 39 | 3.9491937 | 35.6% | 1 | K.NTIENITMNKVLKQQGLSPLSKR.A | 4 |
| U | YPR068C | 1 | 1 | 4.7% | 470 | 54764 | 5.3 | HOS1 SGDID:S000006272, Chr XVI from 684350-682938, reverse complement, Verified ORF, "Putative class I histone deacetylase (HDAC) with sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p; deletion results in increased histone acetylation at rDNA repeats; interacts with the Tup1p-Ssn6p corepressor complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17937.17937.2 | 2.0258 | 0.1547 | 95.2% | 2571.172 | 2569.3083 | 22 | 3.887663 | 32.1% | 1 | K.HGCDDNYLELIASKIVNPLIER.H | 2 |
| U | YAL005C | 3 | 3 | 4.5% | 642 | 69768 | 5.1 | SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" |
| U | YLL024C | 3 | 3 | 4.5% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| U | YER103W | 3 | 3 | 4.5% | 642 | 69651 | 5.1 | SSA4 SGDID:S000000905, Chr V from 364585-366513, Verified ORF, "Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation" |
| U | YBL075C | 3 | 3 | 4.5% | 649 | 70547 | 5.2 | SSA3 SGDID:S000000171, Chr II from 86446-84497, reverse complement, Verified ORF, "ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.3826.3826.2 | 3.7179 | 0.3618 | 100.0% | 1787.9884 | 1787.9907 | 1 | 6.4394426 | 70.8% | 1 | R.IINEPTAAAIAYGLDKK.G | 2 | |
| Jamie_Mit_09102008.3803.3803.3 | 2.6984 | 0.1913 | 96.7% | 1788.9902 | 1787.9907 | 54 | 4.734038 | 34.7% | 1 | R.IINEPTAAAIAYGLDKK.G | 3 | |
| Jamie_Mit_09102008.5317.5317.2 | 3.1199 | 0.4018 | 100.0% | 1527.7543 | 1526.7426 | 1 | 6.4483566 | 88.2% | 1 | R.ARFEELCADLFR.S | 2 |
| U | Reverse_YNL039W | 1 | 1 | 4.5% | 594 | 67688 | 6.9 | BDP1 SGDID:S000004984, Chr XIV from 555049-556833, Verified ORF, "Essential subunit of RNA polymerase III transcription factor (TFIIIB), which is involved in transcription of genes encoding tRNAs, 5S rRNA, U6 snRNA, and other small RNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18565.18565.4 | 2.3705 | 0.1446 | 90.6% | 3239.0906 | 3236.9434 | 57 | 4.007584 | 24.1% | 1 | K.SRLALEILIPRKKEENVFKAKVQKRSR.Y | 4 |
| U | YGR192C | 1 | 1 | 4.5% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YJR009C | 1 | 1 | 4.5% | 332 | 35847 | 7.0 | TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YJL052W | 1 | 1 | 4.5% | 332 | 35750 | 8.3 | TDH1 SGDID:S000003588, Chr X from 338187-339185, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 1, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.1213.1213.2 | 2.5124 | 0.1885 | 98.9% | 1376.7322 | 1374.7229 | 5 | 4.6793485 | 45.8% | 1 | R.TASGNIIPSSTGAAK.A | 2 |
| U | YBR021W | 1 | 1 | 4.4% | 633 | 71736 | 7.9 | FUR4 SGDID:S000000225, Chr II from 281443-283344, Verified ORF, "Uracil permease, localized to the plasma membrane; expression is tightly regulated by uracil levels and environmental cues" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21365.21365.3 | 2.2202 | 0.1764 | 92.3% | 3210.015 | 3209.837 | 25 | 4.042164 | 30.8% | 1 | R.HLFTVKAVLVPFASFGFLIWAIRRAHGR.I | 3 |
| U | YLR134W | 1 | 1 | 4.4% | 563 | 61912 | 6.4 | PDC5 SGDID:S000004124, Chr XII from 410724-412415, Verified ORF, "Minor isoform of pyruvate decarboxylase, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde, regulation is glucose- and ethanol-dependent, repressed by thiamine, involved in amino acid catabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7626.7626.3 | 2.9668 | 0.2188 | 97.6% | 2747.7244 | 2744.4988 | 3 | 4.091668 | 36.1% | 1 | R.TTYTTQRPVYLGLPANLVDLNVPAK.L | 3 |
| U | Reverse_contaminant_SPA1_STAAU | 1 | 1 | 4.4% | 524 | 57320 | 5.7 | owl|P02976| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| U | Reverse_contaminant_SPA2_STAAU | 1 | 1 | 4.5% | 508 | 55439 | 5.7 | owl|P38507| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.19006.19006.3 | 2.9664 | 0.2494 | 99.1% | 2849.4243 | 2846.4114 | 23 | 4.5251784 | 40.0% | 1 | R.QEENLNPLHLIEYFANQQEKNFK.N | 3 |
| U | Reverse_YDR338C | 1 | 1 | 4.3% | 695 | 77846 | 5.3 | YDR338C SGDID:S000002746, Chr IV from 1149458-1147371, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17788.17788.3 | 2.4001 | 0.2123 | 95.8% | 3417.1057 | 3415.8057 | 41 | 3.7943976 | 24.6% | 1 | K.DWDPFLVYYAEVLGILLMASGIGIWLGYLK.M | 3 |
| U | YFL039C | 1 | 1 | 4.3% | 375 | 41690 | 5.7 | ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5494.5494.2 | 2.7933 | 0.3971 | 100.0% | 1791.8983 | 1790.8925 | 2 | 6.0457945 | 66.7% | 1 | K.SYELPDGQVITIGNER.F | 2 |
