* | STY | 80.0 |
# | X | 0.0 |
@ | X | 0.0 |
Static | C | 57.0 |
true | Use criteria |
0.0 | Minimum peptide confidence |
0.1 | Peptide false positive rate |
0.0 | Minimum protein confidence |
1.0 | Protein false positive rate |
1 | Minimum charge state |
16 | Maximum charge state |
0.0 | Minimum ion proportion |
1000 | Maximum Sp rank |
-1.0 | Minimum Sp score |
Include | Modified peptide inclusion |
Any | Tryptic status requirement |
false | Multiple, ambiguous IDs allowed |
Ignore | Peptide validation handling |
XCorr | Purge duplicate peptides by protein |
false | Include only loci with unique peptide |
true | Remove subset proteins |
Ignore | Locus validation handling |
con | Exclude protein names matching |
0 | Minimum modified peptides per locus |
1000 | Minimum redundancy for low coverage loci |
1 | Minimum peptides per locus |
Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
Locus | # of identical peptides | # of differing peptides |
U | YDL130W | 5 | 18 | 64.2% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09273.09273.2 | 3.6216 | 0.4137 | 100.0% | 1664.1322 | 1663.808 | 1 | 6.292 | 56.7% | 2 | K.AAGANVDNVWADVYAK.A | 2 |
* | 22_g_01_itms.15060.15060.3 | 6.4974 | 0.5196 | 100.0% | 5092.224 | 5091.1274 | 1 | 8.524 | 20.1% | 9 | K.EILSGFHNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12324.12324.3 | 4.4982 | 0.0648 | 100.0% | 3473.1843 | 3471.322 | 1 | 5.778 | 27.3% | 1 | A.SGAAAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12305.12305.3 | 4.8778 | 0.3402 | 100.0% | 3257.0645 | 3256.2312 | 1 | 7.053 | 42.5% | 4 | A.AAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12343.12343.2 | 4.1403 | 0.3926 | 100.0% | 3257.3323 | 3256.2312 | 1 | 6.763 | 35.0% | 2 | A.AAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 2 |
U | YDR363W-A | 3 | 11 | 62.9% | 89 | 10386 | 4.3 | SEM1 SGDID:S000007235, Chr IV from 1202118-1202387, Verified ORF, "Component of the lid subcomplex of the regulatory subunit of the 26S proteasome; ortholog of human DSS1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13577.13577.2 | 5.0436 | 0.4469 | 100.0% | 2700.7122 | 2700.184 | 1 | 8.333 | 47.7% | 4 | K.SLEEDDEFEDFPIDTWANGETIK.S | 2 |
* | 22_g_01_itms.13661.13661.3 | 5.5318 | 0.3577 | 100.0% | 2701.0444 | 2700.184 | 1 | 7.482 | 33.0% | 6 | K.SLEEDDEFEDFPIDTWANGETIK.S | 3 |
* | 22_g_01_itms.19824.19824.3 | 3.7327 | 0.2302 | 98.1% | 3915.9543 | 3910.7532 | 3 | 4.309 | 21.1% | 1 | K.SNAVTQTNIWEENWDDVEVDDDFTNELKAELDR.Y | 3 |
U | YBR109C | 3 | 8 | 55.1% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23873.23873.3 | 4.2227 | 0.1669 | 99.0% | 4110.1143 | 4106.9326 | 2 | 4.666 | 20.1% | 1 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
* | 22_g_01_itms.10553.10553.2 | 4.2442 | 0.3819 | 100.0% | 1509.8121 | 1509.7073 | 1 | 7.136 | 79.2% | 4 | K.SNDSEQELLEAFK.V | 2 |
* | 22_g_01_itms.26644.26644.3 | 4.152 | 0.3101 | 100.0% | 3367.6143 | 3366.601 | 3 | 5.409 | 21.7% | 3 | T.SIGEKLTDAEVDDMLREVSDGSGEINIQQFA.A | 3 |
U | YDL081C | 3 | 16 | 48.1% | 106 | 10908 | 3.9 | RPP1A SGDID:S000002239, Chr IV from 310122-309802, reverse complement, Verified ORF, "Ribosomal protein P1 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16146.16146.3 | 4.1985 | 0.277 | 100.0% | 5111.1846 | 5109.1997 | 1 | 5.602 | 16.5% | 2 | K.DLLVNFSAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12953.12953.3 | 6.7218 | 0.4251 | 100.0% | 3813.2043 | 3811.533 | 1 | 7.83 | 26.4% | 9 | A.GVAGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12858.12858.3 | 5.5152 | 0.3892 | 100.0% | 3656.3643 | 3655.443 | 1 | 6.874 | 27.9% | 5 | V.AGGVAGGEAGEAEAEKEEEEAKEES*DDDMGFGLFD.- | 3 |
U | YDR382W | 3 | 22 | 43.6% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12434.12434.3 | 4.9382 | 0.3209 | 100.0% | 4693.5244 | 4686.947 | 1 | 5.422 | 19.1% | 5 | K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.11879.11879.3 | 3.7805 | 0.2795 | 97.7% | 3640.7644 | 3640.4434 | 1 | 4.926 | 18.6% | 2 | A.AAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.13068.13068.3 | 4.0503 | 0.2568 | 100.0% | 3177.3843 | 3171.2148 | 1 | 5.897 | 38.4% | 15 | A.AAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- | 3 |
U | YOL039W | 4 | 14 | 43.4% | 106 | 10746 | 4.0 | RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13023.13023.3 | 8.0701 | 0.5539 | 100.0% | 4454.5444 | 4447.856 | 1 | 9.512 | 30.6% | 4 | K.LAAVPAAGPASAGGAAAASGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12281.12281.3 | 4.2879 | 0.3623 | 100.0% | 3289.4944 | 3286.242 | 1 | 5.967 | 25.0% | 1 | A.AAASGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
* | 22_g_01_itms.12757.12757.2 | 4.3677 | 0.4254 | 100.0% | 3073.4321 | 3073.1306 | 1 | 7.349 | 38.9% | 4 | A.SGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 2 |
* | 22_g_01_itms.12702.12702.3 | 5.0175 | 0.4188 | 100.0% | 3077.2744 | 3073.1306 | 1 | 7.185 | 34.3% | 5 | A.SGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 3 |
U | Reverse_YPR036W-A | 1 | 1 | 40.3% | 67 | 7055 | 5.9 | YPR036W-A SGDID:S000028425, Chr XVI from 645947-646150, Uncharacterized ORF |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22372.22372.2 | 2.6616 | 0.284 | 95.6% | 2830.7122 | 2830.4224 | 21 | 4.546 | 26.9% | 1 | N.ADSNKRSSPQSVPSLSPIVFPQSVDST.L | 2 |
U | YIL002W-A | 2 | 3 | 31.9% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00239.00239.2 | 3.049 | 0.4073 | 100.0% | 1191.0122 | 1190.5541 | 1 | 6.427 | 77.3% | 1 | R.DTPEDVSTAGAK.D | 2 |
* | 22_g_01_itms.16829.16829.2 | 3.4302 | 0.223 | 98.4% | 1156.2922 | 1155.6989 | 2 | 4.848 | 83.3% | 2 | K.DILDVLNLLK.G | 2 |
U | YOR257W | 3 | 6 | 30.4% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10425.10425.2 | 2.8888 | 0.172 | 92.0% | 2593.0322 | 2592.268 | 1 | 4.356 | 31.8% | 1 | R.SSLQSGPLNSELLEEQKQEIYEA.F | 2 |
* | 22_g_01_itms.11359.11359.2 | 4.6419 | 0.41 | 100.0% | 1668.4521 | 1666.7811 | 1 | 7.434 | 80.8% | 2 | R.EILDLIDEYDSEGR.H | 2 |
* | 22_g_01_itms.06696.06696.2 | 3.1462 | 0.3936 | 100.0% | 1406.2522 | 1404.6858 | 12 | 6.295 | 63.6% | 3 | K.ELGETLTDEELR.A | 2 |
U | Reverse_YOR020C | 1 | 1 | 29.2% | 106 | 11372 | 9.0 | HSP10 SGDID:S000005546, Chr XV from 370843-370523, reverse complement, Verified ORF, "Mitochondrial matrix co-chaperonin that inhibits the ATPase activity of Hsp60p, a mitochondrial chaperonin; involved in protein folding and sorting in the mitochondria; 10 kD heat shock protein with similarity to E. coli groES" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15188.15188.3 | 2.8649 | 0.1703 | 90.2% | 3238.5244 | 3233.717 | 443 | 3.802 | 20.0% | 1 | Q.PVVKNGNADTFGPGVAVVEAQNLKEVNKEPL.Y | 3 |
U | YKL042W | 9 | 27 | 26.7% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09764.09764.2 | 3.1006 | 0.3262 | 94.6% | 2607.392 | 2607.0903 | 3 | 5.361 | 36.8% | 1 | R.LYDDYYNIPYQYSNPT*PMNR.D | 2 |
* | 22_g_01_itms.10109.10109.2 | 3.0547 | 0.3982 | 100.0% | 1297.1921 | 1296.6986 | 1 | 6.804 | 80.0% | 3 | R.TLSVLTNYVMR.S | 2 |
* | 22_g_01_itms.12015.12015.2 | 2.8979 | 0.3483 | 97.1% | 1376.7722 | 1376.6649 | 1 | 5.491 | 80.0% | 1 | R.TLS*VLTNYVMR.S | 2 |
* | 22_g_01_itms.13505.13505.3 | 5.16 | 0.2287 | 97.7% | 2848.7043 | 2844.3352 | 1 | 4.945 | 36.5% | 4 | R.SEDGNNDRMS*PLPSPLNTILPINNR.L | 3 |
* | 22_g_01_itms.13451.13451.3 | 5.0754 | 0.2547 | 92.5% | 2927.5745 | 2924.3015 | 1 | 4.76 | 31.2% | 8 | R.SEDGNNDRMS*PLPS*PLNTILPINNR.L | 3 |
* | 22_g_01_itms.15361.15361.3 | 5.209 | 0.2395 | 98.2% | 2615.1243 | 2614.1895 | 1 | 5.272 | 34.5% | 1 | R.KLS*LNNQLQELQSMMDGDDNIK.L | 3 |
* | 22_g_01_itms.05137.05137.2 | 4.0908 | 0.3265 | 100.0% | 1958.5521 | 1956.8414 | 1 | 5.988 | 53.1% | 1 | R.VKPENNMSETFAT*PTPN.N | 2 |
* | 22_g_01_itms.09851.09851.3 | 3.9872 | 0.1876 | 92.3% | 2228.3943 | 2226.9854 | 12 | 4.769 | 36.1% | 1 | R.VKPENNMSETFATPT*PNNR.- | 3 |
* | 22_g_01_itms.08207.08207.3 | 4.3433 | 0.2587 | 98.3% | 2228.6343 | 2226.9854 | 5 | 5.226 | 33.3% | 7 | R.VKPENNMSETFAT*PTPNNR.- | 3 |
U | YLL024C | 13 | 35 | 25.7% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
U | YGR271C-A | 1 | 2 | 25.4% | 63 | 7099 | 4.3 | YGR271C-A SGDID:S000007608, Chr VII from 1037997-1037806, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09590.09590.2 | 3.401 | 0.2588 | 100.0% | 1914.3322 | 1913.8292 | 1 | 5.62 | 56.7% | 2 | K.ELDQVVGEDEKDDFFE.- | 2 |
U | YGL258W-A | 1 | 1 | 23.4% | 77 | 8690 | 8.8 | YGL258W-A SGDID:S000007607, Chr VII from 9162-9395, Uncharacterized ORF, "Hypothetical protein identified by homology. See FEBS Letters [2000] 487:31-36." |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00067.00067.2 | 1.5681 | 0.2836 | 95.7% | 1968.0521 | 1968.0231 | 62 | 4.611 | 23.5% | 1 | N.VHFGSILFGAVDKSKYAE.E | 2 |
U | YDL055C | 6 | 11 | 22.7% | 361 | 39566 | 6.3 | PSA1 SGDID:S000002213, Chr IV from 356759-355674, reverse complement, Verified ORF, "GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase), synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15137.15137.2 | 4.7059 | 0.4211 | 100.0% | 2291.652 | 2291.0693 | 1 | 7.359 | 58.3% | 3 | K.DNSPFFVLNSDVICEYPFK.E | 2 |
* | 22_g_01_itms.15098.15098.3 | 4.2264 | 0.1964 | 99.0% | 2291.9644 | 2291.0693 | 1 | 4.646 | 40.3% | 1 | K.DNSPFFVLNSDVICEYPFK.E | 3 |
* | 22_g_01_itms.08313.08313.2 | 2.3667 | 0.2202 | 97.8% | 1205.2522 | 1204.6465 | 67 | 4.785 | 61.1% | 2 | K.ETFPILVEEK.Q | 2 |
* | 22_g_01_itms.15830.15830.2 | 4.8308 | 0.409 | 100.0% | 1641.3922 | 1640.8899 | 1 | 8.072 | 75.0% | 2 | K.DFLSGTVLYLNSLAK.R | 2 |
* | 22_g_01_itms.10046.10046.2 | 3.4551 | 0.2925 | 100.0% | 1753.6122 | 1750.8335 | 1 | 6.343 | 53.6% | 2 | K.STIVGWNSTVGQWCR.L | 2 |
* | 22_g_01_itms.26659.26659.3 | 3.696 | 0.1115 | 93.4% | 2464.8542 | 2462.2666 | 8 | 3.973 | 30.7% | 1 | R.LEGVTVLGDDVEVKDEIYINGGK.V | 3 |
U | YER112W | 1 | 1 | 22.5% | 187 | 21276 | 9.5 | LSM4 SGDID:S000000914, Chr V from 387228-387791, Verified ORF, "Lsm (Like Sm) protein; part of heteroheptameric complexes (Lsm2p-7p and either Lsm1p or 8p): cytoplasmic Lsm1p complex involved in mRNA decay; nuclear Lsm8p complex part of U6 snRNP and possibly involved in processing tRNA, snoRNA, and rRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25249.25249.3 | 3.933 | 0.277 | 100.0% | 4632.534 | 4629.1426 | 3 | 5.354 | 17.7% | 1 | K.NGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSK.A | 3 |
U | YIL149C | 31 | 75 | 22.2% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15391.15391.2 | 2.7732 | 0.2239 | 100.0% | 2412.4321 | 2408.2866 | 19 | 5.55 | 32.5% | 1 | K.ISEFLNVPFESLQGVTYPVLR.K | 2 |
* | 22_g_01_itms.04802.04802.2 | 3.6828 | 0.3276 | 100.0% | 1822.3322 | 1818.8105 | 2 | 5.797 | 50.0% | 4 | R.DQGNDSLNDDLNKENK.L | 2 |
* | 22_g_01_itms.04802.04802.3 | 3.7899 | 0.176 | 98.3% | 2732.9944 | 2729.4004 | 15 | 4.345 | 28.4% | 1 | R.DQGNDSLNDDLNKENKLLRRKLM.E | 2 |
* | 22_g_01_itms.45486.45486.3 | 2.9511 | 0.1379 | 92.9% | 2601.4443 | 2600.1536 | 48 | 3.931 | 29.8% | 1 | K.NDDNSCRNPEHTDVIDELIDTK.L | 3 |
* | 22_g_01_itms.08289.08289.2 | 3.616 | 0.3308 | 100.0% | 2116.392 | 2113.9456 | 1 | 6.674 | 47.1% | 3 | R.LQNIVMDCTKEEEATMTT.S | 2 |
* | 22_g_01_itms.14390.14390.2 | 4.304 | 0.3838 | 100.0% | 2806.9922 | 2805.465 | 2 | 6.126 | 33.3% | 2 | K.LLLLNTSAIQETAS*PLSQDELISLR.K | 2 |
* | 22_g_01_itms.14414.14414.3 | 5.1624 | 0.3052 | 100.0% | 2807.4243 | 2805.465 | 1 | 6.379 | 36.5% | 1 | K.LLLLNTSAIQETAS*PLSQDELISLR.K | 3 |
* | 22_g_01_itms.07058.07058.2 | 3.3841 | 0.0972 | 92.8% | 2246.7122 | 2245.131 | 1 | 4.39 | 42.1% | 2 | K.ILESSNIVNENDSQAIITER.L | 2 |
* | 22_g_01_itms.07007.07007.2 | 4.2026 | 0.2755 | 100.0% | 1550.4122 | 1548.791 | 1 | 6.011 | 70.8% | 3 | R.LVEFSNVNELQEK.N | 2 |
* | 22_g_01_itms.08297.08297.2 | 4.8218 | 0.232 | 100.0% | 1343.3922 | 1342.7218 | 1 | 5.872 | 81.8% | 6 | K.DAIIELENINAK.M | 2 |
* | 22_g_01_itms.04377.04377.2 | 2.2165 | 0.3416 | 100.0% | 1106.9722 | 1106.5581 | 1 | 5.644 | 77.8% | 2 | R.ELEAELSSTK.V | 2 |
* | 22_g_01_itms.08846.08846.2 | 2.6812 | 0.2256 | 95.4% | 1245.4521 | 1243.5846 | 1 | 4.496 | 77.8% | 4 | K.TTLEDFENFK.G | 2 |
* | 22_g_01_itms.07454.07454.2 | 3.2208 | 0.2181 | 96.9% | 1808.4122 | 1806.8873 | 6 | 4.743 | 46.7% | 2 | K.FLDQNSDASTLEPTLR.K | 2 |
* | 22_g_01_itms.15867.15867.3 | 5.8 | 0.3372 | 100.0% | 2693.3342 | 2692.3318 | 1 | 6.549 | 40.2% | 4 | K.DANSQIQAYEEIISSNENALIELK.N | 3 |
* | 22_g_01_itms.15876.15876.2 | 5.3358 | 0.3663 | 100.0% | 2694.5522 | 2692.3318 | 1 | 6.341 | 52.2% | 3 | K.DANSQIQAYEEIISSNENALIELK.N | 2 |
* | 22_g_01_itms.20158.20158.3 | 4.4004 | 0.2065 | 99.7% | 3249.4744 | 3247.6333 | 104 | 5.041 | 20.5% | 2 | K.DANSQIQAYEEIISSNENALIELKNELAK.T | 3 |
* | 22_g_01_itms.00870.00870.2 | 3.6929 | 0.3404 | 100.0% | 1222.0922 | 1221.5421 | 1 | 7.088 | 85.0% | 6 | K.DAADCQAELTK.T | 2 |
* | 22_g_01_itms.07670.07670.2 | 4.2895 | 0.3444 | 100.0% | 1533.0721 | 1531.7968 | 2 | 5.961 | 70.8% | 2 | R.ELISNIEQTESLR.V | 2 |
* | 22_g_01_itms.08023.08023.2 | 2.9239 | 0.3218 | 100.0% | 1472.2322 | 1471.7756 | 14 | 5.792 | 54.2% | 3 | K.QQAALTNELNELK.A | 2 |
* | 22_g_01_itms.07220.07220.2 | 2.944 | 0.3366 | 100.0% | 1310.4722 | 1308.6436 | 1 | 5.996 | 63.6% | 1 | K.ENAGSLTFLDNK.G | 2 |
* | 22_g_01_itms.11105.11105.3 | 4.2482 | 0.2167 | 94.6% | 3106.3145 | 3104.3374 | 32 | 4.858 | 22.2% | 2 | K.ENAGSLTFLDNKGS*GEDAEEELWNSPSK.G | 3 |
* | 22_g_01_itms.06503.06503.2 | 5.1361 | 0.3484 | 100.0% | 1735.2722 | 1734.7458 | 1 | 6.611 | 70.0% | 2 | K.GSGEDAEEELWNSPSK.G | 2 |
* | 22_g_01_itms.18960.18960.3 | 4.504 | 0.3053 | 100.0% | 3471.2644 | 3470.55 | 87 | 5.356 | 23.4% | 3 | K.GSGEDAEEELWNSPS*KGNSERPSAVAGFINQK.N | 3 |
* | 22_g_01_itms.00423.00423.2 | 2.616 | 0.1448 | 98.4% | 1319.8922 | 1318.6239 | 6 | 4.892 | 58.3% | 2 | K.ENNIVDSSAAGNK.A | 2 |
* | 22_g_01_itms.13499.13499.2 | 2.5512 | 0.2734 | 99.3% | 1533.2722 | 1532.7789 | 201 | 5.158 | 50.0% | 1 | K.AIPTFSFGKPFFSS.N | 2 |
* | 22_g_01_itms.13188.13188.2 | 3.1156 | 0.0876 | 99.3% | 2164.3523 | 2163.0762 | 30 | 5.084 | 34.2% | 2 | K.AIPTFSFGKPFFSSNTSSLQ.S | 2 |
* | 22_g_01_itms.10529.10529.3 | 3.5149 | 0.1757 | 91.1% | 2840.3044 | 2837.3818 | 2 | 3.837 | 27.0% | 1 | S.NTSSLQSFQNPFTASQSNINTNAPLR.T | 3 |
* | 22_g_01_itms.08259.08259.2 | 4.7113 | 0.3123 | 100.0% | 2054.3123 | 2052.984 | 1 | 6.212 | 52.6% | 3 | K.AAINFSNVTDLTNNSTDGAK.I | 2 |
* | 22_g_01_itms.08376.08376.3 | 4.3756 | 0.1553 | 96.3% | 2054.9343 | 2052.984 | 9 | 4.179 | 35.5% | 1 | K.AAINFSNVTDLTNNSTDGAK.I | 3 |
* | 22_g_01_itms.08229.08229.2 | 4.6309 | 0.4287 | 100.0% | 1982.9521 | 1981.9467 | 1 | 7.74 | 58.3% | 3 | A.AINFSNVTDLTNNSTDGAK.I | 2 |
* | 22_g_01_itms.07867.07867.2 | 4.5654 | 0.3958 | 100.0% | 1913.7722 | 1910.9095 | 1 | 7.634 | 64.7% | 2 | A.INFSNVTDLTNNSTDGAK.I | 2 |
U | YDL229W | 11 | 58 | 22.0% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
U | YNL209W | 11 | 58 | 22.0% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.11534.11534.2 | 4.9863 | 0.4196 | 100.0% | 2161.172 | 2160.1077 | 1 | 8.755 | 61.1% | 2 | K.VIDVDGNPVIEVQYLEETK.T | 2 | |
22_g_01_itms.07961.07961.2 | 3.4499 | 0.1961 | 100.0% | 1185.5521 | 1185.6592 | 1 | 5.577 | 86.4% | 3 | K.DAGAISGLNVLR.I | 2 | |
22_g_01_itms.15785.15785.3 | 5.1956 | 0.4246 | 100.0% | 2964.0842 | 2963.401 | 1 | 6.987 | 30.8% | 6 | R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A | 3 | |
22_g_01_itms.15828.15828.2 | 4.5336 | 0.4411 | 100.0% | 2965.4922 | 2963.401 | 1 | 7.32 | 40.4% | 5 | R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A | 2 | |
22_g_01_itms.13697.13697.2 | 4.1069 | 0.4967 | 100.0% | 1990.2122 | 1989.8817 | 1 | 8.756 | 64.7% | 2 | T.TVEVDSLFDGEDFESSLT.R | 2 | |
22_g_01_itms.11113.11113.2 | 2.8723 | 0.2121 | 100.0% | 1279.2522 | 1278.6582 | 1 | 5.493 | 80.0% | 2 | K.ENTLLGEFDLK.N | 2 | |
22_g_01_itms.19358.19358.3 | 3.7746 | 0.2994 | 100.0% | 2356.1943 | 2355.0662 | 1 | 5.78 | 38.8% | 14 | L.SSEEIEKMVNQAEEFKAADEA.F | 3 | |
22_g_01_itms.12583.12583.2 | 4.5079 | 0.4078 | 100.0% | 2165.7722 | 2166.1182 | 1 | 8.681 | 44.7% | 3 | R.LESYVASIEQTVTDPVLSSK.L | 2 | |
22_g_01_itms.28108.28108.3 | 5.1296 | 0.2267 | 99.7% | 2629.0144 | 2626.3577 | 1 | 4.84 | 33.3% | 15 | K.SKIEAALSDALAALQIEDPSADELR.K | 3 | |
22_g_01_itms.14610.14610.3 | 5.3409 | 0.1419 | 99.0% | 2412.5044 | 2411.2305 | 1 | 4.587 | 39.8% | 2 | K.IEAALSDALAALQIEDPSADELR.K | 3 | |
22_g_01_itms.14634.14634.2 | 6.2604 | 0.4636 | 100.0% | 2415.652 | 2411.2305 | 1 | 7.717 | 54.5% | 4 | K.IEAALSDALAALQIEDPSADELR.K | 2 |
U | YNL064C | 2 | 65 | 19.1% | 409 | 44671 | 6.3 | YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22643.22643.3 | 3.9564 | 0.248 | 98.3% | 4461.8945 | 4459.0083 | 9 | 4.357 | 17.0% | 2 | R.DIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPR.G | 3 |
* | 22_g_01_itms.29316.29316.3 | 7.5798 | 0.4272 | 100.0% | 3566.0044 | 3561.7278 | 1 | 7.583 | 28.9% | 63 | R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
U | YAL005C | 9 | 17 | 19.0% | 642 | 69768 | 5.1 | SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.05347.05347.2 | 3.318 | 0.2386 | 100.0% | 1407.1522 | 1407.6215 | 2 | 5.261 | 72.7% | 1 | R.NFNDPEVQADMK.H | 2 |
22_g_01_itms.14927.14927.3 | 3.2954 | 0.3067 | 99.7% | 1677.0844 | 1675.7312 | 1 | 4.883 | 41.7% | 2 | K.ATAGDTHLGGEDFDNR.L | 33 | |
22_g_01_itms.14049.14049.3 | 3.5944 | 0.3016 | 100.0% | 2578.3145 | 2577.2683 | 3 | 5.176 | 28.0% | 2 | R.SINPDEAVAYGAAVQAAILTGDESSK.T | 33 | |
22_g_01_itms.14083.14083.2 | 5.3564 | 0.5322 | 100.0% | 2581.8323 | 2577.2683 | 1 | 8.995 | 44.0% | 3 | R.SINPDEAVAYGAAVQAAILTGDESSK.T | 22 | |
22_g_01_itms.09411.09411.2 | 2.6828 | 0.1985 | 99.6% | 1265.7522 | 1265.6742 | 42 | 5.213 | 65.0% | 2 | K.NQLESIAYSLK.N | 22 | |
* | 22_g_01_itms.45905.45905.3 | 2.6218 | 0.1598 | 92.1% | 2165.3643 | 2163.0781 | 114 | 3.901 | 28.9% | 1 | K.NTISEAGDKLEQADKDTVTK.K | 3 |
* | 22_g_01_itms.06689.06689.3 | 3.1642 | 0.0244 | 98.6% | 2438.1243 | 2436.122 | 279 | 4.447 | 23.2% | 1 | L.YQAGGAPGGAAGGAPGGFPGGAPPAPEAE.G | 3 |
* | 22_g_01_itms.08483.08483.3 | 3.0002 | 0.2029 | 99.0% | 3262.8245 | 3262.493 | 402 | 4.628 | 18.8% | 1 | L.YQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD.- | 3 |
22_g_01_itms.08339.08339.2 | 3.5598 | 0.3224 | 100.0% | 2178.7722 | 2177.004 | 27 | 6.138 | 34.1% | 4 | A.PGGFPGGAPPAPEAEGPTVEEVD.- | 32 |
U | YLR048W | 5 | 10 | 18.7% | 252 | 27962 | 4.7 | RPS0B SGDID:S000004038, Chr XII from 242233-242322,242682-243350, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13999.13999.3 | 3.4042 | 0.1922 | 93.4% | 3764.5745 | 3759.6367 | 2 | 4.014 | 20.6% | 1 | R.NPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEAT.E | 3 |
* | 22_g_01_itms.19388.19388.3 | 6.1544 | 0.5481 | 100.0% | 5235.2046 | 5232.221 | 1 | 8.759 | 23.4% | 4 | R.NPEEVEQVAEEAAAAEEGEEEEVKEEVTEGQAEATEWAEENADNVEW.- | 3 |
* | 22_g_01_itms.16548.16548.3 | 4.8838 | 0.3328 | 100.0% | 3910.6143 | 3907.643 | 3 | 5.993 | 20.6% | 2 | A.AAAEEGEEEEVKEEVTEGQAEATEWAEENADNVEW.- | 3 |
22_g_01_itms.09792.09792.2 | 4.431 | 0.4645 | 100.0% | 1865.4722 | 1863.7673 | 1 | 8.339 | 66.7% | 1 | Q.AEATEWAEENADNVEW.- | 2 | |
22_g_01_itms.08675.08675.2 | 3.5271 | 0.2387 | 100.0% | 1493.0322 | 1491.6028 | 1 | 6.058 | 77.3% | 2 | T.EWAEENADNVEW.- | 2 |
U | YOR383C | 1 | 1 | 18.6% | 204 | 19836 | 4.3 | FIT3 SGDID:S000005910, Chr XV from 1061051-1060437, reverse complement, Verified ORF, "Mannoprotein that is incorporated into the cell wall via a glycosylphosphatidylinositol (GPI) anchor, involved in the retention of siderophore-iron in the cell wall" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13075.13075.3 | 3.4891 | 0.2306 | 98.7% | 3412.3743 | 3408.4897 | 240 | 4.387 | 17.6% | 1 | A.AESSAAETSAAETSAAATTSAAATTSAAETSSAAETSS.A | 3 |
U | YNL225C | 9 | 26 | 17.6% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15241.15241.2 | 4.463 | 0.3188 | 100.0% | 2420.5723 | 2419.208 | 1 | 6.68 | 52.5% | 3 | K.SILPLFVNPEDVINCNFSNAR.D | 2 |
* | 22_g_01_itms.15302.15302.3 | 5.8382 | 0.423 | 100.0% | 2421.6243 | 2419.208 | 1 | 7.27 | 43.8% | 2 | K.SILPLFVNPEDVINCNFSNAR.D | 3 |
* | 22_g_01_itms.15522.15522.2 | 4.4531 | 0.2775 | 100.0% | 2500.6921 | 2499.1743 | 1 | 6.001 | 50.0% | 2 | K.SILPLFVNPEDVINCNFS*NAR.D | 2 |
* | 22_g_01_itms.15549.15549.3 | 4.2536 | 0.2387 | 94.0% | 2501.8145 | 2499.1743 | 18 | 4.815 | 30.0% | 1 | K.SILPLFVNPEDVINCNFS*NAR.D | 3 |
* | 22_g_01_itms.10037.10037.2 | 3.2095 | 0.2759 | 100.0% | 1896.0922 | 1895.871 | 1 | 5.655 | 56.7% | 1 | L.FVNPEDVINCNFSNAR.D | 2 |
* | 22_g_01_itms.11238.11238.3 | 3.3355 | 0.1906 | 98.6% | 2167.1943 | 2164.8916 | 13 | 4.415 | 35.3% | 1 | R.DSYEENKSPSMDQMNYAR.N | 3 |
* | 22_g_01_itms.04784.04784.3 | 3.8144 | 0.2856 | 94.7% | 3046.5544 | 3045.1821 | 3 | 4.848 | 25.0% | 1 | R.ANEQASAQPTDEHTS*PDIS*IEDCNGAK.I | 3 |
* | 22_g_01_itms.08843.08843.2 | 2.2653 | 0.2218 | 97.0% | 1308.9321 | 1307.7034 | 6 | 4.727 | 65.0% | 1 | R.MLENVILGYQK.K | 2 |
* | 22_g_01_itms.30027.30027.3 | 4.8243 | 0.2362 | 100.0% | 2907.6543 | 2904.4558 | 1 | 5.814 | 31.2% | 14 | R.KAELFEIPIGILFFDLYDSEENSSK.L | 3 |
U | Reverse_YFR011C | 1 | 1 | 17.6% | 170 | 18855 | 5.5 | YFR011C SGDID:S000001907, Chr VI from 167251-166739, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39284.39284.3 | 3.1638 | 0.1861 | 98.3% | 3211.0144 | 3206.8113 | 19 | 4.376 | 22.4% | 1 | E.TLKAKISISGNDTKKDSKGKAGGYKELKQL.E | 3 |
U | YAL038W | 6 | 33 | 17.0% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21477.21477.2 | 3.0632 | 0.2043 | 92.6% | 2266.5322 | 2266.1858 | 279 | 4.378 | 34.2% | 1 | R.IIYVDDGVLSFQVLEVVDDK.T | 2 |
* | 22_g_01_itms.10305.10305.2 | 4.0672 | 0.3816 | 100.0% | 1727.4922 | 1724.9071 | 1 | 7.134 | 62.5% | 2 | K.GVNLPGTDVDLPALSEK.D | 2 |
* | 22_g_01_itms.11580.11580.2 | 3.565 | 0.1908 | 98.4% | 1863.0721 | 1860.8762 | 5 | 4.842 | 44.1% | 1 | T.RAEVSDVGNAILDGADCV.M | 2 |
* | 22_g_01_itms.13170.13170.2 | 4.8809 | 0.4079 | 100.0% | 2522.8323 | 2522.1755 | 1 | 7.522 | 45.8% | 1 | R.AEVSDVGNAILDGADCVMLSGETAK.G | 2 |
* | 22_g_01_itms.18577.18577.3 | 5.6015 | 0.3097 | 100.0% | 2570.2144 | 2569.225 | 1 | 7.213 | 47.6% | 27 | R.GVFPFVFEKEPVSDWTDDVEAR.I | 3 |
* | 22_g_01_itms.06605.06605.2 | 2.8039 | 0.3021 | 100.0% | 1519.1522 | 1518.6713 | 2 | 6.184 | 50.0% | 1 | K.EPVSDWTDDVEAR.I | 2 |
U | YPL059W | 1 | 18 | 16.7% | 150 | 16931 | 4.9 | GRX5 SGDID:S000005980, Chr XVI from 444576-445028, Verified ORF, "Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; mitochondrial matrix protein involved in the synthesis/assembly of iron-sulfur centers; monothiol glutaredoxin subfamily member along with Grx3p and Grx4p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20202.20202.3 | 4.8913 | 0.2182 | 99.7% | 2803.0745 | 2800.3376 | 1 | 4.892 | 31.2% | 18 | R.SGELADLLEEAQALVPEEEEETKDR.- | 3 |
U | YLR180W | 3 | 22 | 15.7% | 382 | 41818 | 5.2 | SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18876.18876.3 | 6.1572 | 0.44 | 100.0% | 3603.7144 | 3600.7783 | 1 | 7.122 | 28.8% | 11 | K.DLEDIGAGDQGIMFGYATDETPEGLPLTILLAHK.L | 3 |
22_g_01_itms.07227.07227.2 | 4.2008 | 0.3889 | 100.0% | 1447.4722 | 1444.7549 | 1 | 6.743 | 78.6% | 7 | R.FVIGGPQGDAGLTGR.K | 22 | |
* | 22_g_01_itms.09995.09995.2 | 3.9404 | 0.2059 | 98.4% | 1262.3121 | 1261.6527 | 1 | 4.831 | 85.0% | 4 | K.SDEEIIDIISK.N | 2 |
U | Reverse_YPL229W | 1 | 1 | 15.5% | 206 | 23260 | 6.3 | YPL229W SGDID:S000006150, Chr XVI from 117067-117687, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26205.26205.3 | 3.3892 | 0.174 | 97.7% | 3377.6343 | 3379.5361 | 6 | 4.279 | 22.6% | 1 | P.NFKPRSNFISSASNPPSSSMSGPNSSSQTNQH.Y | 3 |
U | Reverse_YOL109W | 1 | 1 | 15.0% | 113 | 12589 | 5.4 | ZEO1 SGDID:S000005469, Chr XV from 110296-110637, Verified ORF, "Peripheral membrane protein of the plasma membrane that interacts with Mid2p; regulates the cell integrity pathway mediated by Pkc1p and Slt2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34209.34209.3 | 2.3717 | 0.094 | 91.3% | 1963.9143 | 1960.0715 | 262 | 3.851 | 32.8% | 1 | Q.KKTEEVKNAAETKKQEV.G | 3 |
U | YKL159C | 1 | 1 | 14.7% | 211 | 24135 | 5.5 | RCN1 SGDID:S000001642, Chr XI from 154456-153821, reverse complement, Verified ORF, "Protein involved in calcineurin regulation during calcium signaling; has similarity to H. sapiens DSCR1 which is found in the Down Syndrome candidate region" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.45829.45829.3 | 1.7223 | 0.0744 | 90.6% | 3470.5745 | 3473.6582 | 215 | 3.81 | 13.3% | 1 | T.IDRCPTNDGNGQMQLADHVKTAFPPKSIFDT.D | 3 |
U | YLR061W | 1 | 2 | 14.0% | 121 | 13693 | 6.2 | RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08160.08160.2 | 3.9318 | 0.3198 | 100.0% | 2072.132 | 2071.8508 | 1 | 7.018 | 62.5% | 2 | R.LAFYQVTPEEDEEEDEE.- | 2 |
U | YOR261C | 2 | 10 | 13.9% | 338 | 38313 | 5.6 | RPN8 SGDID:S000005787, Chr XV from 816929-815913, reverse complement, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome; has similarity to the human p40 proteasomal subunit and to another S. cerevisiae regulatory subunit, Rpn11p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17825.17825.3 | 5.3533 | 0.313 | 100.0% | 2995.6743 | 2993.4128 | 164 | 5.23 | 26.0% | 8 | K.LQDVFNLLPNLGTPDDDEIDVENHDR.I | 3 |
* | 22_g_01_itms.11133.11133.3 | 3.7461 | 0.252 | 99.7% | 2235.0842 | 2234.0425 | 1 | 4.893 | 38.8% | 2 | K.VSDDSESESGDKEATAPLIQR.K | 3 |
U | YOR369C | 1 | 5 | 13.3% | 143 | 15472 | 4.7 | RPS12 SGDID:S000005896, Chr XV from 1028621-1028190, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to rat ribosomal protein S12" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16436.16436.2 | 4.604 | 0.3053 | 100.0% | 2256.5923 | 2252.9592 | 1 | 6.015 | 55.6% | 5 | K.NWGAETDELSMIMEHFSQQ.- | 2 |
U | YOR083W | 1 | 1 | 13.2% | 295 | 32901 | 6.8 | WHI5 SGDID:S000005609, Chr XV from 479534-480421, Verified ORF, "Protein that regulates the critical cell size required for passage through Start and commitment to cell division; may act upstream of SCB binding factor (SBF) and MCB binding factor (MBF); periodically expressed in G1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18868.18868.3 | 4.222 | 0.3041 | 100.0% | 4292.8145 | 4292.2686 | 272 | 5.577 | 17.1% | 1 | T.LLSTPVRLKNGFGTPS*PPS*PPGITKSITKSRRRPSTTSL.Q | 3 |
U | YDL004W | 1 | 1 | 13.1% | 160 | 17020 | 6.5 | ATP16 SGDID:S000002162, Chr IV from 443026-443508, Verified ORF, "Delta subunit of the central stalk of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08061.08061.2 | 2.6764 | 0.158 | 90.5% | 2111.2522 | 2110.162 | 31 | 4.313 | 35.0% | 1 | S.GSEVTQVNLPAKSGRIGVLAN.H | 2 |
U | YDR502C | 2 | 12 | 12.8% | 384 | 42256 | 5.4 | SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.19603.19603.3 | 4.3684 | 0.2417 | 99.0% | 3577.6143 | 3572.7834 | 2 | 4.558 | 22.7% | 5 | K.SLEDLGAGDQGIMFGYATDETPEGLPLTILLAHK.L | 3 |
22_g_01_itms.07227.07227.2 | 4.2008 | 0.3889 | 100.0% | 1447.4722 | 1444.7549 | 1 | 6.743 | 78.6% | 7 | R.FVIGGPQGDAGLTGR.K | 22 |
U | YLR340W | 1 | 1 | 12.8% | 312 | 33717 | 4.8 | RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14433.14433.3 | 6.5308 | 0.4629 | 100.0% | 4007.6042 | 4000.5754 | 1 | 8.23 | 23.7% | 1 | K.YAAAAPAATSAASGDAAPAEEAAAEEEEES*DDDMGFGLFD.- | 3 |
U | YHR051W | 1 | 1 | 12.8% | 148 | 17342 | 6.0 | COX6 SGDID:S000001093, Chr VIII from 209699-210145, Verified ORF, "Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; expression is regulated by oxygen levels" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11051.11051.2 | 4.394 | 0.4368 | 100.0% | 2150.912 | 2149.1003 | 1 | 6.874 | 50.0% | 1 | R.VLNNCFSYDLVPAPAVIEK.A | 2 |
U | YER095W | 2 | 2 | 12.5% | 400 | 42963 | 4.9 | RAD51 SGDID:S000000897, Chr V from 349976-351178, Verified ORF, "Strand exchange protein, forms a helical filament with DNA that searches for homology; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; homolog of Dmc1p and bacterial RecA protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11819.11819.2 | 2.385 | 0.2139 | 95.4% | 2301.892 | 2300.028 | 30 | 4.522 | 32.5% | 1 | Q.GEMEDEAYDEAALGSFVPIEK.L | 2 |
* | 22_g_01_itms.14085.14085.3 | 3.7655 | 0.2217 | 98.7% | 3298.0745 | 3296.425 | 8 | 4.398 | 22.3% | 1 | K.VVDSPCLPEAECVFAIYEDGVGDPREEDE.- | 3 |
U | YAL044C | 1 | 1 | 12.4% | 170 | 18795 | 4.7 | GCV3 SGDID:S000000042, Chr I from 58463-57951, reverse complement, Verified ORF, "H subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12854.12854.2 | 2.8892 | 0.2398 | 92.2% | 2354.2922 | 2351.144 | 9 | 4.374 | 35.0% | 1 | K.LGEGVNVEQVEGLMSLEQYEK.T | 2 |
U | YLR437C | 1 | 1 | 12.0% | 133 | 15165 | 7.4 | YLR437C SGDID:S000004429, Chr XII from 1012019-1011618, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12355.12355.2 | 1.9083 | 0.2093 | 95.5% | 1706.0922 | 1705.8397 | 9 | 4.487 | 40.0% | 1 | T.PSTSDASLQPGVIRDY.S | 2 |
U | YDR418W | 1 | 4 | 11.5% | 165 | 17823 | 9.4 | RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
U | YEL054C | 1 | 4 | 11.5% | 165 | 17823 | 9.4 | RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.11397.11397.2 | 3.8724 | 0.2495 | 99.3% | 2076.3123 | 2074.0093 | 2 | 4.944 | 47.2% | 4 | K.NPHDIIEGINAGEIEIPEN.- | 2 |
U | Reverse_YAR002C-A | 1 | 1 | 11.4% | 219 | 24723 | 7.4 | ERP1 SGDID:S000002129, Chr I from 154726-154067, reverse complement, Verified ORF, "Protein that forms a heterotrimeric complex with Erp2p, Emp24p, and Erv25p; member, along with Emp24p and Erv25p, of the p24 family involved in ER to Golgi transport and localized to COPII-coated vesicles" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.36952.36952.2 | 1.7514 | 0.1601 | 93.1% | 2567.2122 | 2570.2124 | 14 | 4.4 | 31.2% | 1 | E.GSDSALFTLDGSASGKQHVVLHNDD.F | 2 |
U | YOR117W | 2 | 3 | 11.1% | 434 | 48256 | 5.1 | RPT5 SGDID:S000005643, Chr XV from 545029-546333, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13189.13189.2 | 3.0457 | 0.2336 | 95.4% | 1871.3722 | 1870.9075 | 19 | 4.511 | 43.3% | 2 | K.DSYLILDTLPSEFDSR.V | 2 |
* | 22_g_01_itms.21575.21575.3 | 4.2294 | 0.0122 | 92.2% | 3494.2144 | 3489.755 | 63 | 3.909 | 21.0% | 1 | I.NWQELARSTDEFNGAQLKAVTVEAGMIALRNG.Q | 3 |
U | YDR356W | 10 | 28 | 11.0% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09235.09235.2 | 2.8455 | 0.2928 | 95.0% | 1749.8722 | 1749.7584 | 254 | 5.212 | 39.3% | 1 | R.SIDDTIDS*TRLFSEA.S | 2 |
* | 22_g_01_itms.10850.10850.2 | 4.5036 | 0.3785 | 100.0% | 1861.1322 | 1859.8704 | 1 | 6.822 | 70.0% | 2 | R.LFSEASQFDDSFPEIK.A | 2 |
* | 22_g_01_itms.11663.11663.2 | 4.151 | 0.3357 | 100.0% | 1940.5521 | 1939.8367 | 1 | 6.271 | 60.0% | 1 | R.LFSEAS*QFDDSFPEIK.A | 2 |
* | 22_g_01_itms.10793.10793.2 | 4.2933 | 0.2405 | 94.7% | 1943.3322 | 1939.8367 | 1 | 5.318 | 63.3% | 4 | R.LFSEASQFDDS*FPEIK.A | 2 |
* | 22_g_01_itms.15788.15788.3 | 4.6739 | 0.163 | 98.3% | 2401.6443 | 2399.0737 | 2 | 4.34 | 38.2% | 5 | K.EKNDTLNNYDTLEEETDDLK.N | 3 |
* | 22_g_01_itms.08657.08657.2 | 5.4847 | 0.3799 | 100.0% | 2143.2522 | 2141.9363 | 1 | 7.155 | 67.6% | 7 | K.NDTLNNYDTLEEETDDLK.N | 2 |
* | 22_g_01_itms.07325.07325.2 | 5.67 | 0.3763 | 100.0% | 1832.2122 | 1830.9086 | 1 | 6.945 | 73.3% | 4 | K.DQVLELENNSDVQSLK.L | 2 |
* | 22_g_01_itms.06959.06959.2 | 3.1516 | 0.1659 | 95.8% | 1404.1322 | 1403.7018 | 3 | 4.577 | 68.2% | 1 | K.DEQISDLTQNLK.L | 2 |
* | 22_g_01_itms.10251.10251.2 | 4.3178 | 0.418 | 100.0% | 1696.6522 | 1695.819 | 1 | 7.539 | 61.5% | 1 | K.NYLSEITSLQEENR.R | 2 |
* | 22_g_01_itms.11723.11723.2 | 4.5529 | 0.3903 | 100.0% | 1920.5322 | 1919.8696 | 1 | 7.071 | 80.0% | 2 | K.DNDSTMQLNDIISYYK.L | 2 |
U | YBR287W | 2 | 2 | 11.0% | 427 | 47506 | 4.9 | YBR287W SGDID:S000000491, Chr II from 776567-777850, Uncharacterized ORF, "Protein of unknown function; mutation results in a zinc sensitive phenotype" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10097.10097.3 | 3.8846 | 0.2193 | 99.7% | 3156.5942 | 3156.4092 | 2 | 4.987 | 25.0% | 1 | R.TPNIDNEELVNEEQEEQELLEEENNR.M | 3 |
* | 22_g_01_itms.22609.22609.2 | 2.323 | 0.1399 | 95.4% | 2263.0122 | 2259.3005 | 55 | 4.504 | 30.0% | 1 | I.AIAVKYINVSILDDPIFLVVG.F | 2 |
U | YLR216C | 2 | 15 | 10.2% | 371 | 42072 | 6.2 | CPR6 SGDID:S000004206, Chr XII from 573213-572098, reverse complement, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds to Hsp82p and contributes to chaperone activity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10847.10847.3 | 4.9796 | 0.1826 | 99.4% | 3866.5444 | 3859.6655 | 1 | 4.815 | 31.8% | 2 | K.IDDCGVLPDDYQVPENAEATPTDEYGDNYEDVLK.Q | 3 |
* | 22_g_01_itms.12527.12527.3 | 5.6166 | 0.3579 | 100.0% | 4363.344 | 4359.8887 | 1 | 6.756 | 26.4% | 13 | K.IDDCGVLPDDYQVPENAEATPTDEYGDNYEDVLKQDEK.V | 3 |
U | YNR054C | 1 | 1 | 10.1% | 316 | 36408 | 8.0 | ESF2 SGDID:S000005337, Chr XIV from 724307-723357, reverse complement, Verified ORF, "Essential nucleolar protein involved in pre-18S rRNA processing; component of the small subunit (SSU) processome; has sequence similarity to mABT1, a mouse transcription activator" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11793.11793.3 | 2.8365 | 0.0522 | 90.7% | 3764.1243 | 3758.84 | 417 | 3.807 | 19.4% | 1 | D.FEDFSSDEETDQHNVLIQTKKKISSKDDIFSK.K | 3 |
U | Reverse_YMR263W | 1 | 1 | 10.0% | 201 | 23026 | 9.7 | SAP30 SGDID:S000004876, Chr XIII from 794918-795523, Verified ORF, "Subunit of a histone deacetylase complex, along with Rpd3p and Sin3p, that is involved in silencing at telomeres, rDNA, and silent mating-type loci" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23224.23224.2 | 2.2489 | 0.2119 | 96.4% | 2009.6322 | 2009.9026 | 56 | 4.691 | 31.6% | 1 | C.SGNNNSAYGGGQTPRGRSET.E | 2 |
U | YJR053W | 3 | 5 | 9.9% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10406.10406.2 | 3.9608 | 0.2608 | 96.9% | 2457.172 | 2456.1233 | 1 | 5.527 | 40.0% | 2 | L.TLNGLDEPETS*FEELNTTLPR.F | 2 |
* | 22_g_01_itms.12462.12462.3 | 6.5513 | 0.4498 | 100.0% | 3184.0444 | 3178.2708 | 1 | 7.353 | 32.0% | 2 | K.QADDDQDMEVDQDDEFLNDFQEFQNK.K | 3 |
* | 22_g_01_itms.08964.08964.2 | 2.6814 | 0.212 | 96.0% | 1256.4722 | 1255.5594 | 1 | 4.628 | 77.8% | 1 | K.NDIFAEEFDR.K | 2 |
U | YHL034C | 2 | 53 | 9.9% | 294 | 32990 | 5.7 | SBP1 SGDID:S000001026, Chr VIII from 34075-33191, reverse complement, Verified ORF, "Nucleolar single-strand nucleic acid binding protein; associates with small nuclear RNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13310.13310.3 | 6.134 | 0.3779 | 100.0% | 3350.9043 | 3344.5505 | 1 | 6.292 | 30.4% | 31 | R.ELTVDVAVIRPENDEEEIEQETGSEEKQE.- | 3 |
* | 22_g_01_itms.13381.13381.3 | 4.5071 | 0.0563 | 99.7% | 2618.1543 | 2617.1753 | 1 | 5.068 | 38.1% | 22 | A.VIRPENDEEEIEQETGSEEKQE.- | 3 |
U | YKL056C | 1 | 1 | 9.6% | 167 | 18741 | 4.6 | YKL056C SGDID:S000001539, Chr XI from 334559-334056, reverse complement, Verified ORF, "Protein of unknown function; putative ribosomal protein; homolog of translationally controlled tumor protein; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YKL056C is not an essential gene" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10986.10986.2 | 4.5829 | 0.4293 | 100.0% | 1817.3922 | 1815.8289 | 1 | 7.028 | 60.0% | 1 | K.DIFSNDELLSDAYDAK.L | 2 |
U | YMR244W | 1 | 1 | 9.3% | 355 | 37383 | 5.3 | YMR244W SGDID:S000004858, Chr XIII from 757249-758316, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08142.08142.3 | 2.7535 | 0.1531 | 90.2% | 3107.2144 | 3111.4038 | 8 | 3.799 | 20.3% | 1 | S.IDPSSNGVNEVTSSGGGSSGAGGGNFCVVTARN.G | 3 |