| U | YGL138C | 1 | 1 | 4.3% | 345 | 40846 | 9.3 | YGL138C SGDID:S000003106, Chr VII from 249536-248499, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2757.2757.2 | 1.6591 | 0.2351 | 96.8% | 1963.417 | 1962.2274 | 3 | 4.5136895 | 38.9% | 1 | R.RKYLRRKISKMLKNK.I | 2 |
| U | Reverse_YFL025C | 1 | 1 | 4.2% | 1029 | 117755 | 6.7 | BST1 SGDID:S000001869, Chr VI from 87232-84143, reverse complement, Verified ORF, "GPI inositol deacylase of the ER that negatively regulates COPII vesicle formation, prevents production of vesicles with defective subunits, required for proper discrimination between resident ER proteins and Golgi-bound cargo molecules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.20394.20394.3 | 2.4397 | 0.1616 | 92.5% | 4990.0986 | 4987.585 | 1 | 4.047312 | 29.5% | 1 | R.YTYPKKAIKDNNMYKPSAKDQDERTALVRSYQGSSNVKNIIPR.T | 3 |
| U | YKL054C | 1 | 1 | 4.2% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2281.2281.3 | 5.5931 | 0.5583 | 100.0% | 3614.5308 | 3612.5613 | 1 | 8.870856 | 38.9% | 1 | K.NNYNYYQTQNGQEQQSPNQGVAQHSEDSQQK.Q | 3 |
| U | Reverse_Q0055 | 1 | 1 | 4.0% | 854 | 98008 | 9.6 | AI2 SGDID:S000007262, Chr Mito from 13818-13986,16435-18830, Verified ORF, "Reverse transcriptase required for splicing of the COX1 pre-mRNA, encoded by a mobile group II intron within the mitochondrial COX1 gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5818.5818.4 | 2.1874 | 0.1665 | 91.0% | 3969.1765 | 3966.0977 | 20 | 3.4389753 | 39.5% | 1 | K.NLESFDTTNIKTLYALSDEKRANLKSLTSFYRVK.N | 4 |
| U | YOR080W | 1 | 1 | 4.0% | 746 | 86801 | 9.1 | DIA2 SGDID:S000005606, Chr XV from 474553-476793, Verified ORF, "Protein of unknown function, involved in invasive and pseudohyphal growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4754.4754.4 | 2.3047 | 0.2145 | 95.8% | 3136.4822 | 3134.6519 | 36 | 3.9806406 | 29.0% | 1 | K.NKKYTPMSSPGNSGVAIDSTVLKAIELGTR.L | 4 |
| U | Reverse_YDL156W | 1 | 1 | 4.0% | 522 | 59156 | 7.3 | YDL156W SGDID:S000002315, Chr IV from 174919-176487, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7564.7564.2 | 2.6028 | 0.0832 | 93.2% | 2241.309 | 2240.0981 | 26 | 3.4390728 | 32.0% | 1 | K.DQGDPSGMKLLQNDNVNPIGK.V | 2 |
| U | YAL038W | 1 | 1 | 4.0% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4145.4145.3 | 3.9097 | 0.4769 | 100.0% | 2186.1814 | 2185.1829 | 3 | 6.8438168 | 34.5% | 1 | R.TANDVLTIREVLGEQGKDVK.I | 3 |
| U | Reverse_YBR055C | 1 | 1 | 3.9% | 899 | 104229 | 8.0 | PRP6 SGDID:S000000259, Chr II from 347299-344600, reverse complement, Verified ORF, "Splicing factor, component of the U4/U6-U5 snRNP complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4593.4593.4 | 2.19 | 0.1578 | 90.0% | 3896.4966 | 3895.1697 | 21 | 4.544308 | 50.0% | 1 | K.LWASLTAKYGNKSLELLGEKLLSVLKDVPIDPNNR.E | 4 |
| U | Reverse_YOR011W | 2 | 2 | 3.8% | 1394 | 157750 | 7.2 | AUS1 SGDID:S000005537, Chr XV from 349678-353862, Verified ORF, "Transporter of the ATP-binding cassette family, involved in uptake of sterols and anaerobic growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.12775.12775.4 | 2.2217 | 0.1778 | 92.2% | 3753.7346 | 3753.851 | 26 | 3.8098724 | 46.9% | 1 | K.PWIRAVYTLYYGAFMAFFNFGVFAWEIGFNR.W | 4 |
| Jamie_Mit_09102008.4216.4216.2 | 2.0897 | 0.107 | 90.6% | 2527.131 | 2527.3196 | 25 | 4.1769786 | 29.6% | 1 | K.TSNDWLYVSGNAIFTEIISIRK.R | 2 |
| U | Reverse_YJL110C | 1 | 1 | 3.8% | 551 | 60520 | 9.2 | GZF3 SGDID:S000003646, Chr X from 211494-209839, reverse complement, Verified ORF, "GATA zinc finger protein and Dal80p homolog that negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.19633.19633.2 | 1.7723 | 0.1766 | 94.8% | 2444.6877 | 2443.4736 | 16 | 4.015894 | 26.1% | 1 | K.RNRSKIVDTKLSIPRPKGHLK.L | 2 |
| U | contaminant_SPA1_STAAU | 1 | 1 | 3.8% | 524 | 57320 | 5.7 | owl|P02976| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| U | contaminant_SPA2_STAAU | 1 | 1 | 3.9% | 508 | 55439 | 5.7 | owl|P38507| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.8600.8600.3 | 2.8045 | 0.3338 | 100.0% | 2487.2178 | 2485.2112 | 1 | 5.0915036 | 47.5% | 1 | K.EQQNAFYEILHLPNLNEEQR.N | 3 |
| U | YCR073W-A | 1 | 1 | 3.8% | 315 | 34501 | 6.8 | SOL2 SGDID:S000000718, Chr III from 246959-247906, Verified ORF, "Protein with a possible role in tRNA export; shows similarity to 6-phosphogluconolactonase non-catalytic domains but does not exhibit this enzymatic activity; homologous to Sol1p, Sol3p, and Sol4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.1624.1624.2 | 1.7775 | 0.1432 | 92.1% | 987.5062 | 984.4234 | 2 | 3.6262515 | 68.4% | 1 | K.SGSSGSGSGSSK.P | 2 |
| U | YOR087W | 1 | 1 | 3.6% | 675 | 77953 | 5.4 | YVC1 SGDID:S000005613, Chr XV from 487708-489735, Verified ORF, "Vacuolar cation channel, mediates release of Ca(2+) from the vacuole in response to hyperosmotic shock" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13221.13221.4 | 2.009 | 0.1902 | 92.4% | 2788.7366 | 2788.521 | 17 | 3.4817736 | 31.5% | 1 | K.DLSYTVMTIVYSPFLLLISVKETR.E | 4 |
| U | YDL024C | 1 | 1 | 3.6% | 468 | 53076 | 5.5 | DIA3 SGDID:S000002182, Chr IV from 409854-408448, reverse complement, Verified ORF, "Protein of unknown function, involved in invasive and pseudohyphal growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2485.2485.3 | 2.1616 | 0.195 | 95.4% | 1944.8944 | 1941.9532 | 57 | 3.9316187 | 39.5% | 1 | R.KDAAALFSWCAFELNAK.G | 3 |
| U | Reverse_YKL085W | 1 | 1 | 3.6% | 334 | 35650 | 8.5 | MDH1 SGDID:S000001568, Chr XI from 278767-279771, Verified ORF, "Mitochondrial malate dehydrogenase, catalyzes interconversion of malate and oxaloacetate; involved in the tricarboxylic acid (TCA) cycle" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4587.4587.2 | 1.9668 | 0.0951 | 90.4% | 1341.7031 | 1340.6963 | 5 | 3.7240314 | 50.0% | 1 | K.YPNAVTSSFARK.A | 2 |
| U | YKR024C | 1 | 1 | 3.5% | 742 | 83308 | 9.3 | DBP7 SGDID:S000001732, Chr XI from 487015-484787, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box family involved in ribosomal biogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.14780.14780.2 | 1.9316 | 0.1646 | 95.3% | 2909.7722 | 2908.6096 | 17 | 3.9292948 | 32.1% | 1 | K.FLHLGHLAKSFGLRERPKAMGLQSSK.D | 2 |
| U | Reverse_YDR508C | 1 | 1 | 3.5% | 663 | 73598 | 7.7 | GNP1 SGDID:S000002916, Chr IV from 1468434-1466443, reverse complement, Verified ORF, "High-affinity glutamine permease, also transports Leu, Ser, Thr, Cys, Met and Asn; expression is fully dependent on Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.11125.11125.3 | 2.6309 | 0.2053 | 96.3% | 2682.2043 | 2682.3496 | 27 | 3.889131 | 40.0% | 1 | R.GERDIYDFCKPANGQKALSMLIR.S | 3 |
| U | Reverse_YPL195W | 1 | 1 | 3.4% | 932 | 106924 | 5.1 | APL5 SGDID:S000006116, Chr XVI from 176222-179020, Verified ORF, "Delta adaptin-like subunit of the clathrin associated protein complex (AP-3); functions in transport of alkaline phosphatase to the vacuole via the alternate pathway, suppressor of loss of casein kinase 1 function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18777.18777.4 | 3.1017 | 0.275 | 99.5% | 3642.9253 | 3643.0618 | 30 | 4.910948 | 30.9% | 1 | K.KGKKKKRSIETTSLSLSNLSNDTRNLRITEPK.K | 4 |
| U | YDL040C | 1 | 1 | 3.4% | 854 | 98905 | 8.8 | NAT1 SGDID:S000002198, Chr IV from 381435-378871, reverse complement, Verified ORF, "Subunit of the N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.13988.13988.3 | 2.2599 | 0.1652 | 91.6% | 3330.1013 | 3326.9097 | 45 | 3.796448 | 37.8% | 1 | -.MSRKRSTKPKPAAKIALKKENDQFLEALK.L | 3 |
| U | YPL242C | 1 | 1 | 3.3% | 1495 | 172830 | 8.9 | IQG1 SGDID:S000006163, Chr XVI from 95109-90622, reverse complement, Verified ORF, "Essential protein required for determination of budding pattern, promotes localization of axial markers Bud4p and Cdc12p and functionally interacts with Sec3p, localizes to the contractile ring during anaphase, member of the IQGAP family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15705.15705.4 | 2.7061 | 0.1299 | 91.3% | 5496.606 | 5494.989 | 19 | 3.3942192 | 23.5% | 1 | K.TIRGEKLAELTVKVFGSSGPKFPDIIFKISTSDGSRFGIQMIDKRKGPDK.R | 4 |
| U | YNL188W | 1 | 1 | 3.2% | 433 | 50653 | 9.3 | KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.1988.1988.4 | 2.2254 | 0.1491 | 91.8% | 1749.9535 | 1748.9546 | 41 | 4.0503573 | 44.1% | 1 | R.KEEVFTDEVLQKKR.E | 4 |
| U | YIL173W | 1 | 1 | 3.1% | 1549 | 174427 | 5.3 | VTH1 SGDID:S000001435, Chr IX from 11492-16141, Verified ORF, "Putative membrane glycoprotein with strong similarity to Vth2p and Pep1p/Vps10p, may be involved in vacuolar protein sorting" |
| U | YJL222W | 1 | 1 | 3.1% | 1549 | 174401 | 5.3 | VTH2 SGDID:S000003758, Chr X from 11475-16124, Verified ORF, "Putative membrane glycoprotein with strong similarity to Vth1p and Pep1p/Vps10p, may be involved in vacuolar protein sorting" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.19047.19047.4 | 2.7361 | 0.2307 | 97.6% | 5290.9766 | 5290.466 | 48 | 4.027238 | 21.3% | 1 | K.DIRDTYSSGSALGMMFGVGNVGDRLLPYEECSTFLTTDGGETWTEVKK.G | 4 |