U | Reverse_YDR530C | 1 | 1 | 9.2% | 325 | 36841 | 5.5 | APA2 SGDID:S000002938, Chr IV from 1497758-1496781, reverse complement, Verified ORF, "Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase II (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34920.34920.3 | 3.1687 | 0.171 | 95.6% | 3650.0942 | 3656.9116 | 69 | 4.151 | 23.3% | 1 | C.IWKKTLLVNYSKTLEPSENTWDQFFTLARQ.M | 3 |
U | YJL034W | 6 | 21 | 9.1% | 682 | 74468 | 4.9 | KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.14409.14409.2 | 3.0215 | 0.1122 | 97.0% | 2025.5922 | 2023.0236 | 16 | 4.724 | 41.2% | 2 | R.IEIDSFVDGIDLSETLTR.A | 2 | |
22_g_01_itms.07314.07314.2 | 2.6626 | 0.2655 | 98.4% | 1347.0721 | 1345.6963 | 1 | 4.834 | 66.7% | 1 | K.DVDDIVLVGGSTR.I | 2 | |
22_g_01_itms.16739.16739.3 | 4.833 | 0.2418 | 99.7% | 3401.9644 | 3398.2893 | 5 | 4.886 | 23.3% | 8 | S.KLYGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 3 | |
22_g_01_itms.09791.09791.3 | 7.4408 | 0.5142 | 100.0% | 3271.3442 | 3270.1943 | 1 | 8.913 | 34.5% | 5 | K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 3 | |
22_g_01_itms.09648.09648.2 | 4.9448 | 0.4616 | 100.0% | 3272.392 | 3270.1943 | 1 | 9.284 | 34.5% | 3 | K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 2 | |
22_g_01_itms.09405.09405.3 | 4.2404 | 0.1346 | 99.0% | 3160.1042 | 3157.1104 | 1 | 4.577 | 26.8% | 2 | L.YGGADGSGAADYDDEDEDDDGDYFEHDEL.- | 3 |
U | YBR162C | 1 | 1 | 9.0% | 455 | 47994 | 4.7 | TOS1 SGDID:S000000366, Chr II from 564565-563198, reverse complement, Uncharacterized ORF, "Covalently-bound cell wall protein of unknown function; identified as a cell cycle regulated SBF target gene; deletion mutants are highly resistant to treatment with beta-1,3-glucanase; has sequence similarity to YJL171C" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29172.29172.3 | 3.0377 | 0.032 | 92.3% | 4088.6643 | 4086.9478 | 6 | 3.905 | 17.5% | 1 | N.GQTVTADSTNTVVGPAVPSSYTKDSTVLSSSAQAVETSESQ.S | 3 |
U | Reverse_YLR312C | 1 | 1 | 9.0% | 398 | 46628 | 9.7 | YLR312C SGDID:S000004303, Chr XII from 758835-757639, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18888.18888.3 | 4.7716 | 0.2107 | 90.6% | 3608.5444 | 3603.6414 | 3 | 4.75 | 24.3% | 1 | K.SGEMSPLVTGGVNSGS*LTDFSESITPVGTQDINVGA.N | 3 |
U | YCL050C | 1 | 17 | 9.0% | 321 | 36493 | 5.0 | APA1 SGDID:S000000555, Chr III from 38801-37836, reverse complement, Verified ORF, "Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15419.15419.3 | 4.7316 | 0.3731 | 100.0% | 3055.0745 | 3053.4592 | 1 | 6.602 | 28.6% | 17 | R.GQTPEGEDPLGKPEEELTVIPEFGGADNK.A | 3 |
U | YBL027W | 1 | 1 | 9.0% | 189 | 21704 | 11.4 | RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" |
U | YBR084C-A | 1 | 1 | 9.0% | 189 | 21704 | 11.4 | RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.07953.07953.2 | 2.8068 | 0.3006 | 100.0% | 1932.5721 | 1929.9307 | 4 | 5.493 | 43.8% | 1 | K.VWLDPNETSEIAQANSR.N | 2 |
U | Reverse_YDR044W | 1 | 1 | 8.8% | 328 | 37712 | 6.8 | HEM13 SGDID:S000002451, Chr IV from 546639-547625, Verified ORF, "Coproporphyrinogen III oxidase, an oxygen requiring enzyme that catalyzes the sixth step in the heme biosynthetic pathway; localizes to the mitochondrial inner membrane; transcription is repressed by oxygen and heme (via Rox1p and Hap1p)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24692.24692.3 | 4.1139 | 0.1692 | 96.8% | 3405.8643 | 3399.6133 | 71 | 4.219 | 20.5% | 1 | A.TDHKDLADKHLQHFLQGDEEYLYSPTLDA.G | 3 |
U | YBR118W | 2 | 2 | 8.7% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
U | YPR080W | 2 | 2 | 8.7% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.28984.28984.3 | 3.2343 | 0.0855 | 93.2% | 3120.3542 | 3120.5464 | 265 | 3.963 | 19.6% | 1 | K.KVGYNPKTVPFVPISGWNGDNMIEATTNA.P | 3 | |
22_g_01_itms.07063.07063.2 | 2.5411 | 0.2562 | 99.3% | 1267.6322 | 1265.6166 | 5 | 5.133 | 65.0% | 1 | V.EAFSEYPPLGR.F | 2 |
U | YOR051C | 2 | 6 | 8.7% | 412 | 47352 | 4.8 | YOR051C SGDID:S000005577, Chr XV from 426085-424847, reverse complement, Uncharacterized ORF, "Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26800.26800.3 | 4.7384 | 0.3546 | 100.0% | 4087.5244 | 4081.9043 | 1 | 6.653 | 22.1% | 5 | K.AKLEDDPDTWVQVAEAYIDLGNLLDNESAEQEEAYK.T | 3 |
* | 22_g_01_itms.20830.20830.3 | 6.3746 | 0.3483 | 100.0% | 3889.7644 | 3882.7722 | 1 | 7.019 | 27.3% | 1 | K.LEDDPDTWVQVAEAYIDLGNLLDNESAEQEEAYK.T | 3 |
U | YBL039C | 2 | 17 | 8.6% | 579 | 64710 | 6.0 | URA7 SGDID:S000000135, Chr II from 145731-143992, reverse complement, Verified ORF, "Major CTP synthase isozyme (see also URA8), catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.17465.17465.3 | 5.8605 | 0.3524 | 100.0% | 4263.6543 | 4258.853 | 1 | 6.316 | 23.0% | 16 | K.IDPYMNIDAGTMSPLEHGECFVLDDGGETDLDLGNYER.Y | 3 | |
* | 22_g_01_itms.09530.09530.2 | 3.3351 | 0.2197 | 100.0% | 1447.4321 | 1446.6542 | 1 | 5.32 | 81.8% | 1 | K.YDLEAGENKFNF.- | 2 |
U | YNL113W | 1 | 2 | 8.5% | 142 | 16151 | 4.4 | RPC19 SGDID:S000005057, Chr XIV from 412773-413201, Verified ORF, "RNA polymerase subunit, common to RNA polymerases I and III" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10049.10049.2 | 3.5162 | 0.3259 | 100.0% | 1424.9722 | 1423.6449 | 1 | 5.836 | 72.7% | 2 | K.DLMDLCDVVESK.F | 2 |
U | YJR064W | 2 | 3 | 8.4% | 562 | 61914 | 5.5 | CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25755.25755.3 | 4.5026 | 0.2766 | 99.7% | 3101.9944 | 3098.6108 | 2 | 5.001 | 24.1% | 2 | K.SQDDEIGDGTTGVVVLASALLDQALELIQK.G | 3 |
* | 22_g_01_itms.07615.07615.2 | 2.5182 | 0.3176 | 100.0% | 2014.6921 | 2013.8711 | 4 | 5.215 | 40.6% | 1 | K.LEETCDDISASNDELFR.D | 2 |
U | Reverse_YDR190C | 1 | 1 | 8.2% | 463 | 50453 | 5.9 | RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10646.10646.3 | 3.697 | 0.1761 | 99.2% | 3853.1343 | 3857.041 | 200 | 4.743 | 18.2% | 1 | V.EVSYLESGVLPCFPVKPGLEQSIALALATKGTSPGGAL.L | 3 |
U | Reverse_YLR449W | 1 | 1 | 8.2% | 392 | 43903 | 4.7 | FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27805.27805.3 | 3.6148 | 0.2718 | 98.8% | 3530.3943 | 3526.991 | 1 | 4.539 | 21.8% | 1 | D.FVKGNKLKGVYRMGVRTGKKAHPGKGTVRDEI.I | 3 |
U | YKL040C | 2 | 4 | 8.2% | 256 | 29174 | 5.0 | NFU1 SGDID:S000001523, Chr XI from 361471-360701, reverse complement, Verified ORF, "Protein involved in iron metabolism in mitochondria; similar to NifU, which is a protein required for the maturation of the Fe/S clusters of nitrogenase in nitrogen-fixing bacteria" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20149.20149.3 | 4.0498 | 0.1994 | 99.7% | 2539.3145 | 2538.1987 | 1 | 4.992 | 36.2% | 1 | K.FELTEEDEEVSELIEELIDTR.I | 3 |
* | 22_g_01_itms.20238.20238.2 | 5.4913 | 0.326 | 100.0% | 2542.7922 | 2538.1987 | 1 | 6.653 | 60.0% | 3 | K.FELTEEDEEVSELIEELIDTR.I | 2 |
U | Reverse_YOR136W | 1 | 1 | 8.1% | 369 | 39739 | 8.7 | IDH2 SGDID:S000005662, Chr XV from 580250-581359, Verified ORF, "Subunit of mitochondrial NAD(+)-dependent isocitrate dehydrogenase, which catalyzes the oxidation of isocitrate to alpha-ketoglutarate in the TCA cycle" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34929.34929.3 | 3.1602 | 0.0949 | 92.5% | 3378.8943 | 3380.7366 | 307 | 3.917 | 19.8% | 1 | T.YASPNTVVKLVSNDILETELTLDPYEKSLE.K | 3 |
U | Reverse_YHR187W | 1 | 1 | 8.1% | 309 | 35220 | 4.8 | IKI1 SGDID:S000001230, Chr VIII from 480990-481919, Verified ORF, "Subunit of the Elp4p-Iki1p-Elp6p-subcomplex of RNA polymerase II elongator complex, which is a histone acetyltransferase; iki1 mutations confer resistance to the K. lactis toxin zymocin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24322.24322.2 | 2.0802 | 0.1792 | 91.4% | 2701.172 | 2704.5037 | 85 | 4.332 | 22.9% | 1 | E.LFPLAVQDKALKQKNSTGLNFTTLG.Q | 2 |
U | YLR172C | 1 | 1 | 8.0% | 300 | 33847 | 4.9 | DPH5 SGDID:S000004162, Chr XII from 502164-501262, reverse complement, Verified ORF, "Methyltransferase required for synthesis of diphthamide, which is a modified histidine residue of translation elongation factor 2 (Eft1p or Eft2p); not essential for viability; GFP-Dph5p fusion protein localizes to the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10807.10807.2 | 2.5267 | 0.217 | 95.5% | 2741.872 | 2738.1746 | 6 | 4.49 | 30.4% | 1 | K.DVANDQEYFKPAAWVPPTEDDSDE.- | 2 |
U | YDR533C | 1 | 1 | 8.0% | 237 | 25670 | 5.5 | HSP31 SGDID:S000002941, Chr IV from 1502150-1501437, reverse complement, Verified ORF, "Possible chaperone and cysteine protease with similarity to E. coli Hsp31 and S. cerevisiae Hsp32p, Hsp33p, and Sno4p; member of the DJ-1/ThiJ/PfpI superfamily, which includes human DJ-1 involved in Parkinson's disease; exists as a dimer" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16346.16346.2 | 2.2768 | 0.2416 | 96.9% | 2001.9922 | 1998.0482 | 15 | 4.747 | 33.3% | 1 | G.VVAAVCHGPAIFDGLTDKK.T | 2 |
U | YKL054C | 2 | 19 | 7.9% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12914.12914.3 | 5.3712 | 0.3576 | 100.0% | 2839.8843 | 2837.221 | 1 | 6.569 | 35.4% | 12 | K.HDVPQDSNDNNNEELEAQGQQAQEK.N | 3 |
* | 22_g_01_itms.14011.14011.3 | 4.6478 | 0.3005 | 100.0% | 3821.0645 | 3814.7517 | 7 | 5.65 | 20.3% | 7 | K.EQVKEEEQTAEELEQEQDNVAAPEEEVTVVEEK.V | 3 |
U | YMR186W | 3 | 3 | 7.9% | 705 | 80900 | 4.8 | HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11763.11763.2 | 5.2191 | 0.3995 | 100.0% | 1998.2722 | 1997.9344 | 1 | 7.93 | 71.9% | 1 | K.LIEAFNEIAEDSEQFDK.F | 2 |
* | 22_g_01_itms.13098.13098.3 | 3.0143 | 0.0857 | 92.9% | 4221.1143 | 4216.8867 | 2 | 3.93 | 18.4% | 1 | R.LISLGLNIDEDEETETAPEASTEAPVEEVPADTEMEEVD.- | 3 |
* | 22_g_01_itms.09717.09717.3 | 3.9508 | 0.2686 | 100.0% | 3795.0544 | 3790.6023 | 6 | 5.768 | 18.4% | 1 | L.GLNIDEDEETETAPEASTEAPVEEVPADTEMEEVD.- | 3 |
U | YMR268C | 1 | 1 | 7.9% | 444 | 50849 | 9.3 | PRP24 SGDID:S000004881, Chr XIII from 804221-802887, reverse complement, Verified ORF, "Splicing factor that reanneals U4 and U6 snRNPs during spliceosome recycling" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23680.23680.3 | 3.3015 | 0.1117 | 91.7% | 4017.7144 | 4023.897 | 222 | 3.863 | 17.6% | 1 | L.LDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCA.F | 3 |
U | YNL330C | 1 | 1 | 7.9% | 433 | 48904 | 5.5 | RPD3 SGDID:S000005274, Chr XIV from 19302-18001, reverse complement, Verified ORF, "Histone deacetylase; regulates transcription and silencing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21105.21105.3 | 3.1504 | 0.1386 | 98.7% | 3688.7043 | 3684.6304 | 180 | 4.404 | 18.9% | 1 | Q.PSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNY.V | 3 |
U | Reverse_YKR053C | 1 | 1 | 7.9% | 404 | 46488 | 7.7 | YSR3 SGDID:S000001761, Chr XI from 534923-533709, reverse complement, Verified ORF, "Dihydrosphingosine 1-phosphate phosphatase, membrane protein involved in sphingolipid metabolism; has similarity to Lcb3p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25593.25593.3 | 3.3248 | 0.2139 | 91.6% | 3733.3743 | 3728.7034 | 24 | 3.859 | 21.8% | 1 | Y.RETLWDSCDLGSVVGIFAVSDEFCPCEDIPRV.H | 3 |
U | YDR385W | 4 | 8 | 7.8% | 842 | 93289 | 6.3 | EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
U | YOR133W | 4 | 8 | 7.8% | 842 | 93289 | 6.3 | EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.06822.06822.2 | 5.2609 | 0.4309 | 100.0% | 1980.0122 | 1977.9227 | 1 | 7.48 | 73.5% | 2 | R.AEQLYEGPADDANCIAIK.N | 2 | |
22_g_01_itms.03073.03073.2 | 4.6191 | 0.4455 | 100.0% | 1496.4321 | 1495.7128 | 1 | 7.692 | 76.9% | 2 | R.ETVESESSQTALSK.S | 2 | |
22_g_01_itms.13862.13862.2 | 3.6411 | 0.107 | 96.4% | 2180.632 | 2179.1248 | 14 | 4.676 | 42.1% | 1 | K.AEPIDEEVSLAIENGIINPR.D | 2 | |
22_g_01_itms.08473.08473.2 | 4.5948 | 0.3859 | 100.0% | 1628.1322 | 1627.7063 | 1 | 8.171 | 88.5% | 3 | R.IMADDYGWDVTDAR.K | 2 |
U | YGR234W | 1 | 1 | 7.8% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25035.25035.3 | 3.8424 | 0.2562 | 98.3% | 3349.7644 | 3347.705 | 14 | 4.337 | 23.3% | 1 | K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 3 |
U | Reverse_YFR004W | 1 | 1 | 7.8% | 306 | 34398 | 6.2 | RPN11 SGDID:S000001900, Chr VI from 153388-154308, Verified ORF, "Metalloprotease subunit of the 19S regulatory particle of the 26S proteasome lid; couples the deubiquitination and degradation of proteasome substrates" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32305.32305.3 | 3.3009 | 0.1784 | 97.4% | 2669.2744 | 2671.3625 | 10 | 5.028 | 28.3% | 1 | R.FADIVVKGKVS*QIPDVVVAVARS*N.L | 3 |
U | YPR108W | 2 | 24 | 7.7% | 429 | 48959 | 5.2 | RPN7 SGDID:S000006312, Chr XVI from 742452-743741, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome, similar to another S. cerevisiae regulatory subunit, Rpn5p, as well as to mammalian proteasome subunits" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17201.17201.3 | 5.5509 | 0.2528 | 100.0% | 3228.7744 | 3226.4705 | 1 | 5.608 | 27.8% | 2 | K.LEEDDEGELEQAQAWINLGEYYAQIGDK.D | 3 |
* | 22_g_01_itms.18239.18239.3 | 6.0973 | 0.4024 | 100.0% | 3785.5745 | 3783.7148 | 1 | 7.216 | 31.2% | 22 | K.LEEDDEGELEQAQAWINLGEYYAQIGDKDNAEK.T | 3 |
U | Reverse_YPR023C | 1 | 1 | 7.7% | 401 | 45203 | 8.3 | EAF3 SGDID:S000006227, Chr XVI from 610028-608823, reverse complement, Verified ORF, "Esa1p-associated factor, nonessential component of the NuA4 acetyltransferase complex, homologous to Drosophila dosage compensation protein MSL3" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35443.35443.3 | 2.4428 | 0.1791 | 94.1% | 3770.2144 | 3768.8916 | 296 | 4.057 | 20.0% | 1 | Q.LRELRYLLMNGLCKDFYLKLGACYESLQSQS.G | 3 |
U | YCR012W | 2 | 2 | 7.7% | 416 | 44738 | 7.6 | PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10790.10790.2 | 3.6051 | 0.1432 | 95.8% | 1963.3722 | 1962.9482 | 46 | 4.564 | 44.1% | 1 | K.DVTFLNDCVGPEVEAAVK.A | 2 |
* | 22_g_01_itms.08489.08489.2 | 4.1591 | 0.3041 | 100.0% | 1579.7122 | 1579.7855 | 1 | 7.181 | 69.2% | 1 | K.VLENTEIGDSIFDK.A | 2 |
U | YKL193C | 1 | 1 | 7.7% | 338 | 38887 | 5.5 | SDS22 SGDID:S000001676, Chr XI from 79887-78871, reverse complement, Verified ORF, "Conserved nuclear regulatory subunit of Glc7p type 1 protein serine-threonine phosphatase (PP1), functions positively with Glc7p to promote dephosphorylation of nuclear substrates required for chromosome transmission during mitosis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09539.09539.3 | 2.8881 | 0.1446 | 90.8% | 2937.5344 | 2940.4744 | 130 | 3.835 | 23.0% | 1 | T.DIWASFNKIDQSFESLGENLSALSRL.E | 3 |
U | Reverse_YMR081C | 1 | 1 | 7.7% | 338 | 37110 | 8.8 | ISF1 SGDID:S000004686, Chr XIII from 431094-430078, reverse complement, Verified ORF, "Serine-rich, hydrophilic protein with similarity to Mbr1p; overexpression suppresses growth defects of hap2, hap3, and hap4 mutants; expression is under glucose control; cotranscribed with NAM7 in a cyp1 mutant" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14741.14741.3 | 3.109 | 0.2212 | 92.0% | 2821.2244 | 2822.296 | 236 | 4.788 | 23.0% | 1 | S.SAVSTNLSSNSPSKVLS*NSYSNNRTQ.L | 3 |
U | Reverse_YNL283C | 1 | 1 | 7.6% | 503 | 52292 | 7.0 | WSC2 SGDID:S000005227, Chr XIV from 106695-105184, reverse complement, Verified ORF, "Partially redundant sensor-transducer of the stress-activated PKC1-MPK1 signaling pathway involved in maintenance of cell wall integrity and recovery from heat shock; secretory pathway Wsc2p is required for the arrest of secretion response" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.28907.28907.3 | 3.2959 | 0.1947 | 95.5% | 3842.9343 | 3837.876 | 265 | 4.904 | 16.9% | 1 | A.GGSLGKSKSS*SSKGNLLSSTSSSTSSVTAYVSTRTTFI.T | 3 |
U | YGR254W | 1 | 1 | 7.6% | 437 | 46816 | 6.6 | ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" |
U | YHR174W | 1 | 1 | 7.6% | 437 | 46914 | 6.0 | ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.21007.21007.3 | 4.6397 | 0.3464 | 100.0% | 3258.2344 | 3257.6177 | 1 | 6.03 | 26.6% | 1 | R.YGASAGNVGDEGGVAPNIQTAEEALDLIVDAIK.A | 3 |
U | Reverse_YER039C | 1 | 1 | 7.6% | 249 | 27688 | 8.5 | HVG1 SGDID:S000000841, Chr V from 229204-228455, reverse complement, Verified ORF, "Protein of unknown function, has homology to Vrg4p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08667.08667.3 | 2.9513 | 0.0863 | 93.0% | 2267.5745 | 2266.2197 | 9 | 3.957 | 31.9% | 1 | S.LNKTSWDEMIFSFVLLLPL.A | 3 |
U | YCL043C | 4 | 16 | 7.5% | 522 | 58227 | 4.5 | PDI1 SGDID:S000000548, Chr III from 50221-48653, reverse complement, Verified ORF, "Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13482.13482.2 | 4.4146 | 0.4101 | 100.0% | 1940.8722 | 1940.913 | 1 | 7.895 | 59.4% | 3 | K.YGLPQLSEEAFDELSDK.I | 2 |
* | 22_g_01_itms.10763.10763.3 | 3.8473 | 0.305 | 100.0% | 2342.5444 | 2341.9795 | 1 | 6.461 | 39.3% | 2 | K.AAEEADADAELADEEDAIHDEL.- | 3 |
* | 22_g_01_itms.10733.10733.2 | 6.5992 | 0.4382 | 100.0% | 2346.5322 | 2341.9795 | 1 | 8.499 | 64.3% | 9 | K.AAEEADADAELADEEDAIHDEL.- | 2 |
* | 22_g_01_itms.09912.09912.2 | 3.7012 | 0.3831 | 100.0% | 1871.2522 | 1870.7831 | 1 | 6.325 | 53.1% | 2 | A.DADAELADEEDAIHDEL.- | 2 |
U | YLR457C | 2 | 4 | 7.5% | 319 | 37354 | 10.2 | NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09291.09291.2 | 3.2457 | 0.2822 | 100.0% | 2805.1921 | 2804.2424 | 1 | 6.231 | 37.0% | 2 | R.DGNIPEMQPLQENISPACPT*PPYR.S | 2 |
* | 22_g_01_itms.09335.09335.3 | 5.8758 | 0.3333 | 100.0% | 2806.8245 | 2804.2424 | 2 | 5.994 | 40.2% | 2 | R.DGNIPEMQPLQENISPACPT*PPYR.S | 3 |
U | YMR169C | 1 | 1 | 7.3% | 506 | 55385 | 5.7 | ALD3 SGDID:S000004779, Chr XIII from 600871-599351, reverse complement, Verified ORF, "Cytoplasmic aldehyde dehydrogenase, involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose" |
U | YMR170C | 1 | 1 | 7.3% | 506 | 55188 | 5.6 | ALD2 SGDID:S000004780, Chr XIII from 603081-601561, reverse complement, Verified ORF, "Cytoplasmic aldehyde dehydrogenase, involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.25897.25897.3 | 3.09 | 0.1564 | 98.6% | 4054.5244 | 4053.0684 | 2 | 4.464 | 20.1% | 1 | I.FGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVK.K | 3 |
U | YJL108C | 1 | 1 | 7.3% | 383 | 41488 | 8.0 | PRM10 SGDID:S000003644, Chr X from 218773-217622, reverse complement, Verified ORF, "Pheromone-regulated protein, predicted to have 5 transmembrane segments" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09421.09421.3 | 2.9954 | 0.2021 | 94.6% | 2833.1943 | 2829.4746 | 351 | 4.084 | 22.2% | 1 | I.FVQVPSGIASQNSLLSGLQSANTIVNAN.E | 3 |
U | YDL211C | 1 | 1 | 7.3% | 372 | 40752 | 5.5 | YDL211C SGDID:S000002370, Chr IV from 80413-79295, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16160.16160.3 | 2.8996 | 0.0644 | 93.3% | 2788.5244 | 2785.6455 | 56 | 3.986 | 23.1% | 1 | A.NNRRTGVIVGSTVGVVIGVVIVIFIGF.I | 3 |
U | YPL262W | 1 | 1 | 7.2% | 488 | 53152 | 8.2 | FUM1 SGDID:S000006183, Chr XVI from 47336-48802, Verified ORF, "Fumarase, converts fumaric acid to L-malic acid in the TCA cycle; cytosolic and mitochondrial localization determined by the N-terminal mitochondrial targeting sequence and protein conformation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33657.33657.3 | 2.919 | 0.1615 | 95.1% | 3612.4443 | 3618.9746 | 135 | 4.13 | 19.1% | 1 | S.LKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKE.T | 3 |
U | YNL178W | 1 | 4 | 7.1% | 240 | 26503 | 9.4 | RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.05349.05349.2 | 3.8893 | 0.3271 | 100.0% | 1906.5922 | 1904.8514 | 1 | 5.947 | 65.6% | 4 | K.DYRPAEETEAQAEPVEA.- | 2 |
U | YFL010C | 1 | 1 | 7.1% | 211 | 22655 | 4.5 | WWM1 SGDID:S000001884, Chr VI from 115737-115102, reverse complement, Verified ORF, "WW domain containing protein of unknown function; binds to Mca1p, a caspase-related protease that regulates H2O2-induced apoptosis; overexpression causes Gi phase growth arrest and clonal death that is suppressed by overexpression of MCA1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32666.32666.3 | 2.8974 | 0.259 | 100.0% | 1560.9543 | 1563.6481 | 16 | 5.476 | 39.3% | 1 | Q.AYYGTAPSTSKGS*GH.G | 3 |
U | YHR075C | 1 | 1 | 7.0% | 400 | 44888 | 7.1 | PPE1 SGDID:S000001117, Chr VIII from 249643-248441, reverse complement, Verified ORF, "Protein with carboxyl methyl esterase activity that may have a role in demethylation of the phosphoprotein phosphatase catalytic subunit; also identified as a small subunit mitochondrial ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.37544.37544.3 | 2.4073 | 0.0677 | 96.3% | 3030.1743 | 3034.6829 | 20 | 4.178 | 22.2% | 1 | T.DLSHSFVGLPVSKLLILAGNENLDKELI.V | 3 |
U | YDL126C | 3 | 24 | 6.9% | 835 | 91996 | 4.9 | CDC48 SGDID:S000002284, Chr IV from 238664-236157, reverse complement, Verified ORF, "ATPase in ER, nuclear membrane and cytosol with homology to mammalian p97; in a complex with Npl4p and Ufd1p participates in retrotranslocation of ubiquitinated proteins from the ER into the cytosol for degradation by the proteasome" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26746.26746.3 | 4.0855 | 0.299 | 100.0% | 3341.9644 | 3340.5452 | 6 | 5.344 | 25.9% | 5 | R.EKMDLIDLDEDEIDAEVLDSLGVTMDNFR.F | 3 |
* | 22_g_01_itms.20646.20646.3 | 4.2349 | 0.4142 | 100.0% | 3087.2043 | 3083.4077 | 1 | 6.661 | 26.9% | 1 | K.MDLIDLDEDEIDAEVLDSLGVTMDNFR.F | 3 |
* | 22_g_01_itms.11349.11349.3 | 6.2885 | 0.3213 | 100.0% | 3209.5444 | 3204.4783 | 1 | 6.681 | 35.7% | 18 | K.VEGEDVEMTDEGAKAEQEPEVDPVPYITK.E | 3 |
U | YFL039C | 2 | 6 | 6.9% | 375 | 41690 | 5.7 | ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.01266.01266.2 | 2.276 | 0.305 | 100.0% | 977.03217 | 976.44885 | 1 | 5.783 | 72.2% | 2 | K.AGFAGDDAPR.A | 2 |
* | 22_g_01_itms.10055.10055.2 | 4.0478 | 0.353 | 100.0% | 1792.2322 | 1790.8925 | 1 | 6.046 | 73.3% | 4 | K.SYELPDGQVITIGNER.F | 2 |
U | YBR121C | 3 | 5 | 6.7% | 667 | 75411 | 6.0 | GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09591.09591.2 | 3.9725 | 0.239 | 100.0% | 1638.3322 | 1637.7733 | 1 | 6.807 | 67.9% | 2 | K.IDGYSGPELGELMEK.Y | 2 |
* | 22_g_01_itms.15551.15551.3 | 3.6382 | 0.1305 | 97.2% | 3275.9043 | 3272.4758 | 87 | 4.228 | 22.4% | 1 | R.DITYNGASWEEGTKDLTPFIAQAEAEAETD.- | 3 |
* | 22_g_01_itms.12426.12426.2 | 3.8225 | 0.4939 | 100.0% | 1721.2122 | 1720.7917 | 1 | 8.383 | 66.7% | 2 | K.DLTPFIAQAEAEAETD.- | 2 |
U | YPL061W | 1 | 4 | 6.6% | 500 | 54414 | 5.4 | ALD6 SGDID:S000005982, Chr XVI from 432585-434087, Verified ORF, "Cytosolic aldehyde dehydrogenase that is activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for the conversion of acetaldehyde to acetate; constitutively expressed" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15660.15660.3 | 7.4162 | 0.4115 | 100.0% | 3744.5645 | 3737.5957 | 1 | 7.933 | 33.6% | 4 | K.TYPVEDPSTENTVCEVSSATTEDVEYAIECADR.A | 3 |
U | YAL009W | 1 | 1 | 6.6% | 259 | 30114 | 10.0 | SPO7 SGDID:S000000007, Chr I from 135856-136635, Verified ORF, "Integral nuclear/ER membrane protein of unknown function, required for normal nuclear envelope morphology and sporulation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.40101.40101.3 | 2.2104 | 0.1452 | 90.6% | 1769.2743 | 1766.8534 | 434 | 3.815 | 32.8% | 1 | V.GNHAQDDSASIVSGPRR.R | 3 |
U | Reverse_YBL055C | 1 | 1 | 6.5% | 418 | 47390 | 6.7 | YBL055C SGDID:S000000151, Chr II from 116832-115576, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24427.24427.3 | 2.873 | 0.139 | 90.6% | 3222.7744 | 3216.7566 | 46 | 3.818 | 22.1% | 1 | A.HTRKIECWPADTELLLRETPIQKVVAL.N | 3 |
U | YAL025C | 1 | 1 | 6.5% | 306 | 35694 | 5.3 | MAK16 SGDID:S000000023, Chr I from 101146-100226, reverse complement, Verified ORF, "Essential nuclear protein, constituent of 66S pre-ribosomal particles; required for normal concentration of free 60S ribosomal subunits; required for maintenance of M1 satellite double-stranded RNA of the L-A virus" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09881.09881.2 | 3.4813 | 0.2754 | 100.0% | 2402.5522 | 2402.0635 | 6 | 5.447 | 39.5% | 1 | K.VEIEYEEEHEVQNAEQEVAQ.- | 2 |
U | YDR463W | 1 | 1 | 6.4% | 519 | 58088 | 7.5 | STP1 SGDID:S000002871, Chr IV from 1386806-1388365, Verified ORF, "Transcription factor, activated by proteolytic processing in response to signals from the SPS sensor system for external amino acids; activates transcription of amino acid permease genes and may have a role in tRNA processing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31774.31774.3 | 3.4073 | 0.2093 | 94.3% | 3781.1343 | 3786.0198 | 25 | 4.064 | 19.5% | 1 | E.NHIESGDCKALPQGYTKKNEKRSGKLRKIKTSN.G | 3 |
U | YBR181C | 1 | 1 | 6.4% | 236 | 26996 | 10.4 | RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein" |
U | YPL090C | 1 | 1 | 6.4% | 236 | 26996 | 10.4 | RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.06038.06038.2 | 4.1298 | 0.401 | 100.0% | 1594.4922 | 1592.7444 | 1 | 7.271 | 71.4% | 1 | R.IGQEVDGEAVGDEFK.G | 2 |
U | YJL060W | 1 | 1 | 6.3% | 444 | 50082 | 6.6 | BNA3 SGDID:S000003596, Chr X from 323302-324636, Verified ORF, "Arylformamidase, involved in biosynthesis of nicotinic acid from tryptophan via kynurenine pathway; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15654.15654.3 | 3.9785 | 0.1688 | 97.4% | 3348.7144 | 3351.7893 | 38 | 4.236 | 24.1% | 1 | G.KDFRISHWLINELGVVAIPPTEFYIKEH.E | 3 |
U | YPL124W | 3 | 9 | 6.3% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08075.08075.2 | 3.8944 | 0.283 | 100.0% | 1922.6122 | 1922.8749 | 120 | 6.02 | 43.3% | 6 | R.SSQIHIENEST*EDILK.I | 2 |
* | 22_g_01_itms.07410.07410.2 | 3.2723 | 0.1954 | 93.2% | 1924.4122 | 1922.8749 | 4 | 5.149 | 50.0% | 1 | R.SSQIHIENES*TEDILK.I | 2 |
* | 22_g_01_itms.07781.07781.3 | 4.0728 | 0.2179 | 100.0% | 1924.5543 | 1922.8749 | 1 | 5.407 | 43.3% | 2 | R.SSQIHIENES*TEDILK.I | 3 |
U | YER036C | 2 | 2 | 6.2% | 610 | 68377 | 6.5 | YER036C SGDID:S000000838, Chr V from 225198-223366, reverse complement, Uncharacterized ORF, "ATPase of the ATP-binding cassette (ABC) family involved in ribosome biogenesis, has similarity to Gcn20p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31467.31467.2 | 2.437 | 0.0824 | 92.0% | 2271.8323 | 2276.161 | 1 | 4.363 | 42.1% | 1 | N.YGRRYGLLGENGCGKSTFLK.A | 2 |
* | 22_g_01_itms.12705.12705.2 | 2.6165 | 0.1159 | 91.4% | 2105.892 | 2103.0498 | 43 | 4.329 | 35.3% | 1 | K.TILEDGPESELLEPLYER.M | 2 |
U | Reverse_YGR152C | 1 | 1 | 6.2% | 272 | 30391 | 9.2 | RSR1 SGDID:S000003384, Chr VII from 795497-794679, reverse complement, Verified ORF, "GTP-binding protein of the ras superfamily required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.01790.01790.3 | 2.4278 | 0.1112 | 90.8% | 1679.9944 | 1681.8622 | 55 | 3.835 | 35.9% | 1 | A.SIGTRNSSGSKPVAHSP.K | 3 |
U | Reverse_YNL040W | 1 | 1 | 6.1% | 456 | 50964 | 6.5 | YNL040W SGDID:S000004985, Chr XIV from 553381-554751, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27618.27618.3 | 2.8903 | 0.2103 | 90.5% | 3262.4644 | 3258.709 | 362 | 3.806 | 20.4% | 1 | E.EEMFYARKKGSAKLTNMLEESATRALRK.I | 3 |
U | YDR171W | 2 | 4 | 6.1% | 375 | 42817 | 5.1 | HSP42 SGDID:S000002578, Chr IV from 806616-807743, Verified ORF, "Small cytosolic stress-induced chaperone that forms barrel-shaped oligomers and suppresses the aggregation of non-native proteins; oligomer dissociation is not required for function; involved in cytoskeleton reorganization after heat shock" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11457.11457.2 | 3.5062 | 0.3946 | 100.0% | 2670.3523 | 2670.231 | 1 | 6.969 | 38.6% | 2 | R.IAIEEIPDEELEFEENPNPTVEN.- | 2 |
* | 22_g_01_itms.11448.11448.3 | 3.2476 | 0.0754 | 90.6% | 2670.3843 | 2670.231 | 82 | 3.81 | 27.3% | 2 | R.IAIEEIPDEELEFEENPNPTVEN.- | 3 |
U | YKL104C | 2 | 5 | 6.0% | 717 | 80047 | 6.4 | GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11708.11708.2 | 3.8579 | 0.2413 | 100.0% | 2376.5122 | 2372.1663 | 1 | 5.321 | 52.5% | 3 | K.VDFVDVEFPEENAGQPEIPLK.S | 2 |
* | 22_g_01_itms.18834.18834.2 | 4.3589 | 0.3503 | 100.0% | 2470.0723 | 2465.245 | 1 | 6.874 | 45.2% | 2 | R.AIFEELSDIPVSVELASDFLDR.K | 2 |
U | YGL253W | 1 | 2 | 6.0% | 486 | 53943 | 5.3 | HXK2 SGDID:S000003222, Chr VII from 23935-25395, Verified ORF, "Hexokinase isoenzyme 2 that catalyzes phosphorylation of glucose in the cytosol; predominant hexokinase during growth on glucose; functions in the nucleus to repress expression of HXK1 and GLK1 and to induce expression of its own gene" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15667.15667.3 | 5.7503 | 0.4047 | 100.0% | 3458.1543 | 3457.556 | 4 | 6.633 | 25.9% | 2 | R.IEEDPFENLEDTDDLFQNEFGINTTVQER.K | 3 |
U | YMR314W | 1 | 1 | 6.0% | 234 | 25604 | 7.4 | PRE5 SGDID:S000004931, Chr XIII from 901708-902412, Verified ORF, "20S proteasome alpha-type subunit" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08091.08091.2 | 2.8586 | 0.2438 | 99.3% | 1527.4521 | 1526.7379 | 3 | 4.97 | 53.8% | 1 | K.DTPFTIYDGEAVAK.Y | 2 |
U | YGR187C | 1 | 2 | 5.8% | 394 | 44952 | 4.7 | HGH1 SGDID:S000003419, Chr VII from 871421-870237, reverse complement, Verified ORF, "Protein of unknown function with similarity to human HMG1 and HMG2; localizes to the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15343.15343.2 | 3.8552 | 0.3964 | 100.0% | 2734.7322 | 2734.2292 | 1 | 7.169 | 38.6% | 2 | K.DSEIDEEDMFNLPDELQLLPEDK.E | 2 |
U | Reverse_YOL077C | 1 | 1 | 5.8% | 291 | 33577 | 9.2 | BRX1 SGDID:S000005437, Chr XV from 186722-185847, reverse complement, Verified ORF, "Nucleolar protein, constituent of 66S pre-ribosomal particles; depletion leads to defects in rRNA processing and a block in the assembly of large ribosomal subunits; possesses a sigma(70)-like RNA-binding motif" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10100.10100.3 | 2.7104 | 0.1409 | 92.1% | 1963.8544 | 1964.9791 | 163 | 3.912 | 32.8% | 1 | K.DDVISFSMVHDIFPKSK.R | 3 |
U | Reverse_YDL168W | 1 | 1 | 5.7% | 386 | 41042 | 6.8 | SFA1 SGDID:S000002327, Chr IV from 159605-160765, Verified ORF, "Bifunctional enzyme containing both alcohol dehydrogenase and glutathione-dependent formaldehyde dehydrogenase activities, functions in formaldehyde detoxification and formation of long chain and complex alcohols, regulated by Hog1p-Sko1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12251.12251.2 | 2.2251 | 0.2547 | 96.2% | 2352.8523 | 2348.3125 | 17 | 4.656 | 31.0% | 1 | E.VKLAGKQYDKILGGMESRGKIG.G | 2 |
U | YPL131W | 1 | 4 | 5.7% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14373.14373.2 | 4.2256 | 0.3952 | 100.0% | 2094.372 | 2092.9868 | 1 | 6.898 | 62.5% | 4 | R.FPGWDFETEEIDPELLR.S | 2 |
U | YCR002C | 1 | 1 | 5.6% | 322 | 37025 | 5.7 | CDC10 SGDID:S000000595, Chr III from 118345-117377, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10191.10191.2 | 2.7442 | 0.2605 | 97.0% | 2228.3323 | 2228.0247 | 1 | 4.725 | 47.1% | 1 | K.IYPYDSEELTDEELELNR.S | 2 |
U | YJR109C | 5 | 9 | 5.5% | 1118 | 123915 | 5.3 | CPA2 SGDID:S000003870, Chr X from 632856-629500, reverse complement, Verified ORF, "Large subunit of carbamoyl phosphate synthetase, which catalyzes a step in the synthesis of citrulline, an arginine precursor" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18276.18276.3 | 3.5313 | 0.1327 | 90.6% | 3995.0942 | 3995.9185 | 1 | 3.816 | 20.0% | 1 | T.SEDRDLFASALKDINIPIAESFACETVDEALEAAER.V | 3 |
* | 22_g_01_itms.18275.18275.3 | 4.9327 | 0.4302 | 100.0% | 2665.0745 | 2663.251 | 1 | 7.631 | 41.3% | 2 | K.DINIPIAESFACETVDEALEAAER.V | 3 |
* | 22_g_01_itms.18302.18302.2 | 6.0092 | 0.4217 | 100.0% | 2668.3123 | 2663.251 | 1 | 8.357 | 58.7% | 3 | K.DINIPIAESFACETVDEALEAAER.V | 2 |
* | 22_g_01_itms.14820.14820.2 | 4.8764 | 0.4239 | 100.0% | 2824.7122 | 2824.3416 | 1 | 7.252 | 43.8% | 2 | K.FSSILDSIDVDQPEWSELTSVEEAK.L | 2 |
* | 22_g_01_itms.15134.15134.2 | 2.9909 | 0.1903 | 95.5% | 2464.7922 | 2462.1462 | 58 | 4.478 | 31.0% | 1 | S.SILDSIDVDQPEWSELTSVEEA.K | 2 |
U | YOL023W | 1 | 1 | 5.5% | 676 | 75657 | 8.7 | IFM1 SGDID:S000005383, Chr XV from 278056-280086, Verified ORF, "Mitochondrial translation initiation factor 2" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.28474.28474.3 | 2.8974 | 0.1541 | 90.2% | 3748.3145 | 3753.7249 | 5 | 3.798 | 20.1% | 1 | C.DVSGSAEAVSESISSLGNDEVRCNVISSSVGIPTESD.L | 3 |
U | Reverse_YIL037C | 1 | 1 | 5.5% | 656 | 75021 | 8.0 | PRM2 SGDID:S000001299, Chr IX from 284998-283028, reverse complement, Verified ORF, "Pheromone-regulated protein, predicted to have 4 transmembrane segments and a coiled coil domain; regulated by Ste12p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23095.23095.3 | 2.9387 | 0.2037 | 96.4% | 3718.5544 | 3715.8635 | 1 | 4.204 | 21.4% | 1 | T.TTATTTATATATSISAFTSVTDNRKVQAHSMKAMTI.D | 3 |
U | YBR015C | 1 | 1 | 5.5% | 597 | 67774 | 6.3 | MNN2 SGDID:S000000219, Chr II from 269503-267710, reverse complement, Verified ORF, "Alpha-1,2-mannosyltransferase, responsible for addition of the first alpha-1,2-linked mannose to form the branches on the mannan backbone of oligosaccharides, localizes to an early Golgi compartment" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23665.23665.3 | 3.4222 | 0.2459 | 98.6% | 3707.1843 | 3706.6895 | 16 | 5.061 | 20.3% | 1 | Y.NVNGPTWYYPIFSQKAAGEGDKET*FIAAANFYG.L | 3 |
U | YER021W | 1 | 1 | 5.5% | 523 | 60393 | 5.6 | RPN3 SGDID:S000000823, Chr V from 196947-198518, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23083.23083.3 | 3.9476 | 0.0982 | 92.0% | 3467.9343 | 3466.5925 | 19 | 3.896 | 23.2% | 1 | K.INHEDGFIETTELLNIYDSEDPQQVFDER.I | 3 |
U | Reverse_YIL135C | 1 | 1 | 5.5% | 436 | 47961 | 9.2 | VHS2 SGDID:S000001397, Chr IX from 96375-95065, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function; identified as a high-copy suppressor of the synthetic lethality of a sis2 sit4 double mutant, suggesting a role in G1/S phase progression; similar to Mlf3p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20330.20330.2 | 2.1634 | 0.1888 | 98.7% | 2601.9722 | 2605.2468 | 61 | 4.915 | 28.3% | 1 | S.SNNHNFLSTRSSQRSLSNAANNSV.T | 2 |
U | YOR373W | 2 | 2 | 5.4% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13056.13056.3 | 4.2872 | 0.1045 | 98.6% | 2943.9844 | 2941.182 | 1 | 5.039 | 35.6% | 1 | K.VSSSFS*DDS*DSGPAAEAHDVFDGILQK.Q | 3 |
* | 22_g_01_itms.08298.08298.2 | 3.7856 | 0.4319 | 100.0% | 2302.1921 | 2301.9417 | 14 | 6.557 | 38.9% | 1 | R.VEDITSIS*EVNTS*FNETEK.Q | 2 |
U | YHL027W | 1 | 1 | 5.4% | 625 | 68232 | 7.2 | RIM101 SGDID:S000001019, Chr VIII from 51109-52986, Verified ORF, "Transcriptional repressor involved in the response to pH; required for alkaline pH-stimulated differentiation pathways such as haploid invasive growth and sporulation; activated by proteolytic processing; has similarity to the A. nidulans transcription factor PacC" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21016.21016.3 | 3.3646 | 0.0744 | 91.7% | 3559.6143 | 3562.7737 | 366 | 3.861 | 18.2% | 1 | N.KENGTAAPQHSRESIVENGTDVSNVTKKDGLPSP.N | 3 |
U | Reverse_YDL066W | 1 | 1 | 5.4% | 428 | 48190 | 8.8 | IDP1 SGDID:S000002224, Chr IV from 334835-336121, Verified ORF, "Mitochondrial NADP-specific isocitrate dehydrogenase, catalyzes the oxidation of isocitrate to alpha-ketoglutarate; not required for mitochondrial respiration and may function to divert alpha-ketoglutarate to biosynthetic processes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00651.00651.3 | 2.2412 | 0.0158 | 92.8% | 2446.4944 | 2445.176 | 120 | 3.928 | 25.0% | 1 | G.FGQAVIDSQVDGDYNKLAMIFGG.K | 3 |