| U | Reverse_YOR256C | 1 | 1 | 3.1% | 809 | 91995 | 5.5 | YOR256C SGDID:S000005782, Chr XV from 810681-808252, reverse complement, Uncharacterized ORF, "Protein of unknown function with similarity to TRE1/YPL176C; required for cell viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2241.2241.3 | 3.1055 | 0.1867 | 96.6% | 2603.422 | 2603.2266 | 34 | 3.6901217 | 29.7% | 1 | K.EEVPSGDWNLGSADGTSYQPLGVPK.S | 23 |
| U | YER091C | 1 | 1 | 3.1% | 767 | 85860 | 6.5 | MET6 SGDID:S000000893, Chr V from 342163-339860, reverse complement, Verified ORF, "Cobalamin-independent methionine synthase, involved in amino acid biosynthesis; requires a minimum of two glutamates on the methyltetrahydrofolate substrate, similar to bacterial metE homologs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21141.21141.2 | 2.8102 | 0.109 | 95.4% | 2744.3523 | 2742.5068 | 4 | 3.5498364 | 46.2% | 1 | K.DSLDLEPLSLLEQLLPLYTEILSK.L | 2 |
| U | YBL091C | 1 | 1 | 3.1% | 421 | 47502 | 6.3 | MAP2 SGDID:S000000187, Chr II from 48625-47360, reverse complement, Verified ORF, "Methionine aminopeptidase, catalyzes the cotranslational removal of N-terminal methionine from nascent polypeptides; function is partially redundant with that of Map1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7394.7394.2 | 1.474 | 0.3234 | 98.8% | 1588.2122 | 1586.0593 | 12 | 5.335872 | 22.2% | 1 | K.NKKKKKKKSNVKK.I | 2 |
| U | YDR395W | 1 | 1 | 3.0% | 944 | 108405 | 4.7 | SXM1 SGDID:S000002803, Chr IV from 1263314-1266148, Verified ORF, "Nuclear transport factor (karyopherin) involved in protein transport between the cytoplasm and nucleoplasm; similar to Nmd5p, Cse1p, Lph2p, and the human cellular apoptosis susceptibility protein, CAS1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21660.21660.2 | 3.2943 | 0.3489 | 100.0% | 3146.2922 | 3143.5425 | 1 | 5.9012237 | 50.0% | 1 | R.DYIDSVIEELFPIVEGIASNIGSQTDYR.S | 2 |
| U | Reverse_YFL013C | 1 | 1 | 3.0% | 692 | 78753 | 5.2 | IES1 SGDID:S000001881, Chr VI from 109924-107846, reverse complement, Verified ORF, "Subunit of the INO80 chromatin remodeling complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.8968.8968.2 | 2.2099 | 0.2739 | 99.3% | 2399.2922 | 2398.1978 | 18 | 4.646186 | 42.1% | 1 | R.ETCRLIFKGAPAGDELGNFFR.V | 2 |
| U | YJL083W | 1 | 1 | 3.0% | 604 | 68768 | 9.6 | TAX4 SGDID:S000003619, Chr X from 278757-280571, Verified ORF, "Protein involved in regulation of phosphatidylinositol 4,5-bisphosphate concentrations; Irs4p and Tax4p bind and activate the phosphatase Inp51p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4575.4575.2 | 2.2668 | 0.2147 | 98.8% | 1975.9412 | 1973.1184 | 16 | 4.1603026 | 44.4% | 1 | R.HLKVESAPVVKSEPSLPR.M | 2 |
| U | Reverse_YBR286W | 1 | 1 | 3.0% | 537 | 60137 | 5.3 | APE3 SGDID:S000000490, Chr II from 774696-776309, Verified ORF, "Vacuolar aminopeptidase Y, processed to mature form by Prb1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.7885.7885.2 | 1.821 | 0.1649 | 94.1% | 1815.0231 | 1814.9329 | 14 | 3.5391457 | 57.1% | 1 | K.SKPENDYIVVATFGFK.G | 2 |
| U | YJL080C | 1 | 1 | 2.9% | 1222 | 134809 | 5.8 | SCP160 SGDID:S000003616, Chr X from 289142-285474, reverse complement, Verified ORF, "Essential RNA-binding G protein effector of mating response pathway, predominantly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.6815.6815.3 | 2.6435 | 0.2066 | 96.4% | 3964.7944 | 3962.1643 | 80 | 3.9704497 | 21.0% | 1 | K.DKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITK.E | 3 |
| U | Reverse_YDR359C | 1 | 1 | 2.9% | 982 | 112502 | 9.0 | VID21 SGDID:S000002767, Chr IV from 1194875-1191927, reverse complement, Verified ORF, "Component of the NuA4 histone acetyltransferase complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.25872.25872.3 | 2.4204 | 0.1478 | 90.7% | 3199.2544 | 3199.5588 | 41 | 4.0434985 | 23.9% | 1 | R.PSIPLSAMESNNSSELSQSQMKQRKEHR.E | 3 |
| U | Reverse_YML034W | 1 | 1 | 2.9% | 834 | 95497 | 5.6 | SRC1 SGDID:S000004497, Chr XIII from 209525-211444,211571-212155, Verified ORF, "Protein with a putative role in sister chromatid segregation, potentially phosphorylated by Cdc28p; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9231.9231.2 | 3.8469 | 0.0642 | 97.8% | 2811.3289 | 2808.5696 | 5 | 4.078335 | 48.1% | 1 | R.LQVISLYANEKPDSMSKIKQFKLK.E | 2 |
| U | YBR133C | 2 | 2 | 2.9% | 827 | 95153 | 6.4 | HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.582.582.2 | 2.3732 | 0.1245 | 96.4% | 1266.7122 | 1265.6676 | 25 | 3.991213 | 43.8% | 1 | K.VLLNECKYAR.F | 2 |
| * | Jamie_Mit_09102008.1077.1077.3 | 2.6818 | 0.4008 | 100.0% | 1570.8212 | 1570.8188 | 1 | 6.4811635 | 63.4% | 1 | R.SIVTDDTKTLAHNR.H | 3 |