U | Reverse_YDR528W | 1 | 1 | 5.4% | 423 | 47578 | 6.7 | HLR1 SGDID:S000002936, Chr IV from 1494576-1495847, Verified ORF, "Protein involved in regulation of cell wall composition and integrity and response to osmotic stress; overproduction suppresses a lysis sensitive PKC mutation; similar to Lre1p, which functions antagonistically to protein kinase A" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29605.29605.3 | 3.2972 | 0.0916 | 97.5% | 2601.9543 | 2600.3643 | 61 | 4.275 | 25.0% | 1 | K.KISSSQPSLRVRENISTQLNDID.Q | 3 |
U | YLR449W | 1 | 1 | 5.4% | 392 | 43903 | 4.7 | FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27308.27308.2 | 2.3906 | 0.2139 | 92.0% | 2613.5923 | 2609.485 | 2 | 4.364 | 35.0% | 1 | E.LVKKDEKKKNNKKDSKRKHEE.D | 2 |
U | YGR023W | 1 | 1 | 5.3% | 551 | 57528 | 4.7 | MTL1 SGDID:S000003255, Chr VII from 529268-530923, Verified ORF, "Protein with both structural and functional similarity to Mid2p, which is a plasma membrane sensor required for cell integrity signaling during pheromone-induced morphogenesis; suppresses rgd1 null mutations" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25154.25154.3 | 3.0809 | 0.1436 | 92.8% | 2829.5942 | 2830.227 | 3 | 3.951 | 25.0% | 1 | L.SSTLSSELSSSSMQVSSSSTSSSSSEVTS.S | 3 |
U | YKL189W | 1 | 1 | 5.3% | 399 | 45853 | 8.4 | HYM1 SGDID:S000001672, Chr XI from 84709-85908, Verified ORF, "Component of the RAM signaling network that is involved in regulation of Ace2p activity and cellular morphogenesis, interacts with Kic1p and Sog2p, localizes to sites of polarized growth during budding and during the mating response" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00716.00716.3 | 2.8107 | 0.1174 | 98.6% | 2328.1743 | 2326.317 | 386 | 4.485 | 25.0% | 1 | Y.LVSQPKTISLMLRTAEVALQQ.K | 3 |
U | YDR432W | 2 | 3 | 5.3% | 414 | 45407 | 5.5 | NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17136.17136.2 | 4.6026 | 0.3217 | 100.0% | 2438.4321 | 2437.1775 | 1 | 5.88 | 45.2% | 2 | R.DFDGTGALEFPSEEILVEALER.L | 2 |
* | 22_g_01_itms.17156.17156.3 | 2.9535 | 0.2002 | 97.9% | 2438.6042 | 2437.1775 | 114 | 4.286 | 26.2% | 1 | R.DFDGTGALEFPSEEILVEALER.L | 3 |
U | YPL113C | 1 | 1 | 5.3% | 396 | 45014 | 7.2 | YPL113C SGDID:S000006034, Chr XVI from 337142-335952, reverse complement, Uncharacterized ORF, "Putative dehydrogenase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29439.29439.2 | 2.6155 | 0.2362 | 95.8% | 2228.9521 | 2228.2192 | 11 | 4.561 | 35.0% | 1 | V.LILGFGSIGQNIGSNLHKVFN.M | 2 |
U | Reverse_YOL047C | 1 | 1 | 5.3% | 356 | 40878 | 8.6 | YOL047C SGDID:S000005407, Chr XV from 242745-242503,242439-241612, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11201.11201.3 | 3.2924 | 0.0586 | 95.8% | 2149.4043 | 2146.235 | 29 | 4.158 | 36.1% | 1 | I.CVLLSWALISTFAVILLLN.L | 3 |
U | Reverse_YKL005C | 1 | 1 | 5.2% | 594 | 67901 | 5.4 | BYE1 SGDID:S000001488, Chr XI from 434520-432736, reverse complement, Verified ORF, "Negative regulator of transcription elongation, contains a TFIIS-like domain and a PHD finger, multicopy suppressor of temperature-sensitive ess1 mutations, probably binds RNA polymerase II large subunit" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10541.10541.3 | 3.0893 | 0.0066 | 95.0% | 3613.8843 | 3610.8884 | 83 | 4.114 | 19.2% | 1 | E.KFIDRRLKQSAGIYNLYGTFELGLGPYLFAC.N | 3 |
U | YDR190C | 1 | 2 | 5.2% | 463 | 50453 | 5.9 | RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09662.09662.2 | 5.3441 | 0.3273 | 100.0% | 2598.2722 | 2596.1943 | 1 | 6.536 | 56.5% | 2 | K.EVYEGEVTELTPEDAENPLGGYGK.T | 2 |
U | Reverse_YBR057C | 1 | 1 | 5.2% | 366 | 41433 | 5.9 | MUM2 SGDID:S000000261, Chr II from 353291-352191, reverse complement, Verified ORF, "Cytoplasmic protein essential for meiotic DNA replication and sporulation; interacts with Orc2p, which is a component of the origin recognition complex" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.19219.19219.3 | 4.3784 | 0.1191 | 90.9% | 2212.1343 | 2212.9385 | 1 | 3.837 | 41.7% | 1 | E.MRDDKNSNMENSNVNNMSL.A | 3 |
U | YDR158W | 1 | 1 | 5.2% | 365 | 39544 | 6.7 | HOM2 SGDID:S000002565, Chr IV from 770352-771449, Verified ORF, "Aspartic beta semi-aldehyde dehydrogenase, catalyzes the second step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11186.11186.2 | 2.9475 | 0.3025 | 97.8% | 2075.7522 | 2072.9487 | 6 | 4.812 | 36.1% | 1 | K.ECDIVFSGLDADYAGAIEK.E | 2 |
U | Reverse_YOL011W | 1 | 1 | 5.1% | 686 | 75077 | 5.0 | PLB3 SGDID:S000005371, Chr XV from 305349-307409, Verified ORF, "Phospholipase B (lysophospholipase) involved in phospholipid metabolism; hydrolyzes phosphatidylinositol and phosphatidylserine and displays transacylase activity in vitro" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25056.25056.3 | 2.9681 | 0.1054 | 91.6% | 3865.3145 | 3871.9492 | 11 | 3.87 | 19.9% | 1 | N.DVAFIIDVDREKQILPLVPVNEDDEGGDVLFLSDS.D | 3 |
U | YKL103C | 1 | 1 | 5.1% | 514 | 57093 | 5.8 | LAP4 SGDID:S000001586, Chr XI from 247326-245782, reverse complement, Verified ORF, "Vacuolar aminopeptidase, often used as a marker protein in studies of autophagy and cytosol to vacuole targeting (CVT) pathway" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15294.15294.3 | 3.703 | 0.1347 | 93.3% | 2948.7244 | 2947.3696 | 51 | 4.003 | 25.0% | 1 | K.DVNTEESDLFSTVTLYDNEEIGSLTR.Q | 3 |
U | Reverse_YBR197C | 1 | 1 | 5.1% | 217 | 24203 | 9.1 | YBR197C SGDID:S000000401, Chr II from 615851-615198, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; YBR197C is not an essential gene" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08965.08965.2 | 1.9818 | 0.2001 | 94.5% | 1221.3121 | 1222.6028 | 8 | 4.461 | 65.0% | 1 | S.DSSGKRKDKDS.K | 2 |
U | YBL055C | 1 | 1 | 5.0% | 418 | 47390 | 6.7 | YBL055C SGDID:S000000151, Chr II from 116832-115576, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13689.13689.2 | 2.3438 | 0.2534 | 97.1% | 2429.9521 | 2434.286 | 1 | 5.484 | 37.5% | 1 | P.DRKLVVHSFTGS*AIDLQKLLN.L | 2 |
U | YNL037C | 1 | 2 | 5.0% | 360 | 39324 | 9.0 | IDH1 SGDID:S000004982, Chr XIV from 559003-557921, reverse complement, Verified ORF, "Subunit of mitochondrial NAD(+)-dependent isocitrate dehydrogenase, which catalyzes the oxidation of isocitrate to alpha-ketoglutarate in the TCA cycle" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07922.07922.2 | 3.6197 | 0.2213 | 99.3% | 1901.6322 | 1898.8983 | 12 | 5.021 | 44.1% | 2 | R.DIGGSSSTTDFTNEIINK.L | 2 |
U | YMR300C | 2 | 4 | 4.9% | 510 | 56719 | 6.3 | ADE4 SGDID:S000004915, Chr XIII from 867090-865558, reverse complement, Verified ORF, "Phosphoribosylpyrophosphate amidotransferase (PRPPAT; amidophosphoribosyltransferase), catalyzes first step of the 'de novo' purine nucleotide biosynthetic pathway" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14315.14315.2 | 3.8171 | 0.4223 | 100.0% | 2838.8123 | 2838.2998 | 1 | 6.994 | 39.6% | 2 | K.FEDGVFTGNYVTGVEDGYIQELEEK.R | 2 |
* | 22_g_01_itms.14294.14294.3 | 5.7269 | 0.2582 | 100.0% | 2840.3342 | 2838.2998 | 1 | 6.849 | 35.4% | 2 | K.FEDGVFTGNYVTGVEDGYIQELEEK.R | 3 |
U | YML127W | 1 | 1 | 4.8% | 581 | 65218 | 7.8 | RSC9 SGDID:S000004596, Chr XIII from 17065-18810, Verified ORF, "One of 15 subunits of the 'Remodel the Structure of Chromatin' (RSC) complex; DNA-binding protein involved in the synthesis of rRNA and in transcriptional repression and activation of genes regulated by the Target of Rapamycin (TOR) pathway" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.28794.28794.3 | 3.2219 | 0.1594 | 93.4% | 3208.3743 | 3204.7117 | 2 | 3.979 | 25.0% | 1 | N.LDHKTLSLIVSFLLLECDSELIIASLDF.L | 3 |
U | Reverse_YML123C | 1 | 1 | 4.8% | 587 | 64382 | 6.4 | PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25770.25770.3 | 3.2028 | 0.1797 | 95.4% | 3168.0544 | 3164.7375 | 398 | 4.141 | 22.2% | 1 | I.VYLALLGHDGLKHYAFGIVCFLATLIIF.G | 3 |
U | YGL206C | 3 | 4 | 4.7% | 1653 | 187233 | 5.2 | CHC1 SGDID:S000003174, Chr VII from 107508-102547, reverse complement, Verified ORF, "Clathrin heavy chain, subunit of the major coat protein involved in intracellular protein transport and endocytosis; two heavy chains form the clathrin triskelion structural component; the light chain (CLC1) is thought to regulate function" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11803.11803.2 | 2.9457 | 0.1978 | 100.0% | 1872.7522 | 1869.938 | 2 | 5.533 | 50.0% | 1 | K.DANLEDQLPLVIVCDR.F | 2 |
* | 22_g_01_itms.25213.25213.3 | 3.2205 | 0.1978 | 93.3% | 4377.8345 | 4374.21 | 2 | 3.991 | 17.3% | 1 | K.TAQVVGALLDMDCDEAFIQSLLQSVLGQVPINELTTEVEK.R | 3 |
* | 22_g_01_itms.24033.24033.2 | 3.5569 | 0.2051 | 93.3% | 2538.5923 | 2536.2249 | 1 | 4.417 | 42.9% | 2 | R.YESNGYFEELISLFEAGLGLER.A | 2 |
U | YCR088W | 1 | 1 | 4.6% | 592 | 65576 | 4.7 | ABP1 SGDID:S000000684, Chr III from 265064-266842, Verified ORF, "Actin-binding protein of the cortical actin cytoskeleton, important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10464.10464.3 | 3.6288 | 0.2194 | 98.1% | 3037.5842 | 3035.3606 | 335 | 4.304 | 23.1% | 1 | K.QEEAPEQAPEEEIEEEAEEAAPQLPSR.S | 3 |
U | YMR019W | 1 | 1 | 4.5% | 949 | 109825 | 7.3 | STB4 SGDID:S000004621, Chr XIII from 312155-315004, Verified ORF, "Protein that binds Sin3p in a two-hybrid assay; contains a Zn(II)2Cys6 zinc finger domain characteristic of DNA-binding proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27466.27466.3 | 2.6868 | 0.089 | 92.0% | 4321.0444 | 4329.1484 | 69 | 3.887 | 16.7% | 1 | L.ATRSHNTTNFDGSIAISPESAVANLGTDTGLPSDVLDTVSKIG.N | 3 |
U | YJL083W | 1 | 1 | 4.5% | 604 | 68768 | 9.6 | TAX4 SGDID:S000003619, Chr X from 278757-280571, Verified ORF, "Protein involved in regulation of phosphatidylinositol 4,5-bisphosphate concentrations; Irs4p and Tax4p bind and activate the phosphatase Inp51p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11085.11085.3 | 3.2529 | 0.213 | 92.2% | 2847.3843 | 2845.387 | 103 | 3.91 | 25.0% | 1 | I.HYDVRNKASNSPSSIAAAETAAYLAHT.N | 3 |
U | Reverse_YGR023W | 1 | 1 | 4.5% | 551 | 57528 | 4.7 | MTL1 SGDID:S000003255, Chr VII from 529268-530923, Verified ORF, "Protein with both structural and functional similarity to Mid2p, which is a plasma membrane sensor required for cell integrity signaling during pheromone-induced morphogenesis; suppresses rgd1 null mutations" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39982.39982.3 | 2.5565 | 0.1193 | 94.4% | 2646.0544 | 2644.228 | 3 | 4.078 | 25.0% | 1 | S.LGSHHSNKGSSASATPSYTITTYYN.S | 3 |
U | Reverse_YBR042C | 1 | 1 | 4.5% | 397 | 45515 | 9.3 | YBR042C SGDID:S000000246, Chr II from 321609-320416, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27813.27813.2 | 2.27 | 0.2887 | 99.0% | 1715.5922 | 1716.8881 | 1 | 4.937 | 44.1% | 1 | S.GAGRANSDLGALSNSLTI.K | 2 |
U | YFL018C | 1 | 1 | 4.4% | 499 | 54010 | 8.0 | LPD1 SGDID:S000001876, Chr VI from 103121-101622, reverse complement, Verified ORF, "Dihydrolipoamide dehydrogenase, the lipoamide dehydrogenase component (E3) of the pyruvate dehydrogenase and 2-oxoglutarate dehydrogenase multi-enzyme complexes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11569.11569.2 | 3.7526 | 0.3138 | 100.0% | 2361.9521 | 2358.208 | 9 | 5.438 | 35.7% | 1 | K.NIIVATGSEVTPFPGIEIDEEK.I | 2 |
U | YLL057C | 1 | 1 | 4.4% | 412 | 46983 | 6.7 | JLP1 SGDID:S000003980, Chr XII from 26994-25756, reverse complement, Uncharacterized ORF, "Fe(II)-dependent sulfonate/alpha-ketoglutarate dioxygenase, involved in sulfonate catabolism for use as a sulfur source, contains sequence that closely resembles a J domain (typified by the E. coli DnaJ protein)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.01250.01250.3 | 2.54 | 0.0417 | 95.1% | 1831.3143 | 1829.8234 | 12 | 4.125 | 33.8% | 1 | T.FFSVVEGPDGGGDTLFAD.T | 3 |
U | YER147C | 1 | 1 | 4.3% | 624 | 72141 | 7.8 | SCC4 SGDID:S000000949, Chr V from 464837-462963, reverse complement, Verified ORF, "Subunit of cohesin loading factor (Scc2p-Scc4p), a complex required for the loading of cohesin complexes onto chromosomes; involved in establishing sister chromatid cohesion during double-strand break repair via phosphorylated histone H2AX" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20434.20434.3 | 3.9736 | 0.1706 | 99.2% | 2817.6843 | 2814.3909 | 329 | 4.704 | 25.0% | 1 | M.KVQFEGGGAVEEYTRLAQSGGTSSEVK.M | 3 |
U | YDR143C | 1 | 1 | 4.3% | 610 | 65618 | 5.2 | SAN1 SGDID:S000002550, Chr IV from 743869-742037, reverse complement, Verified ORF, "Ubiquitin-protein ligase, involved in the proteasome-dependent degradation of aberrant nuclear proteins; san1 mutations suppress sir4, spt16, and cdc68 mutations, suggesting a role in chromatin silencing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.19933.19933.3 | 3.2149 | 0.2821 | 98.5% | 2909.8442 | 2909.262 | 54 | 5.158 | 25.0% | 1 | S.ST*TQNPPSNSGGS*NNNQSPRWVPIPL.T | 3 |
U | YER165W | 1 | 2 | 4.3% | 577 | 64344 | 6.0 | PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15095.15095.3 | 3.807 | 0.2675 | 100.0% | 2787.5645 | 2786.2896 | 1 | 5.349 | 32.3% | 2 | K.NLDDSVDDEKLEEEFAPYGTITSAK.V | 3 |
U | YLR286C | 1 | 1 | 4.3% | 562 | 59015 | 4.5 | CTS1 SGDID:S000004276, Chr XII from 710138-708450, reverse complement, Verified ORF, "Endochitinase, required for cell separation after mitosis; transcriptional activation during late G and early M cell cycle phases is mediated by transcription factor Ace2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34756.34756.2 | 2.5778 | 0.1236 | 93.0% | 2487.372 | 2486.1257 | 2 | 5.156 | 30.4% | 1 | K.NIKLFLGLPGSASAAGSGYISDT*S*.L | 2 |
U | YDL044C | 1 | 1 | 4.3% | 440 | 51192 | 6.7 | MTF2 SGDID:S000002202, Chr IV from 375286-373964, reverse complement, Verified ORF, "Mitochondrial matrix protein that interacts with an N-terminal region of mitochondrial RNA polymerase (Rpo41p) and couples RNA processing and translation to transcription" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10761.10761.2 | 2.7189 | 0.1699 | 90.7% | 2222.4321 | 2225.2043 | 286 | 4.32 | 30.6% | 1 | A.MTLPYIIVKSLRLGDFDFP.A | 2 |
U | Reverse_YOR250C | 1 | 1 | 4.3% | 445 | 50226 | 5.9 | CLP1 SGDID:S000005776, Chr XV from 802307-800970, reverse complement, Verified ORF, "Subunit of cleavage factor I (CFI), involved in both the endonucleolyitc cleavage and polyadenylation steps of mRNA 3'-end maturation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07224.07224.3 | 3.4225 | 0.0371 | 90.4% | 2129.3643 | 2125.2021 | 215 | 3.806 | 29.2% | 1 | L.KGEAKLDIQWDSGKPIVLK.H | 3 |
U | YNL021W | 1 | 1 | 4.2% | 706 | 80070 | 5.5 | HDA1 SGDID:S000004966, Chr XIV from 593228-595348, Verified ORF, "Putative catalytic subunit of a class II histone deacetylase complex that also contains Hda2p and Hda3p; Hda1p interacts with the Hda2p-Hda3p subcomplex to form an active tetramer; deletion increases histone H2B, H3 and H4 acetylation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14059.14059.3 | 3.7833 | 0.1926 | 90.6% | 3314.6643 | 3310.8625 | 1 | 3.816 | 25.9% | 1 | R.DTRAVTKTVINFLGDKQLKPLVPLVDETLS.E | 3 |
U | YNL016W | 1 | 1 | 4.2% | 453 | 50763 | 5.1 | PUB1 SGDID:S000004961, Chr XIV from 602908-604269, Verified ORF, "Poly(A)+ RNA-binding protein, abundant mRNP-component protein hypothesized to bind a pool of non-translatable mRNAs; not reported to associate with polyribosomes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12950.12950.3 | 3.0373 | 0.2502 | 98.7% | 2256.0842 | 2259.1023 | 17 | 5.03 | 31.9% | 1 | G.RET*SDRVLYVGNLDKAITE.D | 3 |
U | Reverse_YER154W | 1 | 2 | 4.2% | 402 | 44816 | 10.1 | OXA1 SGDID:S000000956, Chr V from 475015-476223, Verified ORF, "Translocase of the mitochondrial inner membrane, mediates the insertion of both mitochondrial- and nuclear-encoded proteins from the matrix into the inner membrane, interacts with mitochondrial ribosomes; null is respiratory deficient" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38710.38710.3 | 2.506 | 0.1493 | 97.3% | 1867.2244 | 1865.9722 | 275 | 4.27 | 32.8% | 2 | N.LADLEPKIHSNRAVTDS.S | 3 |
U | YML119W | 1 | 1 | 4.2% | 357 | 40060 | 9.6 | YML119W SGDID:S000004588, Chr XIII from 30611-31684, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.01569.01569.3 | 2.9122 | 0.1797 | 98.6% | 1834.1044 | 1835.9033 | 50 | 5.056 | 39.3% | 1 | P.IQLSTNSKTRIS*KS*L.D | 3 |
U | YJL213W | 1 | 1 | 4.2% | 331 | 35905 | 7.0 | YJL213W SGDID:S000003749, Chr X from 32163-33158, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21219.21219.3 | 2.3793 | 0.1308 | 96.5% | 1379.8744 | 1377.7313 | 11 | 4.186 | 40.4% | 1 | R.RGADFIKIMGGGGV.A | 3 |
U | Reverse_YGL205W | 1 | 1 | 4.1% | 748 | 84042 | 8.5 | POX1 SGDID:S000003173, Chr VII from 108162-110408, Verified ORF, "Fatty-acyl coenzyme A oxidase, involved in the fatty acid beta-oxidation pathway; localized to the peroxisomal matrix" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23429.23429.3 | 3.8078 | 0.1077 | 92.1% | 3667.1343 | 3670.056 | 407 | 3.902 | 19.2% | 1 | I.CDKRVIPLLALLQPQVVKSIQDPTFIKFQQF.E | 3 |
U | YMR001C | 1 | 1 | 4.1% | 705 | 81031 | 9.0 | CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24906.24906.3 | 3.9325 | 0.1729 | 92.6% | 3257.1243 | 3261.782 | 3 | 3.922 | 25.0% | 1 | L.NTRSKLVHTPIKGNTADLVGKENHFKQTK.R | 3 |
U | YBR286W | 1 | 1 | 4.1% | 537 | 60138 | 5.3 | APE3 SGDID:S000000490, Chr II from 774696-776309, Verified ORF, "Vacuolar aminopeptidase Y, processed to mature form by Prb1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.19284.19284.2 | 2.4274 | 0.2722 | 99.3% | 2408.9922 | 2412.1836 | 1 | 5.0 | 35.7% | 1 | P.QLNDDDSSAVAANIPKPHIPYF.M | 2 |
U | YBR273C | 1 | 1 | 4.1% | 436 | 50031 | 6.3 | UBX7 SGDID:S000000477, Chr II from 749366-748056, reverse complement, Uncharacterized ORF, "UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.46042.46042.3 | 2.1798 | 0.1271 | 93.5% | 1840.0443 | 1842.9058 | 43 | 4.018 | 30.9% | 1 | P.NRHEVRSSTPLSGAASSS.C | 3 |
U | YOR187W | 1 | 3 | 4.1% | 437 | 47972 | 6.7 | TUF1 SGDID:S000005713, Chr XV from 684030-685343, Verified ORF, "Mitochondrial translation elongation factor Tu; comprises both GTPase and guanine nucleotide exchange factor activities, while these activities are found in separate proteins in S. pombe and humans" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14730.14730.2 | 4.2964 | 0.4215 | 100.0% | 2168.872 | 2164.9817 | 1 | 7.382 | 55.9% | 3 | K.VDTIDDPEMLELVEMEMR.E | 2 |
U | YBL050W | 1 | 1 | 4.1% | 292 | 32803 | 5.1 | SEC17 SGDID:S000000146, Chr II from 125128-125157,125274-126122, Verified ORF, "Peripheral membrane protein required for vesicular transport between ER and Golgi and for the 'priming' step in homotypic vacuole fusion, part of the cis-SNARE complex; has similarity to alpha-SNAP" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21598.21598.3 | 2.0479 | 0.1696 | 96.5% | 1202.2144 | 1201.6177 | 320 | 4.184 | 36.4% | 1 | T.DAVAAARTLQEG.Q | 3 |
U | YDR060W | 2 | 4 | 4.0% | 1025 | 116676 | 5.0 | MAK21 SGDID:S000002467, Chr IV from 570645-573722, Verified ORF, "Constituent of 66S pre-ribosomal particles, required for large (60S) ribosomal subunit biogenesis; involved in nuclear export of pre-ribosomes; required for maintenance of dsRNA virus; homolog of human CAATT-binding protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14084.14084.2 | 5.3846 | 0.3625 | 100.0% | 2498.392 | 2494.996 | 1 | 6.519 | 57.5% | 3 | K.ASNFDS*DDEMDENEIWSALVK.S | 2 |
* | 22_g_01_itms.13935.13935.2 | 4.0852 | 0.3457 | 100.0% | 2300.892 | 2299.9285 | 1 | 6.96 | 50.0% | 1 | K.SLPVFASADDYAQYLDQDS*D.- | 2 |
U | YGL137W | 1 | 3 | 4.0% | 889 | 99445 | 4.7 | SEC27 SGDID:S000003105, Chr VII from 249874-249891,250092-252743, Verified ORF, "Essential beta'-coat protein of the COPI coatomer, involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21694.21694.3 | 5.6906 | 0.3746 | 100.0% | 3857.9644 | 3850.7307 | 1 | 7.086 | 25.0% | 3 | K.DAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGK.W | 3 |
U | YJR045C | 2 | 7 | 4.0% | 654 | 70628 | 5.6 | SSC1 SGDID:S000003806, Chr X from 521516-519552, reverse complement, Verified ORF, "Mitochondrial matrix ATPase that is a subunit of the presequence translocase-associated protein import motor (PAM); involved in protein translocation into the matrix and protein folding; member of the heat shock protein 70 (HSP70) family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12709.12709.3 | 5.3871 | 0.3354 | 100.0% | 2713.2844 | 2710.2366 | 1 | 6.657 | 34.0% | 3 | K.DSSITVAGSSGLSENEIEQMVNDAEK.F | 3 |
* | 22_g_01_itms.12804.12804.2 | 4.9431 | 0.3926 | 100.0% | 2714.912 | 2710.2366 | 1 | 7.459 | 40.0% | 4 | K.DSSITVAGSSGLSENEIEQMVNDAEK.F | 2 |
U | YHR065C | 1 | 1 | 4.0% | 501 | 55969 | 9.2 | RRP3 SGDID:S000001107, Chr VIII from 229039-227534, reverse complement, Verified ORF, "Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10572.10572.3 | 3.0911 | 0.0694 | 98.7% | 2343.8943 | 2342.259 | 6 | 4.413 | 28.9% | 1 | L.MRKPHIIIATPGRLMDHLEN.T | 3 |
U | Reverse_YMR030W | 1 | 1 | 4.0% | 376 | 43460 | 8.2 | RSF1 SGDID:S000004632, Chr XIII from 330792-331922, Verified ORF, "Protein required for respiratory growth; localized to both the nucleus and mitochondrion; mutant displays decreased transcription of specific nuclear and mitochondrial genes whose products are involved in respiratory growth" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.02522.02522.3 | 2.7284 | 0.253 | 99.4% | 1523.8744 | 1526.72 | 50 | 4.827 | 37.5% | 1 | L.SSGTEPHNGNVDGKK.K | 3 |
U | YIL075C | 1 | 3 | 3.9% | 945 | 104232 | 6.2 | RPN2 SGDID:S000001337, Chr IX from 220697-217860, reverse complement, Verified ORF, "Subunit of the 26S proteasome, substrate of the N-acetyltransferase Nat1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25731.25731.3 | 4.4666 | 0.2632 | 100.0% | 4291.7344 | 4289.989 | 1 | 5.803 | 23.6% | 3 | K.TYALESINNVVDQLWSEISNELPDIEALYDDDTFSDR.E | 3 |
U | YMR016C | 1 | 1 | 3.9% | 785 | 85643 | 8.5 | SOK2 SGDID:S000004618, Chr XIII from 305592-303235, reverse complement, Verified ORF, "Nuclear protein that plays a regulatory role in the cyclic AMP (cAMP)-dependent protein kinase (PKA) signal transduction pathway; negatively regulates pseudohyphal differentiation; homologous to several transcription factors" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22252.22252.3 | 3.4382 | 0.1487 | 95.1% | 3362.1243 | 3363.5405 | 22 | 4.13 | 20.8% | 1 | A.YYYYPANGDGTTNGATPSVTSNQVQNPNLEK.T | 3 |
U | Reverse_YFL047W | 1 | 1 | 3.9% | 714 | 82209 | 5.8 | RGD2 SGDID:S000001847, Chr VI from 40421-42565, Verified ORF, "GTPase-activating protein (RhoGAP) for Cdc42p and Rho5p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26904.26904.3 | 3.3818 | 0.219 | 93.3% | 3259.9443 | 3263.5862 | 68 | 3.966 | 20.4% | 1 | I.KNGLTSCFDLTAKKIANLRDSECKEMFS.L | 3 |
U | YHR020W | 2 | 6 | 3.9% | 688 | 77386 | 6.4 | YHR020W SGDID:S000001062, Chr VIII from 143989-146055, Uncharacterized ORF, "Protein required for cell viability" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25572.25572.2 | 4.9397 | 0.493 | 100.0% | 3053.672 | 3051.5818 | 1 | 9.096 | 42.3% | 2 | K.DAEEEVLQILDFYAGVYEELLAVPVVK.G | 2 |
* | 22_g_01_itms.25644.25644.3 | 5.7014 | 0.3734 | 100.0% | 3056.9343 | 3051.5818 | 1 | 6.822 | 30.8% | 4 | K.DAEEEVLQILDFYAGVYEELLAVPVVK.G | 3 |
U | YDL097C | 1 | 2 | 3.9% | 434 | 49774 | 6.3 | RPN6 SGDID:S000002255, Chr IV from 286695-285391, reverse complement, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid required for the assembly and activity of the 26S proteasome; the human homolog (S9 protein) partially rescues Rpn6p depletion" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10196.10196.2 | 3.4548 | 0.2045 | 100.0% | 2072.7722 | 2068.9539 | 2 | 5.422 | 50.0% | 2 | K.FEQVPDSLDDQIFVCEK.S | 2 |
U | Reverse_YHR027C | 2 | 3 | 3.8% | 993 | 109492 | 4.6 | RPN1 SGDID:S000001069, Chr VIII from 164704-161723, reverse complement, Verified ORF, "Non-ATPase base subunit of the 19S regulatory particle of the 26S proteasome; may participate in the recognition of several ligands of the proteasome; contains a leucine-rich repeat (LRR) domain, a site for protein?protein interactions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00816.00816.2 | 2.9281 | 0.1538 | 98.1% | 1224.6721 | 1222.4785 | 1 | 4.817 | 75.0% | 2 | E.GEADVEMEDVE.I | 2 |
* | 22_g_01_itms.26884.26884.3 | 3.288 | 0.0611 | 91.8% | 3096.7444 | 3099.5679 | 91 | 3.876 | 24.0% | 1 | N.LEKALYLFHESLKGNGIIDQVGEYEFS.T | 3 |
U | Reverse_YOR113W | 1 | 2 | 3.8% | 914 | 101170 | 7.4 | AZF1 SGDID:S000005639, Chr XV from 534075-536819, Verified ORF, "Zinc-finger transcription factor, involved in induction of CLN3 transcription in response to glucose; genetic and physical interactions indicate a possible role in mitochondrial transcription or genome maintenance" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27585.27585.3 | 3.2435 | 0.0686 | 90.7% | 3826.2244 | 3824.0208 | 41 | 3.82 | 18.4% | 2 | P.HNEPSSITSKKTGVGKGRGKIGRNSNKYISAFYEL.L | 3 |
U | Reverse_YNL068C | 1 | 1 | 3.8% | 862 | 94374 | 9.3 | FKH2 SGDID:S000005012, Chr XIV from 498290-495702, reverse complement, Verified ORF, "Transcription factor of the forkhead family that regulates the cell cycle and pseudohyphal growth; also involved in chromatin silencing at HML and HMR; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23723.23723.3 | 3.4936 | 0.264 | 93.0% | 3623.2444 | 3621.7566 | 200 | 4.789 | 18.8% | 1 | F.AKTPSRLLTDYPQSLRLSNAALS*STTTGTQPVS*.N | 3 |
U | YBR276C | 1 | 1 | 3.8% | 807 | 91685 | 7.1 | PPS1 SGDID:S000000480, Chr II from 760039-757616, reverse complement, Verified ORF, "Protein phosphatase with specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31440.31440.3 | 3.4642 | 0.2004 | 98.7% | 3634.6743 | 3641.7688 | 356 | 4.395 | 18.3% | 1 | N.LCSSPSEIVCFNNVDKNMVLCEKLELNKLTS.A | 3 |
U | Reverse_YEL065W | 1 | 1 | 3.8% | 628 | 70562 | 8.1 | SIT1 SGDID:S000000791, Chr V from 27657-29543, Verified ORF, "Ferrioxamine B transporter, member of the ARN family of transporters that specifically recognize siderophore-iron chelates; transcription is induced during iron deprivation and diauxic shift; potentially phosphorylated by Cdc28p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27918.27918.2 | 2.4124 | 0.24 | 98.4% | 2603.612 | 2602.4246 | 234 | 4.907 | 26.1% | 1 | T.FPSGYAQAALTPDSIRKSIEKPLI.N | 2 |
U | YIL099W | 1 | 1 | 3.8% | 549 | 61463 | 5.1 | SGA1 SGDID:S000001361, Chr IX from 178001-179650, Verified ORF, "Intracellular sporulation-specific glucoamylase involved in glycogen degradation; induced during starvation of a/a diploids late in sporulation, but dispensable for sporulation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22259.22259.2 | 2.4816 | 0.1292 | 91.8% | 2280.5522 | 2281.2056 | 36 | 4.349 | 32.5% | 1 | Y.NKLLGMLSVGFGFAWALENIT.I | 2 |
U | YBR078W | 1 | 1 | 3.8% | 468 | 48237 | 5.1 | ECM33 SGDID:S000000282, Chr II from 393118-393175,393506-394854, Verified ORF, "GPI-anchored protein of unknown function, has a possible role in apical bud growth; GPI-anchoring on the plasma membrane crucial to function; similar to Sps2p and Pst1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.02655.02655.3 | 2.8483 | 0.2742 | 98.8% | 1948.1344 | 1947.0472 | 173 | 4.519 | 32.4% | 1 | K.KITGDLNMQELIILTSAS.F | 3 |
U | YJL200C | 1 | 1 | 3.7% | 789 | 86583 | 7.0 | YJL200C SGDID:S000003736, Chr X from 58813-56444, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26846.26846.3 | 3.5513 | 0.2359 | 99.4% | 3026.2444 | 3028.305 | 234 | 4.784 | 22.3% | 1 | V.EYFGEGVSTLSCTGMATICNMGAEIGATT.S | 3 |
U | YFR053C | 1 | 2 | 3.7% | 485 | 53738 | 5.5 | HXK1 SGDID:S000001949, Chr VI from 255036-253579, reverse complement, Verified ORF, "Hexokinase isoenzyme 1, a cytosolic protein that catalyzes phosphorylation of glucose during glucose metabolism; expression is highest during growth on non-glucose carbon sources; glucose-induced repression involves the hexokinase Hxk2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12510.12510.2 | 3.514 | 0.3758 | 100.0% | 2183.3523 | 2182.9668 | 1 | 6.614 | 52.9% | 2 | R.IEDDPFENLEDTDDIFQK.D | 2 |
U | Reverse_YKR034W | 1 | 1 | 3.7% | 269 | 30166 | 8.6 | DAL80 SGDID:S000001742, Chr XI from 506540-507349, Verified ORF, "Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Deh1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32346.32346.2 | 1.0629 | 0.0651 | 90.9% | 1063.7122 | 1064.4868 | 59 | 4.323 | 50.0% | 1 | F.LGCANCLVTG.H | 2 |
U | Reverse_YML109W | 1 | 1 | 3.6% | 942 | 105496 | 5.4 | ZDS2 SGDID:S000004577, Chr XIII from 51640-54468, Verified ORF, "Protein that interacts with silencing proteins at the telomere, involved in transcriptional silencing; paralog of Zds1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21860.21860.3 | 3.8405 | 0.253 | 96.6% | 3870.6243 | 3866.6282 | 83 | 4.919 | 18.9% | 1 | A.TPSTNDEREAGIDEELGATTDRS*ISSHVEVDY*NV.D | 3 |
U | YNL287W | 1 | 1 | 3.6% | 935 | 104831 | 5.1 | SEC21 SGDID:S000005231, Chr XIV from 91994-94801, Verified ORF, "Gamma subunit of coatomer, a heptameric protein complex that together with Arf1p forms the COPI coat; involved in ER to Golgi transport of selective cargo" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16435.16435.3 | 4.511 | 0.2866 | 100.0% | 3902.5745 | 3895.6987 | 1 | 5.771 | 26.5% | 1 | K.EINPDTNEPFDGDEGFQDEYEIDSIFLNAGDYVK.S | 3 |
U | YLR451W | 1 | 1 | 3.6% | 886 | 100153 | 6.1 | LEU3 SGDID:S000004443, Chr XII from 1036089-1038749, Verified ORF, "Zinc-finger transcription factor that regulates genes involved in branched chain amino acid biosynthesis and ammonia assimilation; positively regulated by alpha-isopropylmalate, an intermediate in leucine biosynthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14160.14160.3 | 4.1841 | 0.1398 | 93.9% | 3814.8542 | 3813.9988 | 2 | 4.031 | 21.8% | 1 | S.QEEKQPLLHVLNQQLSQLEISLEENNLDDIRK.F | 3 |
U | Reverse_YPL032C | 1 | 1 | 3.6% | 825 | 92144 | 8.7 | SVL3 SGDID:S000005953, Chr XVI from 491362-488885, reverse complement, Verified ORF, "Protein of unknown function, mutant phenotype suggests a potential role in vacuolar function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery, cytoplasm, bud, and bud neck" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38940.38940.3 | 3.0003 | 0.145 | 93.8% | 3032.5745 | 3031.2913 | 1 | 4.823 | 26.7% | 1 | G.NDTSPSAMNAMQSSS*SLTPTSPASVSTTPP.P | 3 |
U | YMR297W | 1 | 1 | 3.6% | 532 | 59802 | 4.7 | PRC1 SGDID:S000004912, Chr XIII from 861921-863519, Verified ORF, "Vacuolar carboxypeptidase Y (proteinase C), involved in protein degradation in the vacuole and required for full protein degradation during sporulation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21848.21848.2 | 3.7959 | 0.3657 | 100.0% | 2428.5122 | 2427.1548 | 1 | 6.715 | 50.0% | 1 | K.DVYNFLELFFDQFPEYVNK.G | 2 |
U | YER060W | 1 | 1 | 3.6% | 528 | 58050 | 5.5 | FCY21 SGDID:S000000862, Chr V from 274565-276151, Verified ORF, "Putative purine-cytosine permease, very similar to Fcy2p but cannot substitute for its function" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12522.12522.2 | 1.8554 | 0.1923 | 95.6% | 2048.7922 | 2047.9078 | 2 | 4.535 | 38.9% | 1 | S.FGSTVYGFAAGWTTYAADY.T | 2 |
U | YOL059W | 1 | 2 | 3.6% | 440 | 49422 | 7.1 | GPD2 SGDID:S000005420, Chr XV from 217125-218447, Verified ORF, "NAD-dependent glycerol 3-phosphate dehydrogenase, homolog of Gpd1p, expression is controlled by an oxygen-independent signaling pathway required to regulate metabolism under anoxic conditions; located in cytosol and mitochondria" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15722.15722.2 | 4.5234 | 0.3477 | 100.0% | 1937.1921 | 1935.8091 | 1 | 6.905 | 70.0% | 2 | R.MEDLPEMIEELDIDDE.- | 2 |
U | YCL044C | 1 | 1 | 3.6% | 417 | 47156 | 9.3 | MGR1 SGDID:S000000549, Chr III from 48364-47111, reverse complement, Verified ORF, "Subunit, with Yme1p, of the mitochondrial inner membrane i-AAA protease complex, which is responsible for degradation of unfolded or misfolded mitochondrial gene products; required for growth of cells lacking the mitochondrial genome" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31789.31789.3 | 2.229 | 0.1564 | 93.4% | 1526.1843 | 1524.6641 | 268 | 3.968 | 37.5% | 1 | -.MAVFTPPSGNSNSTD.H | 3 |
U | YER028C | 1 | 1 | 3.6% | 394 | 43119 | 9.9 | MIG3 SGDID:S000000830, Chr V from 211875-210691, reverse complement, Verified ORF, "Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10045.10045.3 | 2.7427 | 0.1545 | 91.9% | 1831.3143 | 1827.8383 | 90 | 3.884 | 36.5% | 1 | N.DQRPFRCEICSRGF.H | 3 |
U | YNL243W | 1 | 1 | 3.5% | 968 | 108996 | 5.5 | SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27439.27439.3 | 2.8859 | 0.0976 | 94.1% | 3839.5144 | 3836.0051 | 287 | 4.056 | 15.9% | 1 | S.MATLVTNSKAYAVTTLPQEQSDQILTLVKRCARE.A | 3 |
U | Reverse_YBR276C | 1 | 1 | 3.5% | 807 | 91685 | 7.1 | PPS1 SGDID:S000000480, Chr II from 760039-757616, reverse complement, Verified ORF, "Protein phosphatase with specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11455.11455.3 | 3.4759 | 0.2147 | 91.5% | 3309.6243 | 3309.4792 | 104 | 4.753 | 22.2% | 1 | I.ES*PSSCLNLPTNNKFFENDLLPTGILT*Q.P | 3 |
U | YBL099W | 1 | 1 | 3.5% | 545 | 58618 | 9.0 | ATP1 SGDID:S000000195, Chr II from 37050-38687, Verified ORF, "Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.45655.45655.3 | 3.1183 | 0.2078 | 92.4% | 2134.2544 | 2135.149 | 218 | 4.769 | 31.9% | 1 | A.PGILPRRSVHEPVQT*GLKA.V | 3 |
U | Reverse_YCR045C | 1 | 1 | 3.5% | 491 | 55068 | 5.4 | YCR045C SGDID:S000000641, Chr III from 209605-208130, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12089.12089.2 | 2.1412 | 0.1728 | 93.5% | 1844.9722 | 1842.0383 | 205 | 4.426 | 31.2% | 1 | S.GLSLNAVCKKGQPRSVK.T | 2 |
U | YER090W | 1 | 1 | 3.4% | 507 | 56768 | 5.9 | TRP2 SGDID:S000000892, Chr V from 337945-339468, Verified ORF, "Anthranilate synthase, catalyzes the initial step of tryptophan biosynthesis, forms multifunctional hetero-oligomeric anthranilate synthase:indole-3-glycerol phosphate synthase enzyme complex with Trp3p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11563.11563.2 | 4.7669 | 0.3146 | 100.0% | 1844.6322 | 1841.9384 | 1 | 6.49 | 59.4% | 1 | K.TGPTEGIETDPLEILEK.E | 2 |
U | YBR293W | 1 | 1 | 3.4% | 474 | 51677 | 9.7 | VBA2 SGDID:S000000497, Chr II from 787001-788425, Verified ORF, "Permease of basic amino acids in the vacuolar membrane" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15546.15546.3 | 2.6634 | 0.0963 | 98.6% | 1902.0844 | 1905.0566 | 5 | 4.507 | 40.0% | 1 | S.YAYLFTLPLFFQIVLG.D | 3 |
U | YBR233W | 1 | 1 | 3.4% | 413 | 45782 | 7.7 | PBP2 SGDID:S000000437, Chr II from 683423-684664, Verified ORF, "RNA binding protein with similarity to mammalian heterogeneous nuclear RNP K protein, involved in the regulation of telomere position effect and telomere length" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07725.07725.2 | 2.5204 | 0.1809 | 96.0% | 1493.2522 | 1490.8075 | 2 | 4.642 | 57.7% | 1 | F.MASQAAIMLISNKI.E | 2 |
U | YAL060W | 1 | 1 | 3.4% | 382 | 41538 | 6.7 | BDH1 SGDID:S000000056, Chr I from 35156-36304, Verified ORF, "NAD-dependent (2R,3R)-2,3-butanediol dehydrogenase, a zinc-containing medium-chain alcohol dehydrogenase, produces 2,3-butanediol from acetoin during fermentation and allows using 2,3-butanediol as a carbon source during aerobic growth" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29497.29497.2 | 1.7259 | 0.1976 | 95.4% | 1416.0122 | 1416.8214 | 13 | 4.521 | 50.0% | 1 | M.AKKLGVEVFNPSK.H | 2 |