| U | YGL216W | 1 | 1 | 2.9% | 805 | 91090 | 7.1 | KIP3 SGDID:S000003184, Chr VII from 84884-87301, Verified ORF, "Kinesin-related motor protein involved in mitotic spindle positioning " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18612.18612.2 | 1.9704 | 0.1799 | 95.5% | 2551.1494 | 2548.2751 | 14 | 3.8804553 | 38.5% | 1 | R.NEILVNSSIMTEKLMSDPGLNSR.F | 2 |
| U | Reverse_YNL227C | 1 | 1 | 2.9% | 590 | 68783 | 6.2 | JJJ1 SGDID:S000005171, Chr XIV from 222432-220660, reverse complement, Uncharacterized ORF, "Protein that contains a 70 amino acid J-domain, may function as a co-chaperone to recruit Hsp70-like activity to specific sites; mutation causes defects in fluid-phase endocytosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.23822.23822.3 | 1.5664 | 0.3453 | 98.7% | 1847.3712 | 1846.1866 | 19 | 5.294015 | 29.3% | 1 | K.VKKRKVVNKVAAHGAIK.V | 3 |
| U | YKR096W | 1 | 1 | 2.8% | 1195 | 137491 | 5.4 | YKR096W SGDID:S000001804, Chr XI from 626435-630022, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2740.2740.2 | 1.8426 | 0.2168 | 97.3% | 3503.1934 | 3501.8413 | 11 | 4.5965776 | 28.6% | 1 | K.RALKRENSVGITQSSALISKSFSENGGSIAHEK.W | 2 |
| U | YPL147W | 1 | 1 | 2.8% | 870 | 100025 | 9.5 | PXA1 SGDID:S000006068, Chr XVI from 273254-275866, Verified ORF, "Subunit of a heterodimeric peroxisomal ATP-binding cassette transporter complex (Pxa1p-Pxa2p), required for import of long-chain fatty acids into peroxisomes; similarity to human adrenoleukodystrophy transporter and ALD-related proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.11254.11254.2 | 2.2497 | 0.2106 | 98.9% | 2649.3318 | 2646.364 | 9 | 4.265253 | 35.7% | 1 | R.VHSLNFNYGAVPSILSIRTEDASR.N | 2 |
| U | Reverse_YLL008W | 1 | 1 | 2.5% | 752 | 84843 | 5.7 | DRS1 SGDID:S000003931, Chr XII from 131728-133986, Verified ORF, "Nucleolar DEAD-box protein required for ribosome assembly and function, including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.20815.20815.2 | 2.1529 | 0.2697 | 98.7% | 2123.4768 | 2121.2832 | 15 | 4.9029016 | 37.5% | 1 | K.PPDIMIRVPKKLSLSVLSK.I | 2 |
| U | YDR239C | 1 | 1 | 2.4% | 787 | 86433 | 6.6 | YDR239C SGDID:S000002647, Chr IV from 943414-941051, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.26172.26172.2 | 1.6532 | 0.1914 | 94.9% | 2136.5278 | 2135.314 | 2 | 4.5944786 | 35.7% | 1 | K.NIKVKLRTSSKQIGIKHGK.V | 2 |
| U | YJL092W | 1 | 1 | 2.3% | 1174 | 134306 | 8.8 | HPR5 SGDID:S000003628, Chr X from 257339-260863, Verified ORF, "DNA helicase and DNA-dependent ATPase involved in DNA repair, required for proper timing of commitment to meiotic recombination and the transition from Meiosis I to Meiosis II; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18187.18187.2 | 1.7823 | 0.1735 | 94.9% | 3084.652 | 3083.631 | 6 | 3.7867258 | 37.0% | 1 | K.TQKFSKKVKNEPASSQMDIFSQLSRAK.K | 2 |
| U | YFL037W | 1 | 1 | 2.2% | 457 | 50923 | 4.7 | TUB2 SGDID:S000001857, Chr VI from 56335-57708, Verified ORF, "Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5240.5240.2 | 1.9441 | 0.211 | 98.9% | 1126.6917 | 1125.6785 | 5 | 4.5983715 | 58.8% | 1 | K.LAVNLVPFPR.L | 2 |
| U | Reverse_YPL167C | 1 | 1 | 2.1% | 1504 | 172956 | 8.6 | REV3 SGDID:S000006088, Chr XVI from 237106-232592, reverse complement, Verified ORF, "Subunit of DNA polymerase zeta, which is involved in DNA repair; required for mutagenesis induced by DNA damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15025.15025.3 | 2.2889 | 0.1969 | 95.0% | 3620.3438 | 3618.1704 | 45 | 3.6762168 | 34.1% | 1 | R.KGYRLGAAMVKKRKRSLLSTKNASVSSRLKRK.S | 3 |
| U | Reverse_YNR065C | 1 | 1 | 2.1% | 1116 | 125200 | 5.1 | YNR065C SGDID:S000005348, Chr XIV from 753700-750350, reverse complement, Uncharacterized ORF, "Sortilin homolog, interacts with proteins of the endocytic machinery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.11444.11444.2 | 3.2157 | 0.079 | 95.4% | 2587.9722 | 2586.1956 | 14 | 3.8393023 | 39.3% | 1 | R.DSSGEEPIEDCPIDVPEIKMPTK.C | 2 |
| U | YNL087W | 1 | 1 | 2.0% | 1178 | 132509 | 8.5 | TCB2 SGDID:S000005031, Chr XIV from 462413-465949, Verified ORF, "Bud-specific protein with a potential role in membrane trafficking; GFP-fusion protein migrates from the cell surface to intracellular vesicles near vacuole; contains 3 calcium and lipid binding domains; mRNA is targeted to the bud via the mRNA transport system involving She2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.17473.17473.2 | 1.9934 | 0.1359 | 92.9% | 2512.5723 | 2510.3394 | 8 | 3.465813 | 36.0% | 1 | K.AVVPLSTIDPESDTTFNIPLVGPK.G | 2 |