U | YIR033W | 1 | 1 | 3.3% | 1113 | 127054 | 5.2 | MGA2 SGDID:S000001472, Chr IX from 416121-419462, Verified ORF, "ER membrane protein involved, with its homolog Spt23p, in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24558.24558.3 | 3.1091 | 0.1556 | 95.1% | 4223.304 | 4218.923 | 330 | 4.127 | 16.0% | 1 | D.SVETDSNYSISRKYSQSSFNSSLLDNESLNENLFESQ.S | 3 |
U | YLR249W | 2 | 25 | 3.3% | 1044 | 115945 | 6.0 | YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18803.18803.3 | 4.7987 | 0.3144 | 100.0% | 3847.1643 | 3845.6548 | 6 | 6.224 | 22.7% | 22 | K.RAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I | 3 |
* | 22_g_01_itms.11849.11849.3 | 5.4703 | 0.412 | 100.0% | 3691.2544 | 3689.5535 | 1 | 7.367 | 30.5% | 3 | R.AVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I | 3 |
U | YAL035W | 1 | 3 | 3.3% | 1002 | 112268 | 5.8 | FUN12 SGDID:S000000033, Chr I from 76428-79436, Verified ORF, "GTPase, required for general translation initiation by promoting Met-tRNAiMet binding to ribosomes and ribosomal subunit joining; homolog of bacterial IF2" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23681.23681.3 | 4.8992 | 0.3808 | 100.0% | 3570.3542 | 3564.6348 | 1 | 6.468 | 25.0% | 3 | R.LLVVGPEDDEDELMDDVMDDLTGLLDSVDTTGK.G | 3 |
U | YKL064W | 1 | 1 | 3.3% | 969 | 109736 | 7.5 | MNR2 SGDID:S000001547, Chr XI from 317408-320317, Verified ORF, "Putative magnesium transporter; has similarity to Alr1p and Alr2p, which mediate influx of Mg2+ and other divalent cations" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26929.26929.3 | 3.4347 | 0.2198 | 91.7% | 3542.2744 | 3535.7603 | 132 | 3.861 | 19.4% | 1 | S.NDIIKSEDPSLKGAFIDHRPSMSQPREGPQSV.S | 3 |
U | YOR329C | 1 | 1 | 3.3% | 872 | 97305 | 7.8 | SCD5 SGDID:S000005856, Chr XV from 939344-936726, reverse complement, Verified ORF, "Protein required for normal cortical actin organization and endocytosis; multicopy suppressor of clathrin deficiency; acts as a targeting subunit for protein phosphatase type 1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27836.27836.3 | 3.1324 | 0.1274 | 93.5% | 3131.6343 | 3129.622 | 197 | 4.018 | 21.4% | 1 | L.SHFKQIQTVDSASLPISSVFLQNGNTLPT.S | 3 |
U | Reverse_YOR090C | 1 | 1 | 3.3% | 572 | 63669 | 8.6 | PTC5 SGDID:S000005616, Chr XV from 492842-491124, reverse complement, Verified ORF, "Mitochondrially localized type 2C protein phosphatase; contains Mg2+/Mn2+-dependent casein phosphatase activity in vitro but in vivo substrates are unknown" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39736.39736.3 | 2.5258 | 0.2285 | 97.2% | 1998.8043 | 2000.1544 | 223 | 4.23 | 30.6% | 1 | S.GSLLAINLAKSHSSIFLKT.R | 3 |
U | YOR310C | 1 | 3 | 3.3% | 511 | 56956 | 8.9 | NOP58 SGDID:S000005837, Chr XV from 898355-896820, reverse complement, Verified ORF, "Protein involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10593.10593.2 | 4.5157 | 0.3286 | 100.0% | 1960.4922 | 1959.9398 | 1 | 7.629 | 75.0% | 3 | K.ASETDLSEILPEEIEER.V | 2 |
U | YPL231W | 3 | 32 | 3.2% | 1887 | 206945 | 5.4 | FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25396.25396.3 | 6.0336 | 0.4019 | 100.0% | 3400.4343 | 3398.6167 | 1 | 6.726 | 27.5% | 21 | K.EFGTTPEKPEETPLEELAETFQDTFSGALGK.Q | 3 |
* | 22_g_01_itms.21000.21000.3 | 5.1588 | 0.2612 | 100.0% | 3487.5544 | 3487.6758 | 1 | 5.122 | 32.1% | 9 | K.DWVENELEALKLEAEEIPSEDQNEFLLER.T | 3 |
* | 22_g_01_itms.09243.09243.2 | 5.1946 | 0.4111 | 100.0% | 2162.2322 | 2161.03 | 1 | 7.585 | 70.6% | 2 | K.LEAEEIPSEDQNEFLLER.T | 2 |
U | YPL174C | 1 | 1 | 3.2% | 868 | 100290 | 5.8 | NIP100 SGDID:S000006095, Chr XVI from 222772-220166, reverse complement, Verified ORF, "Large subunit of the dynactin complex, which is involved in partitioning the mitotic spindle between mother and daughter cells; putative ortholog of mammalian p150(glued)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35499.35499.3 | 2.8875 | 0.1998 | 99.0% | 3288.9844 | 3292.718 | 8 | 4.644 | 22.2% | 1 | F.LYPSCDITLSSILTILFSDALFLRQDYK.R | 3 |
U | Reverse_YGR014W | 1 | 1 | 3.1% | 1306 | 133114 | 4.2 | MSB2 SGDID:S000003246, Chr VII from 516947-520867, Verified ORF, "Mucin family member at the head of the Cdc42p- and MAP kinase-dependent filamentous growth signaling pathway; also functions as an osmosensor in parallel to the Sho1p-mediated pathway; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22483.22483.3 | 3.2827 | 0.2052 | 96.6% | 3608.4243 | 3604.4263 | 85 | 4.217 | 17.3% | 1 | E.LTGADQYSNGSSSSVGSNSNSGSGSSGSNSNSSSSGDSSG.G | 3 |
U | Reverse_YIL002C | 1 | 1 | 3.1% | 946 | 108430 | 6.7 | INP51 SGDID:S000001264, Chr IX from 353428-350588, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31819.31819.3 | 3.164 | 0.1825 | 98.1% | 3038.5144 | 3040.4426 | 311 | 4.313 | 21.4% | 1 | R.KPEPIPTPSHTPGAISDSGEFSEIVFADD.S | 3 |
U | Reverse_YNL325C | 1 | 1 | 3.1% | 879 | 101746 | 5.7 | FIG4 SGDID:S000005269, Chr XIV from 31377-28738, reverse complement, Verified ORF, "Protein required for efficient mating, member of a family of eukaryotic proteins that contain a domain homologous to Sac1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26690.26690.3 | 2.6897 | 0.0157 | 92.3% | 3089.1543 | 3083.51 | 315 | 3.916 | 22.1% | 1 | Q.LAITDGLDHFLETLINVIDSDYELYSN.D | 3 |
U | Reverse_YJL090C | 1 | 1 | 3.1% | 764 | 87241 | 9.0 | DPB11 SGDID:S000003626, Chr X from 264967-262673, reverse complement, Verified ORF, "Essential BRCT repeat protein, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.46021.46021.3 | 1.8686 | 0.1488 | 97.9% | 2791.8245 | 2790.352 | 33 | 4.297 | 19.6% | 1 | D.NHSSTDKIVFNQYNYSSCGLKKIS.R | 3 |
U | YKL217W | 1 | 1 | 3.1% | 616 | 69376 | 5.9 | JEN1 SGDID:S000001700, Chr XI from 22234-24084, Verified ORF, "Lactate transporter, required for uptake of lactate and pyruvate; expression is derepressed by transcriptional activator Cat8p under nonfermentative growth conditions, and repressed in the presence of glucose, fructose, and mannose" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11233.11233.2 | 2.3113 | 0.1121 | 92.0% | 2096.372 | 2092.1958 | 32 | 4.368 | 33.3% | 1 | G.LVLFVRSAGAVIFGLWTDK.S | 2 |
U | Reverse_YDR323C | 1 | 1 | 3.1% | 515 | 59443 | 8.4 | PEP7 SGDID:S000002731, Chr IV from 1114022-1112475, reverse complement, Verified ORF, "Multivalent adaptor protein that facilitates vesicle-mediated vacuolar protein sorting by ensuring high-fidelity vesicle docking and fusion, which are essential for targeting of vesicles to the endosome; required for vacuole inheritance" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33464.33464.3 | 2.3714 | 0.144 | 94.8% | 1865.5443 | 1865.022 | 146 | 4.086 | 33.3% | 1 | I.GSLPMRVDKNFKRGIF.L | 3 |
U | Reverse_YDL238C | 1 | 1 | 3.1% | 489 | 55204 | 6.0 | GUD1 SGDID:S000002397, Chr IV from 30454-28985, reverse complement, Verified ORF, "Guanine deaminase, a catabolic enzyme of the guanine salvage pathway producing xanthine and ammonia from guanine; activity is low in exponentially-growing cultures but expression is increased in post-diauxic and stationary-phase cultures" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07611.07611.2 | 2.1708 | 0.1605 | 94.1% | 1686.6322 | 1687.923 | 9 | 4.436 | 46.4% | 1 | N.RTKDKGIIDVVTVDE.P | 2 |
U | Reverse_YOL126C | 1 | 1 | 3.1% | 423 | 46170 | 7.3 | MDH2 SGDID:S000005486, Chr XV from 83057-81786, reverse complement, Verified ORF, "Cytoplasmic malate dehydrogenase, one of the three isozymes that catalyze interconversion of malate and oxaloacetate; involved in gluconeogenesis during growth on ethanol or acetate as carbon source; interacts with Pck1p and Fbp1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.06770.06770.3 | 2.3895 | 0.1362 | 93.4% | 1312.5844 | 1314.5748 | 24 | 4.017 | 33.3% | 1 | L.CNEIGGAPSHSSV.S | 3 |
U | YJR132W | 1 | 1 | 3.0% | 1048 | 119983 | 4.7 | NMD5 SGDID:S000003893, Chr X from 669437-672583, Verified ORF, "Karyopherin, a carrier protein involved in nuclear import of proteins; importin beta homolog" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31315.31315.3 | 3.1837 | 0.166 | 93.4% | 3659.5144 | 3657.0508 | 86 | 3.976 | 20.8% | 1 | E.QCVVQKTTWKLVGPHYNVILQHVIFPLLKPT.A | 3 |
U | YEL032W | 1 | 2 | 3.0% | 971 | 107517 | 5.5 | MCM3 SGDID:S000000758, Chr V from 86937-89852, Verified ORF, "Protein involved in DNA replication; component of the Mcm2-7 hexameric complex that binds chromatin as a part of the pre-replicative complex" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08996.08996.3 | 4.6646 | 0.3229 | 100.0% | 3292.7944 | 3291.3872 | 1 | 5.828 | 25.9% | 2 | R.FQDDEQNAGEDDNDIMSPLPADEEAELQR.R | 3 |
U | Reverse_YNR047W | 1 | 1 | 3.0% | 893 | 100546 | 8.0 | YNR047W SGDID:S000005330, Chr XIV from 708525-711206, Uncharacterized ORF, "Putative protein kinase that, when overexpressed, interferes with pheromone-induced growth arrest; localizes to the cytoplasm; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.18379.18379.3 | 3.5884 | 0.1337 | 91.1% | 3112.9143 | 3106.7014 | 355 | 3.844 | 21.2% | 1 | D.AAGMKCGLRKSENKTLLKKILDKCTRS.I | 3 |
U | YJL047C | 1 | 1 | 3.0% | 842 | 99326 | 7.6 | RTT101 SGDID:S000003583, Chr X from 352024-349496, reverse complement, Verified ORF, "Cullin subunit of a Roc1p-dependent E3 ubiquitin ligase complex; deletion phenotype suggests a role in anaphase progression; interacts with Mms22p and implicated in Mms22-dependent DNA repair; modified by the ubiquitin-like protein, Rub1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.30315.30315.3 | 3.6267 | 0.252 | 98.6% | 3302.7244 | 3303.5242 | 12 | 5.04 | 25.0% | 1 | H.VLS*FLTRCDYSYEIIPKNWT*SFYKL.F | 3 |
U | YOL152W | 1 | 2 | 3.0% | 629 | 71997 | 9.1 | FRE7 SGDID:S000005512, Chr XV from 40747-42636, Verified ORF, "Putative ferric reductase with similarity to Fre2p; expression induced by low copper levels" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22205.22205.2 | 2.337 | 0.1735 | 91.9% | 1985.1322 | 1983.0876 | 67 | 4.342 | 33.3% | 2 | Y.LGIPTSVGTFLVVMATTLY.T | 2 |
U | YMR279C | 1 | 1 | 3.0% | 540 | 59562 | 8.2 | YMR279C SGDID:S000004892, Chr XIII from 826350-824728, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38101.38101.2 | 1.9804 | 0.1485 | 93.3% | 1928.0922 | 1927.882 | 176 | 5.112 | 36.7% | 1 | F.SIFKKKTSVQGT*DS*EI.D | 2 |
U | YKL221W | 1 | 1 | 3.0% | 473 | 52342 | 8.8 | MCH2 SGDID:S000001704, Chr XI from 6108-7529, Verified ORF, "Protein with similarity to mammalian monocarboxylate permeases, which are involved in transport of monocarboxylic acids across the plasma membrane; mutant is not deficient in monocarboxylate transport" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.06757.06757.2 | 2.2213 | 0.1033 | 95.8% | 1146.5122 | 1147.596 | 137 | 4.578 | 50.0% | 1 | R.SLASGIGTAGSGLG.G | 2 |
U | YLR383W | 1 | 1 | 2.9% | 1114 | 128008 | 7.5 | SMC6 SGDID:S000004375, Chr XII from 885288-888632, Verified ORF, "Protein involved in structural maintenance of chromosomes; required for interchromosomal and sister chromatid recombination; homologous to S. pombe rad18" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22679.22679.3 | 3.7776 | 0.188 | 96.3% | 3786.8943 | 3782.9712 | 260 | 4.181 | 19.4% | 1 | Q.MRQELEQLEKANEKLREVNNSLVVSLQDVKNE.E | 3 |
U | YER110C | 1 | 1 | 2.9% | 1113 | 122601 | 4.6 | KAP123 SGDID:S000000912, Chr V from 382099-378758, reverse complement, Verified ORF, "Karyopherin beta, mediates nuclear import of ribosomal proteins prior to assembly into ribosomes and import of histones H3 and H4; localizes to the nuclear pore, nucleus, and cytoplasm; exhibits genetic interactions with RAI1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07009.07009.3 | 5.3312 | 0.3531 | 100.0% | 3582.8342 | 3580.4993 | 1 | 6.351 | 29.8% | 1 | K.VACEEIDVDDELNNEDETGENEENTPSSSAIR.L | 3 |
U | YNL233W | 1 | 1 | 2.9% | 892 | 100590 | 5.1 | BNI4 SGDID:S000005177, Chr XIV from 211923-214601, Verified ORF, "Targeting subunit for Glc7p protein phosphatase, localized to the bud neck, required for localization of chitin synthase III to the bud neck via interaction with the chitin synthase III regulatory subunit Skt5p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23862.23862.3 | 2.4119 | 0.1558 | 91.9% | 2955.7744 | 2950.458 | 6 | 3.887 | 24.0% | 1 | N.MDLILGGDKQINTPLQEHVREDDDAK.N | 3 |
U | Reverse_YPR181C | 1 | 1 | 2.9% | 768 | 85385 | 5.7 | SEC23 SGDID:S000006385, Chr XVI from 899663-897357, reverse complement, Verified ORF, "GTPase-activating protein; component of the Sec23p-Sec24p heterodimeric complex of the COPII vesicle coat, involved in ER to Golgi transport and autophagy; stimulates the GDP-bound form of Sar1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27243.27243.2 | 2.4823 | 0.2257 | 97.2% | 2280.3123 | 2283.2283 | 24 | 4.781 | 31.0% | 1 | A.KHVAIRAMLVAAAEQDFSAAIA.P | 2 |
U | Reverse_YBR238C | 1 | 1 | 2.9% | 731 | 83761 | 7.5 | YBR238C SGDID:S000000442, Chr II from 697297-695102, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13034.13034.2 | 3.0259 | 0.2981 | 97.8% | 2260.2522 | 2259.1199 | 127 | 4.813 | 35.0% | 1 | H.PVFHNAPSVQYTALAPNNFTA.P | 2 |
U | Reverse_YOR372C | 1 | 1 | 2.9% | 554 | 60523 | 9.5 | NDD1 SGDID:S000005899, Chr XV from 1036467-1034803, reverse complement, Verified ORF, "Transcriptional activator essential for nuclear division; localized to the nucleus; essential component of the mechanism that activates the expression of a set of late-S-phase-specific genes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38578.38578.2 | 1.9561 | 0.2357 | 95.7% | 1831.9922 | 1832.9507 | 165 | 4.617 | 33.3% | 1 | N.SKLLNNLDVNSFVNQQ.Q | 2 |
U | YKL211C | 1 | 1 | 2.9% | 484 | 53489 | 6.9 | TRP3 SGDID:S000001694, Chr XI from 38154-36700, reverse complement, Verified ORF, "Bifunctional enzyme exhibiting both indole-3-glycerol-phosphate synthase and anthranilate synthase activities, forms multifunctional hetero-oligomeric anthranilate synthase:indole-3-glycerol phosphate synthase enzyme complex with Trp2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07833.07833.2 | 2.6836 | 0.2135 | 91.4% | 1561.4321 | 1560.7659 | 8 | 4.331 | 53.8% | 1 | R.NILNVSGGTWEENK.S | 2 |
U | Reverse_YNL287W | 1 | 1 | 2.8% | 935 | 104831 | 5.1 | SEC21 SGDID:S000005231, Chr XIV from 91994-94801, Verified ORF, "Gamma subunit of coatomer, a heptameric protein complex that together with Arf1p forms the COPI coat; involved in ER to Golgi transport of selective cargo" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10814.10814.3 | 3.1118 | 0.2759 | 98.2% | 3134.0942 | 3133.3584 | 311 | 5.315 | 24.0% | 1 | F.S*DTNSSIY*SSLKSELSPIDYFYKSEI.L | 3 |
U | Reverse_YPR029C | 1 | 1 | 2.8% | 832 | 93624 | 5.5 | APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21615.21615.2 | 2.219 | 0.1997 | 92.1% | 2470.3323 | 2467.2986 | 4 | 4.374 | 31.8% | 1 | E.PSSLFGLSTLALSVAYKNPHHLD.N | 2 |
U | Reverse_YOR035C | 1 | 1 | 2.8% | 789 | 89553 | 5.6 | SHE4 SGDID:S000005561, Chr XV from 400103-397734, reverse complement, Verified ORF, "Protein containing a UCS (UNC-45/CRO1/SHE4) domain, binds to myosin motor domains to regulate myosin function; involved in endocytosis, polarization of the actin cytoskeleton, and asymmetric mRNA localization" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16859.16859.2 | 2.6072 | 0.256 | 91.1% | 2556.5122 | 2560.3984 | 11 | 5.06 | 33.3% | 1 | F.LFPIANLAS*YKKFILGPNTFIL.M | 2 |
U | Reverse_YLR337C | 1 | 1 | 2.8% | 817 | 82594 | 9.9 | VRP1 SGDID:S000004329, Chr XII from 805106-802653, reverse complement, Verified ORF, "Proline-rich, actin-associated protein involved in cytoskeletal organization and cytokinesis; related to mammalian Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33258.33258.3 | 2.4101 | 0.1368 | 98.5% | 2089.4644 | 2090.165 | 44 | 4.382 | 26.1% | 1 | P.VAPAPSLPANPIPPAAVSPVAGP.I | 3 |
U | YGR178C | 1 | 1 | 2.8% | 722 | 78782 | 6.9 | PBP1 SGDID:S000003410, Chr VII from 853220-851052, reverse complement, Verified ORF, "Protein interacting with poly(A)-binding protein Pab1p; likely involved in control of the extent of mRNA polyadenylation; also interacts with Mkt1p to form a complex that may regulate translation of the HO mRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10433.10433.2 | 3.9019 | 0.3964 | 100.0% | 2181.392 | 2181.02 | 1 | 7.056 | 52.6% | 1 | R.GIIIDDSGLDEEDLYSGVDR.R | 2 |
U | Reverse_YGL150C | 1 | 1 | 2.7% | 1489 | 171455 | 5.7 | INO80 SGDID:S000003118, Chr VII from 225578-221109, reverse complement, Verified ORF, "ATPase that forms a large complex, containing actin and several actin-related proteins, that has chromatin remodeling activity and 3' to 5' DNA helicase activity in vitro; shows similarity to the Snf2p family of ATPases" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33482.33482.3 | 2.3466 | 0.2065 | 94.3% | 4315.1045 | 4311.9883 | 14 | 4.895 | 17.9% | 1 | N.NGDENEDGNVTVVTDAHT*QDDKIAKGIAAAAAADKKRS*KQ.I | 3 |
U | YDL073W | 1 | 1 | 2.7% | 984 | 113891 | 7.9 | YDL073W SGDID:S000002231, Chr IV from 326613-329567, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.37026.37026.2 | 1.5721 | 0.3407 | 100.0% | 3255.112 | 3255.5784 | 1 | 5.918 | 19.2% | 1 | D.FHFDT*ILLLT*VSPQISSSIQTSLFSWK.K | 2 |
U | YCR026C | 1 | 1 | 2.7% | 742 | 84734 | 4.6 | NPP1 SGDID:S000000621, Chr III from 166334-164106, reverse complement, Verified ORF, "Nucleotide pyrophosphatase/phosphodiesterase family member; mediates extracellular nucleotide phosphate hydrolysis along with Npp2p and Pho5p; activity and expression enhanced during conditions of phosphate starvation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09157.09157.2 | 2.2655 | 0.1846 | 90.4% | 2268.672 | 2268.1045 | 38 | 4.282 | 31.6% | 1 | R.KDYVSHAYLEGPMMAISLKD.S | 2 |