| U | Reverse_YJL198W | 1 | 1 | 2.0% | 881 | 97689 | 7.1 | PHO90 SGDID:S000003734, Chr X from 60843-63488, Verified ORF, "Low-affinity phosphate transporter; deletion of pho84, pho87, pho89, pho90, and pho91 causes synthetic lethality; transcription independent of Pi and Pho4p activity; overexpression results in vigorous growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.16461.16461.2 | 1.8995 | 0.2147 | 97.3% | 2039.4103 | 2038.272 | 17 | 4.3496013 | 37.5% | 1 | K.IGLLLGTVLIIFYIKYAK.K | 2 |
| U | YLR139C | 1 | 1 | 2.0% | 643 | 73257 | 9.2 | SLS1 SGDID:S000004129, Chr XII from 423474-421543, reverse complement, Verified ORF, "Mitochondrial membrane protein required for assembly of respiratory-chain enzyme complexes III and IV; coordinates expression of mitochondrially-encoded genes; may facilitate delivery of mRNA to membrane-bound translation machinery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.12181.12181.2 | 1.7165 | 0.1407 | 90.6% | 1526.0824 | 1522.932 | 1 | 4.0251784 | 47.4% | 1 | R.PLLKLQENSVILR.T | 2 |
| U | YHR159W | 1 | 1 | 2.0% | 504 | 56314 | 8.3 | YHR159W SGDID:S000001202, Chr VIII from 417552-419066, Uncharacterized ORF, "Protein of unknown function that localizes to the cytoplasm, potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3174.3174.2 | 1.4309 | 0.2208 | 95.3% | 1159.6356 | 1158.5754 | 10 | 3.4989345 | 61.5% | 1 | R.SVSPQDIQER.R | 2 |
| U | YDR027C | 1 | 1 | 1.9% | 889 | 101520 | 6.3 | VPS54 SGDID:S000002434, Chr IV from 497314-494645, reverse complement, Verified ORF, "Component of the GARP (Golgi-associated retrograde protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for the recycling of proteins from endosomes to the late Golgi; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.10920.10920.2 | 2.2014 | 0.2023 | 98.9% | 1988.0721 | 1987.0038 | 31 | 4.3153176 | 30.8% | 1 | K.SSHKFFHALSEVDNIQK.R | 2 |
| U | YJL034W | 1 | 1 | 1.9% | 682 | 74468 | 4.9 | KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" |
| U | contaminant_GR78_YEAST | 1 | 1 | 1.9% | 682 | 74468 | 4.9 | owl|P16474| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_Mit_09102008.5917.5917.2 | 1.0117 | 0.9068 | 100.0% | 1580.3121 | 1580.4672 | 2 | 3.6064868 | 18.8% | 1 | A.DYDDEDEDDDGDY.F | 2 |
| U | YOR156C | 1 | 1 | 1.8% | 726 | 81178 | 7.3 | NFI1 SGDID:S000005682, Chr XV from 630540-628360, reverse complement, Verified ORF, "SUMO ligase, catalyzes the covalent attachment of SUMO (Smt3p) to proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.11957.11957.2 | 1.6361 | 0.1478 | 90.8% | 1501.8522 | 1498.7622 | 20 | 3.3187637 | 40.0% | 1 | K.QSAGRGCTKMKFK.V | 2 |
| U | YHR186C | 1 | 1 | 1.7% | 1557 | 177608 | 7.8 | KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.15914.15914.3 | 3.9908 | 0.3827 | 100.0% | 3298.7214 | 3297.5017 | 1 | 5.7899213 | 37.5% | 1 | R.HGFEEQYQSDQLLQSLANDFIFYFDDK.R | 3 |
| U | Reverse_YDR464W | 1 | 1 | 1.7% | 1435 | 161596 | 8.9 | SPP41 SGDID:S000002872, Chr IV from 1388862-1393169, Verified ORF, "Protein involved in negative regulation of expression of spliceosome components PRP4 and PRP3" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9383.9383.3 | 2.3824 | 0.1753 | 93.6% | 2910.7056 | 2909.6306 | 53 | 3.5130136 | 27.8% | 1 | K.RRAVPLAFPPQSPITWPPHFPIKEK.H | 3 |
| U | YJR091C | 1 | 1 | 1.7% | 1091 | 120374 | 7.0 | JSN1 SGDID:S000003851, Chr X from 598250-594975, reverse complement, Verified ORF, "Member of the Puf family of RNA-binding proteins, interacts with mRNAs encoding membrane-associated proteins; overexpression suppresses a tub2-150 mutation and causes increased sensitivity to benomyl in wild-type cells" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.8835.8835.2 | 1.7999 | 0.1682 | 94.5% | 2070.3257 | 2067.1199 | 14 | 3.813866 | 50.0% | 1 | R.RLLEEVGLASPSSTHNKTK.Q | 2 |
| U | YIL005W | 1 | 1 | 1.7% | 701 | 81219 | 7.8 | EPS1 SGDID:S000001267, Chr IX from 345689-347794, Verified ORF, "Pdi1p (protein disulfide isomerase)-related protein involved in endoplasmic reticulum retention of resident ER proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9198.9198.3 | 1.5589 | 0.2422 | 94.8% | 1386.029 | 1383.8912 | 4 | 4.6019444 | 45.2% | 1 | R.RARKADGIKKIK.E | 3 |
| U | YHR080C | 1 | 1 | 1.6% | 1345 | 149679 | 8.7 | YHR080C SGDID:S000001122, Chr VIII from 266840-262803, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.16743.16743.2 | 1.8656 | 0.1189 | 90.8% | 2458.5435 | 2455.3574 | 8 | 3.6572258 | 53.3% | 1 | R.KVVFEPIRHSHDKPTPGVGNLK.L | 2 |
| U | YGR274C | 1 | 1 | 1.6% | 1066 | 120696 | 7.5 | TAF1 SGDID:S000003506, Chr VII from 1043101-1039901, reverse complement, Verified ORF, "TFIID subunit (145 kDa), involved in RNA polymerase II transcription initiation, has histone acetyltransferase activity, involved in promoter binding and G1/S progression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3209.3209.2 | 1.7044 | 0.2516 | 98.9% | 2079.4758 | 2079.2878 | 10 | 4.8357 | 41.7% | 1 | K.ILKIVRKKRDENGIIQR.Q | 2 |
| U | Reverse_YIL002C | 1 | 1 | 1.6% | 946 | 108430 | 6.7 | INP51 SGDID:S000001264, Chr IX from 353428-350588, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.14259.14259.2 | 1.5926 | 0.1862 | 92.4% | 1838.1322 | 1835.988 | 17 | 3.727925 | 33.3% | 1 | K.SFRISKAITKYDNHR.Q | 2 |
| U | YKR095W | 1 | 1 | 1.5% | 1875 | 218454 | 5.2 | MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.21256.21256.3 | 2.8707 | 0.1272 | 92.4% | 3478.0613 | 3475.7556 | 24 | 3.7694035 | 26.2% | 1 | K.KRSQDILEKHEQLSSSDYEKLESEIENLK.E | 3 |
| U | Reverse_YGL150C | 1 | 1 | 1.4% | 1489 | 171455 | 5.7 | INO80 SGDID:S000003118, Chr VII from 225578-221109, reverse complement, Verified ORF, "ATPase that forms a large complex, containing actin and several actin-related proteins, that has chromatin remodeling activity and 3' to 5' DNA helicase activity in vitro; shows similarity to the Snf2p family of ATPases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.19673.19673.4 | 1.9984 | 0.2035 | 94.6% | 2552.382 | 2549.3132 | 5 | 3.7101858 | 35.4% | 1 | K.SEKEEEEKKAQEMAEKEIKKK.L | 4 |
| U | Reverse_YGR186W | 1 | 1 | 1.4% | 735 | 82194 | 5.7 | TFG1 SGDID:S000003418, Chr VII from 867779-869986, Verified ORF, "TFIIF (Transcription Factor II) largest subunit; involved in both transcription initiation and elongation of RNA polymerase II; homologous to human RAP74" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.203.203.2 | 1.453 | 0.162 | 90.0% | 1198.5812 | 1198.6002 | 15 | 3.8553193 | 50.0% | 1 | K.LEMHDNGVKR.C | 2 |
| U | Reverse_YPL216W | 1 | 1 | 1.3% | 1102 | 128133 | 7.3 | YPL216W SGDID:S000006137, Chr XVI from 143820-147128, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.23887.23887.2 | 1.7321 | 0.1553 | 91.6% | 1500.7322 | 1499.7606 | 10 | 3.788007 | 45.5% | 1 | R.QSSIGYGSVHSIHK.Y | 2 |
| U | Reverse_YDR207C | 1 | 1 | 1.3% | 836 | 91124 | 9.5 | UME6 SGDID:S000002615, Chr IV from 867517-865007, reverse complement, Verified ORF, "Key transcriptional regulator of early meiotic genes, binds URS1 upstream regulatory sequence, couples metabolic responses to nutritional cues with initiation and progression of meiosis, forms complex with Ime1p, and also with Sin3p-Rpd3p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.3337.3337.3 | 1.9426 | 0.2692 | 97.5% | 1346.7626 | 1346.8054 | 23 | 4.629768 | 53.6% | 1 | K.KMARRKAEKTK.K | 3 |
| U | Reverse_YDR283C | 1 | 1 | 1.2% | 1659 | 190192 | 6.4 | GCN2 SGDID:S000002691, Chr IV from 1030043-1025064, reverse complement, Verified ORF, "Protein kinase, phosphorylates the alpha-subunit of translation initiation factor eIF2 (Sui2p) in response to starvation; activated by uncharged tRNAs and the Gcn1p-Gcn20p complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.18554.18554.2 | 1.9485 | 0.1429 | 92.8% | 2310.4163 | 2307.276 | 9 | 3.6148148 | 44.4% | 1 | K.VEKFSRAFGVQSLMRSVLPR.Q | 2 |
| U | Reverse_YGL131C | 1 | 1 | 1.2% | 1403 | 163203 | 8.6 | SNT2 SGDID:S000003099, Chr VII from 265864-261653, reverse complement, Verified ORF, "DNA binding protein with similarity to the S. pombe Snt2 protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.10118.10118.2 | 2.2415 | 0.1706 | 96.8% | 2157.372 | 2154.1792 | 24 | 4.4251137 | 30.4% | 1 | R.KMKVFSNPNKYVKMRQR.I | 2 |
| U | YMR109W | 1 | 1 | 1.2% | 1219 | 136899 | 9.3 | MYO5 SGDID:S000004715, Chr XIII from 486586-490245, Verified ORF, "One of two type I myosins; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.10956.10956.2 | 1.3518 | 0.1851 | 90.1% | 1802.2445 | 1799.0615 | 10 | 3.8872037 | 39.1% | 1 | R.IDAATKIQRTIRERK.E | 2 |
| U | YLR223C | 1 | 1 | 1.2% | 1085 | 122491 | 4.7 | IFH1 SGDID:S000004213, Chr XII from 585492-582235, reverse complement, Verified ORF, "Essential protein with a highly acidic N-terminal domain; IFH1 exhibits genetic interactions with FHL1, overexpression interferes with silencing at telomeres and HM loci; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.24537.24537.2 | 1.3629 | 0.3708 | 99.4% | 1654.3344 | 1652.179 | 2 | 4.001076 | 37.5% | 1 | R.QLKKKKKLLKIRK.Q | 2 |
| U | YIR002C | 1 | 1 | 1.2% | 993 | 114058 | 7.3 | MPH1 SGDID:S000001441, Chr IX from 360393-357412, reverse complement, Verified ORF, "Member of the DEAH family of helicases, functions in an error-free DNA damage bypass pathway that involves homologous recombination, mutations confer a mutator phenotype" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.2361.2361.2 | 1.5541 | 0.1518 | 90.4% | 1437.0251 | 1433.8817 | 18 | 4.1763496 | 31.6% | 1 | R.KHAPKGRKKVER.L | 2 |
| U | Reverse_YDR440W | 1 | 1 | 1.2% | 582 | 66201 | 9.1 | DOT1 SGDID:S000002848, Chr IV from 1342483-1344231, Verified ORF, "Nucleosomal histone H3-Lys79 methylase, associates with transcriptionally active genes, functions in gene silencing at telomeres, most likely by directly modulating chromatin structure and Sir protein localization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.26277.26277.1 | 1.2607 | 0.2137 | 92.9% | 743.55084 | 741.49866 | 2 | 4.415864 | 70.0% | 1 | K.VKAAKPK.K | 1 |
| U | YHR099W | 2 | 2 | 1.1% | 3744 | 433182 | 6.5 | TRA1 SGDID:S000001141, Chr VIII from 302764-313998, Verified ORF, "Subunit of SAGA and NuA4 histone acetyltransferase complexes; interacts with acidic activators (e.g., Gal4p) which leads to transcription activation; similar to human TRRAP, which is a cofactor for c-Myc mediated oncogenic transformation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.9145.9145.2 | 3.3265 | 0.388 | 100.0% | 2846.2922 | 2845.2778 | 1 | 5.6412034 | 52.0% | 1 | R.SGALPYSQSEYALWEDNWIQCAEK.L | 2 |
| * | Jamie_Mit_09102008.15893.15893.2 | 3.3373 | 0.3911 | 100.0% | 2237.8762 | 2236.0503 | 12 | 6.6718946 | 53.8% | 1 | K.DHFTSLFTQFEDFWLFR.K | 2 |
| U | YIR006C | 1 | 1 | 1.1% | 1480 | 160266 | 5.3 | PAN1 SGDID:S000001445, Chr IX from 369905-365463, reverse complement, Verified ORF, "Part of actin cytoskeleton-regulatory complex Pan1p-Sla1p-End3p, associates with actin patches on the cell cortex; promotes protein-protein interactions essential for endocytosis; previously thought to be a subunit of poly(A) ribonuclease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.693.693.4 | 2.2397 | 0.1628 | 92.2% | 2082.9458 | 2082.1418 | 26 | 3.503156 | 41.9% | 1 | K.RIQQENGKNQEIIKDIR.S | 4 |
| U | YJL005W | 1 | 1 | 0.9% | 2026 | 227832 | 7.3 | CYR1 SGDID:S000003542, Chr X from 425072-431152, Verified ORF, "Adenylate cyclase, required for cAMP production and cAMP-dependent protein kinase signaling; involved in cell cycle control and glucose and nitrogen repression of sporulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.14184.14184.2 | 1.6704 | 0.2868 | 98.8% | 2151.583 | 2148.3596 | 6 | 4.830927 | 28.6% | 1 | K.VGKLSKILRPTSKPILIER.K | 2 |
| U | YCR081W | 1 | 1 | 0.9% | 1427 | 166860 | 6.5 | SRB8 SGDID:S000000677, Chr III from 254367-258650, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation; involved in glucose repression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.5311.5311.2 | 1.4792 | 0.254 | 96.4% | 1471.1322 | 1467.9878 | 21 | 4.06843 | 15.0% | 1 | K.LNILKILSSLILK.I | 2 |
| U | Reverse_YGR097W | 1 | 1 | 0.9% | 1146 | 126864 | 9.3 | ASK10 SGDID:S000003329, Chr VII from 678699-682139, Verified ORF, "Component of the RNA polymerase II holoenzyme, phosphorylated in response to oxidative stress; has a role in destruction of Ssn8p, which relieves repression of stress-response genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.4544.4544.2 | 1.8037 | 0.1716 | 95.1% | 1100.657 | 1100.5587 | 1 | 3.5398018 | 78.6% | 1 | R.VDANENLTPK.G | 2 |
| U | YIL126W | 1 | 1 | 0.8% | 1359 | 156742 | 6.7 | STH1 SGDID:S000001388, Chr IX from 117992-122071, Verified ORF, "ATPase component of the ATP-dependent RSC chromatin remodeling complex required for kinetochore function in chromosome segregation; required for expression of early meiotic genes; essential helicase-related protein homologous to Snf2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | Prob Score | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_Mit_09102008.6470.6470.2 | 1.476 | 0.3118 | 98.8% | 1311.0399 | 1310.925 | 1 | 4.8421392 | 44.4% | 1 | K.KKKPKLTVKIK.L | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 10861 | 60981 | 64041 |
| Filtered | 163 | 539 | 657 |
| Forward matches | 106 | 481 | 599 |
| Decoy matches | 57 | 58 | 58 |
| Forward FP rate | 53.77% | 12.06% | 9.68% |