U | Reverse_YNL218W | 1 | 1 | 2.7% | 587 | 66544 | 8.4 | MGS1 SGDID:S000005162, Chr XIV from 238239-240002, Verified ORF, "Protein with DNA-dependent ATPase and ssDNA annealing activities involved in maintenance of genome; interacts functionally with DNA polymerase delta; homolog of human Werner helicase interacting protein (WHIP)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.15839.15839.2 | 2.2486 | 0.101 | 92.6% | 1891.2922 | 1887.9315 | 135 | 4.379 | 33.3% | 1 | A.VYLPDEGGQLMRALYY.L | 2 |
U | YIR019C | 1 | 2 | 2.6% | 1367 | 136110 | 4.3 | MUC1 SGDID:S000001458, Chr IX from 393672-389569, reverse complement, Verified ORF, "GPI-anchored cell surface glycoprotein required for diploid pseudohyphal formation and haploid invasive growth, transcriptionally regulated by the MAPK pathway (via Ste12p and Tec1p) and the cAMP pathway (via Flo8p)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.09542.09542.3 | 3.3936 | 0.1458 | 92.3% | 3309.2944 | 3313.4568 | 56 | 3.913 | 19.1% | 2 | T.TESSSAPVPTPSSSTTESSSAPAPTPSSSTTESSS.A | 3 |
U | YDR128W | 1 | 1 | 2.6% | 1148 | 130946 | 5.9 | YDR128W SGDID:S000002535, Chr IV from 709544-712990, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29719.29719.3 | 3.4365 | 0.1658 | 98.6% | 3343.3743 | 3348.701 | 353 | 4.49 | 20.7% | 1 | K.QGSRAISSSPFHSRMPDIKVELLHDDIIEA.Y | 3 |
U | YCR067C | 1 | 1 | 2.6% | 1065 | 114079 | 4.7 | SED4 SGDID:S000000663, Chr III from 236317-233120, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09566.09566.3 | 3.9775 | 0.2174 | 90.0% | 3090.5044 | 3091.355 | 135 | 4.74 | 21.3% | 1 | S.VASNLIPNEEILS*TSAS*QDSISSHPSTF.S | 3 |
U | YHR027C | 1 | 1 | 2.6% | 993 | 109492 | 4.6 | RPN1 SGDID:S000001069, Chr VIII from 164704-161723, reverse complement, Verified ORF, "Non-ATPase base subunit of the 19S regulatory particle of the 26S proteasome; may participate in the recognition of several ligands of the proteasome; contains a leucine-rich repeat (LRR) domain, a site for protein?protein interactions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.30176.30176.2 | 1.9095 | 0.2047 | 96.5% | 2587.652 | 2583.2942 | 245 | 4.669 | 24.0% | 1 | L.YVDEPEVKAGALLGIGISASGVHDGE.V | 2 |
U | YMR031C | 1 | 1 | 2.6% | 843 | 93345 | 6.3 | YMR031C SGDID:S000004633, Chr XIII from 334742-332211, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.30946.30946.2 | 2.0781 | 0.1592 | 90.5% | 2373.0322 | 2370.0374 | 1 | 4.31 | 35.7% | 1 | D.SLEHTFSGFSQGSSIEDDQDAI.S | 2 |
U | YFL009W | 1 | 1 | 2.6% | 779 | 86090 | 7.1 | CDC4 SGDID:S000001885, Chr VI from 116139-118478, Verified ORF, "F-box protein required for G1/S and G2/M transition, associates with Skp1p and Cdc53p to form a complex, SCFCdc4, which acts as ubiquitin-protein ligase directing ubiquitination of the phosphorylated CDK inhibitor Sic1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10197.10197.2 | 2.0438 | 0.1125 | 90.0% | 2002.3522 | 1998.9005 | 137 | 4.264 | 31.6% | 1 | T.GAASVDNDGLHNLTDISNDA.E | 2 |
U | YDR172W | 2 | 7 | 2.6% | 685 | 76551 | 7.0 | SUP35 SGDID:S000002579, Chr IV from 808319-810376, Verified ORF, "Translation termination factor eRF3; altered protein conformation creates the [PSI(+)] prion, a dominant cytoplasmically inherited protein aggregate that alters translational fidelity and creates a nonsense suppressor phenotype" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10495.10495.2 | 5.1549 | 0.5166 | 100.0% | 2068.912 | 2068.8657 | 1 | 9.807 | 67.6% | 5 | K.EQEEEVDDEVVNDMFGGK.D | 2 |
* | 22_g_01_itms.10515.10515.3 | 3.7712 | 0.1525 | 99.0% | 2071.1042 | 2068.8657 | 1 | 4.607 | 38.2% | 2 | K.EQEEEVDDEVVNDMFGGK.D | 3 |
U | Reverse_YIR006C | 1 | 1 | 2.5% | 1480 | 160266 | 5.3 | PAN1 SGDID:S000001445, Chr IX from 369905-365463, reverse complement, Verified ORF, "Part of actin cytoskeleton-regulatory complex Pan1p-Sla1p-End3p, associates with actin patches on the cell cortex; promotes protein-protein interactions essential for endocytosis; previously thought to be a subunit of poly(A) ribonuclease" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20176.20176.3 | 3.7525 | 0.2076 | 98.9% | 3762.2344 | 3761.7612 | 36 | 4.674 | 19.4% | 1 | M.VSGYGGTYQSQLAGGTLQPGLNVGFSTQPMMGTTQPM.M | 3 |
U | YDR069C | 1 | 1 | 2.5% | 926 | 105192 | 8.2 | DOA4 SGDID:S000002476, Chr IV from 587716-584936, reverse complement, Verified ORF, "Ubiquitin hydrolase, required for recycling ubiquitin from proteasome-bound ubiquitinated intermediates, acts at the late endosome/prevacuolar compartment to recover ubiquitin from ubiquitinated membrane proteins en route to the vacuole" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.30620.30620.2 | 2.2503 | 0.2331 | 95.5% | 2555.3323 | 2556.226 | 21 | 4.495 | 27.3% | 1 | M.SPSIRHSMDDSMKEMLVAPTPLN.H | 2 |
U | Reverse_YOL006C | 1 | 1 | 2.5% | 769 | 89995 | 8.7 | TOP1 SGDID:S000005366, Chr XV from 315387-313078, reverse complement, Verified ORF, "Topoisomerase I, nuclear enzyme that relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled DNA; functions in replication, transcription, and recombination" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07261.07261.3 | 2.9718 | 0.1915 | 95.3% | 2094.3245 | 2092.1038 | 5 | 4.136 | 34.7% | 1 | V.SLRPDIYNIKSTGLSVQSN.E | 3 |
U | YLL018C | 1 | 2 | 2.5% | 557 | 63516 | 6.6 | DPS1 SGDID:S000003941, Chr XII from 111574-109901, reverse complement, Verified ORF, "Cytoplasmic aspartyl-tRNA synthetase, homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.06708.06708.2 | 2.452 | 0.1847 | 96.4% | 1626.0922 | 1625.7183 | 25 | 4.673 | 50.0% | 2 | K.EIGDFEDLSTENEK.F | 2 |
U | YOR124C | 1 | 1 | 2.4% | 1272 | 146354 | 5.2 | UBP2 SGDID:S000005650, Chr XV from 558642-554824, reverse complement, Verified ORF, "Ubiquitin-specific protease that removes ubiquitin from ubiquitinated proteins, cleaves at the C terminus of ubiquitin fusions; capable of cleaving polyubiquitin and possesses isopeptidase activity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35758.35758.3 | 3.1331 | 0.0429 | 91.7% | 3564.7444 | 3557.7434 | 67 | 3.868 | 21.7% | 1 | E.CNISELNEATLLSIYKYETSNKSQVTSNHLT.N | 3 |
U | YOR330C | 1 | 1 | 2.4% | 1254 | 143502 | 8.8 | MIP1 SGDID:S000005857, Chr XV from 943380-939616, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial DNA polymerase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.13729.13729.3 | 3.0301 | 0.0316 | 94.3% | 3677.3643 | 3672.0205 | 7 | 4.058 | 22.4% | 1 | I.KDIVLLKDKPDFYLKDPWLSQLDWTTKPLR.L | 3 |
U | Reverse_YDR507C | 1 | 1 | 2.4% | 1142 | 129858 | 9.2 | GIN4 SGDID:S000002915, Chr IV from 1465776-1462348, reverse complement, Verified ORF, "Protein kinase involved in bud growth and assembly of the septin ring, proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Kcc4p and Hsl1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22047.22047.2 | 2.1592 | 0.134 | 95.9% | 3241.2722 | 3239.6582 | 3 | 4.646 | 30.8% | 1 | R.IKQVSKNLPPEMDDVVKERKEQDEEQK.H | 2 |
U | YGR162W | 1 | 2 | 2.4% | 952 | 107101 | 6.0 | TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14484.14484.2 | 3.0995 | 0.2659 | 99.3% | 2554.3323 | 2553.2036 | 2 | 4.979 | 31.8% | 2 | K.DATPIEDVFSFNYPEGIEGPDIK.Y | 2 |
U | YJL094C | 1 | 1 | 2.4% | 873 | 97111 | 6.1 | KHA1 SGDID:S000003630, Chr X from 254358-251737, reverse complement, Verified ORF, "Putative K+/H+ antiporter" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35488.35488.2 | 2.1019 | 0.2419 | 95.2% | 2331.8523 | 2328.2917 | 289 | 5.187 | 27.5% | 1 | E.IVVLT*VGLNAGIISRKIFGMF.V | 2 |
U | YLR234W | 1 | 1 | 2.4% | 656 | 74371 | 8.5 | TOP3 SGDID:S000004224, Chr XII from 609785-611755, Verified ORF, "DNA Topoisomerase III, conserved protein that functions in a complex with Sgs1p and Rmi1p to relax single-stranded negatively-supercoiled DNA preferentially, involved in telomere stability and regulation of mitotic recombination" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.02102.02102.3 | 2.3511 | 0.1234 | 90.7% | 1855.0443 | 1857.8342 | 170 | 3.82 | 30.0% | 1 | G.IDFSHDSHGWGKCAIQ.E | 3 |
U | Reverse_YNL088W | 1 | 1 | 2.3% | 1428 | 164214 | 7.0 | TOP2 SGDID:S000005032, Chr XIV from 457706-461992, Verified ORF, "Essential type II topoisomerase, relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone of both positively and negatively supercoiled DNA; cleaves complementary strands; localizes to axial cores in meiosis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.24744.24744.3 | 3.6436 | 0.146 | 92.6% | 3654.0842 | 3658.564 | 151 | 3.927 | 19.5% | 1 | Y.LEEPGNIVNETDEHSSEEDEEDSTAGKVDNIQE.A | 3 |
U | Reverse_YBL085W | 1 | 1 | 2.3% | 980 | 109295 | 9.1 | BOI1 SGDID:S000000181, Chr II from 63873-66815, Verified ORF, "Protein implicated in polar growth, functionally redundant with Boi2p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17576.17576.2 | 2.6863 | 0.1818 | 97.5% | 2680.2322 | 2678.4492 | 46 | 4.782 | 27.3% | 1 | V.RPETFTLGKKSGPQPPVLKFCYK.G | 2 |
U | YOR038C | 1 | 1 | 2.3% | 875 | 98445 | 8.3 | HIR2 SGDID:S000005564, Chr XV from 405387-402760, reverse complement, Verified ORF, "Non-essential transcriptional corepressor involved in the cell cycle-regulated transcription of histone H2A, H2B, H3, and H4 genes; recruits Swi-Snf complexes to histone gene promoters; promotes heterochromatic gene silencing with Asf1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.29269.29269.3 | 2.3759 | 0.0141 | 91.9% | 1952.0343 | 1950.0773 | 178 | 3.878 | 31.6% | 1 | S.ASAAPIPNDIGRSAVGKKPT.K | 3 |
U | Reverse_YGR196C | 1 | 1 | 2.3% | 817 | 90798 | 4.6 | FYV8 SGDID:S000003428, Chr VII from 892191-889738, reverse complement, Verified ORF, "Protein of unknown function, required for survival upon exposure to K1 killer toxin" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.36612.36612.3 | 2.1843 | 0.1536 | 93.5% | 1943.3043 | 1944.0038 | 25 | 4.021 | 34.7% | 1 | K.TENAVPKPKAVKDQGSSTS.N | 3 |
U | YBR142W | 1 | 2 | 2.3% | 773 | 87048 | 8.4 | MAK5 SGDID:S000000346, Chr II from 528311-530632, Verified ORF, "Essential nucleolar protein, putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07471.07471.2 | 4.04 | 0.2942 | 100.0% | 1989.7522 | 1986.8069 | 1 | 6.691 | 58.8% | 2 | K.AADELGIDVDS*DEDDISK.S | 2 |
U | YOL057W | 1 | 1 | 2.3% | 711 | 80510 | 6.3 | YOL057W SGDID:S000005418, Chr XV from 220765-222900, Uncharacterized ORF, "Putative metalloprotease" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.37770.37770.3 | 2.2741 | 0.0705 | 91.9% | 1563.1144 | 1564.8447 | 1 | 3.886 | 43.3% | 1 | L.GNILSAAAKSSSKHPP.S | 3 |
U | YOL141W | 1 | 1 | 2.3% | 695 | 78975 | 7.0 | PPM2 SGDID:S000005501, Chr XV from 56450-58537, Verified ORF, "Putative carboxyl methyl transferase, has similarity to Ppm1p but biochemical activity not yet demonstrated" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08841.08841.3 | 2.3543 | 0.081 | 92.2% | 1843.4343 | 1843.037 | 9 | 3.909 | 40.0% | 1 | I.ILEQLIPKGPFEPFSK.Q | 3 |
U | YDL063C | 1 | 1 | 2.3% | 620 | 70164 | 5.2 | YDL063C SGDID:S000002221, Chr IV from 340134-338272, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.30047.30047.3 | 1.2526 | 0.1434 | 92.2% | 1595.2444 | 1593.7073 | 220 | 3.907 | 36.5% | 1 | M.TNSLFQIYGDASYD.Y | 3 |
U | Reverse_YPL194W | 1 | 1 | 2.3% | 612 | 69694 | 6.6 | DDC1 SGDID:S000006115, Chr XVI from 179276-181114, Verified ORF, "DNA damage checkpoint protein, part of a PCNA-like complex required for DNA damage response, required for pachytene checkpoint to inhibit cell cycle in response to unrepaired recombination intermediates; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.22793.22793.2 | 2.3348 | 0.2001 | 92.8% | 1543.0122 | 1545.7471 | 11 | 4.395 | 46.2% | 1 | R.PKEVQTLGLGDEME.K | 2 |
U | YNL275W | 1 | 1 | 2.3% | 576 | 65028 | 7.8 | YNL275W SGDID:S000005219, Chr XIV from 119268-120998, Verified ORF, "Plasma membrane protein that binds HCO3-, I-, Br-, NO3- and Cl- ; putative boron efflux transporter with similarity to A. thaliana BOR1 which is a known boron efflux transporter" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38338.38338.3 | 1.8963 | 0.1605 | 92.3% | 1342.4644 | 1342.7041 | 259 | 3.906 | 29.2% | 1 | L.VCLGEIPQAVLSG.L | 3 |
U | YLR259C | 1 | 2 | 2.3% | 572 | 60752 | 5.3 | HSP60 SGDID:S000004249, Chr XII from 665004-663286, reverse complement, Verified ORF, "Tetradecameric mitochondrial chaperonin required for ATP-dependent folding of precursor polypeptides and complex assembly; prevents aggregation and mediates protein refolding after heat shock; role in mtDNA transmission; similarity to groEL" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08732.08732.2 | 3.9917 | 0.3256 | 100.0% | 1522.1522 | 1521.7107 | 1 | 6.936 | 62.5% | 2 | R.TLEDELEVTEGMR.F | 2 |
U | Reverse_YGL197W | 2 | 2 | 2.2% | 1487 | 167074 | 7.7 | MDS3 SGDID:S000003165, Chr VII from 124703-129166, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Pmd1p, for growth under alkaline conditions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32540.32540.2 | 1.6366 | 0.2548 | 99.6% | 1092.0322 | 1092.565 | 64 | 5.214 | 50.0% | 1 | F.PKGSASSTRTT.S | 2 |
* | 22_g_01_itms.35388.35388.2 | 2.5326 | 0.2235 | 96.9% | 2453.4722 | 2452.432 | 1 | 4.764 | 32.5% | 1 | L.SLSEEKKALISYLVELILKYL.L | 2 |
U | Reverse_YBL007C | 1 | 1 | 2.2% | 1244 | 135848 | 5.9 | SLA1 SGDID:S000000103, Chr II from 216369-212635, reverse complement, Verified ORF, "Cytoskeletal protein binding protein required for assembly of the cortical actin cytoskeleton; contains 3 SH3 domains; interacts with proteins regulating actin dynamics and with proteins required for endocytosis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11240.11240.2 | 2.6212 | 0.1696 | 90.5% | 2491.8323 | 2488.3298 | 12 | 4.318 | 28.8% | 1 | D.LPAPASSVPASSVPAAPVTTGGTKVPE.L | 2 |
U | Reverse_YOR109W | 1 | 1 | 2.2% | 1107 | 124577 | 7.2 | INP53 SGDID:S000005635, Chr XV from 525278-528601, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in a TGN (trans Golgi network)-to-early endosome pathway; hyperosmotic stress causes translocation to actin patches" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.26558.26558.2 | 2.0082 | 0.1732 | 90.2% | 2439.4321 | 2443.302 | 186 | 4.281 | 26.1% | 1 | V.TEGPCPQAVKSKGTIAGVFLLGNV.E | 2 |
U | Reverse_YBL052C | 1 | 1 | 2.2% | 831 | 97582 | 6.5 | SAS3 SGDID:S000000148, Chr II from 121877-119382, reverse complement, Verified ORF, "Histone acetyltransferase catalytic subunit of NuA3 complex that acetylates histone H3, involved in transcriptional silencing; homolog of the mammalian MOZ proto-oncogene; sas3 gcn5 double mutation confers lethality" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.14191.14191.2 | 2.3165 | 0.1807 | 95.3% | 2246.3523 | 2249.9258 | 24 | 4.477 | 35.3% | 1 | N.KYDCMYETLSSVTDEFFD.T | 2 |
U | YBR202W | 1 | 1 | 2.2% | 845 | 94875 | 5.3 | CDC47 SGDID:S000000406, Chr II from 625767-628304, Verified ORF, "Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38677.38677.3 | 2.3032 | 0.3188 | 97.6% | 2279.6643 | 2283.1274 | 160 | 4.982 | 30.6% | 1 | K.VANRELNS*VIIDLDDILQY.Q | 3 |
U | Reverse_YGR261C | 1 | 1 | 2.2% | 809 | 91607 | 5.8 | APL6 SGDID:S000003493, Chr VII from 1016756-1014327, reverse complement, Verified ORF, "Beta3-like subunit of the yeast AP-3 complex; functions in transport of alkaline phosphatase to the vacuole via the alternate pathway; exists in both cytosolic and peripherally associated membrane-bound pools" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35359.35359.3 | 1.9655 | 0.1316 | 94.0% | 1973.5443 | 1972.0616 | 36 | 4.045 | 30.9% | 1 | E.LRASVIFDDSRATPKPAQ.L | 3 |
U | Reverse_YJL168C | 1 | 1 | 2.2% | 733 | 84540 | 8.5 | SET2 SGDID:S000003704, Chr X from 104421-102220, reverse complement, Verified ORF, "Histone methyltransferase with a role in transcriptional elongation, methylates a lysine residue of histone H3; associates with the C-terminal domain of Rpo21p; histone methylation activity is regulated by phosphorylation status of Rpo21p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17431.17431.3 | 2.8249 | 0.0724 | 96.3% | 1983.4744 | 1985.1198 | 67 | 4.182 | 36.7% | 1 | G.NEHIIEWGPPLRVRRL.D | 3 |
U | Reverse_YKR098C | 1 | 1 | 2.2% | 717 | 82703 | 8.4 | UBP11 SGDID:S000001806, Chr XI from 634817-632664, reverse complement, Verified ORF, "Ubiquitin-specific protease that cleaves ubiquitin from ubiquitinated proteins" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33919.33919.3 | 2.6145 | 0.196 | 98.6% | 1700.1244 | 1701.9064 | 2 | 4.508 | 40.0% | 1 | E.IVPLNYAKPASSEIAE.I | 3 |
U | YJR016C | 1 | 1 | 2.2% | 585 | 62861 | 7.8 | ILV3 SGDID:S000003777, Chr X from 466122-464365, reverse complement, Verified ORF, "Dihydroxyacid dehydratase, catalyzes third step in the common pathway leading to biosynthesis of branched-chain amino acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.05081.05081.2 | 4.3911 | 0.2596 | 100.0% | 1433.1322 | 1431.6604 | 3 | 5.278 | 70.8% | 1 | R.DGDEIIIDADNNK.I | 2 |
U | YHR019C | 1 | 1 | 2.2% | 554 | 62207 | 5.8 | DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11501.11501.2 | 2.334 | 0.1744 | 99.3% | 1386.5521 | 1384.6129 | 1 | 5.173 | 63.6% | 1 | R.IDDMDELMAGFK.R | 2 |
U | YGL133W | 1 | 1 | 2.1% | 1264 | 145642 | 5.7 | ITC1 SGDID:S000003101, Chr VII from 257712-261506, Verified ORF, "Component of the ATP-dependent Isw2p-Itc1p chromatin remodeling complex, required for repression of a-specific genes, repression of early meiotic genes during mitotic growth, and repression of INO1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16196.16196.3 | 3.1 | 0.1655 | 90.4% | 3111.6543 | 3110.449 | 348 | 3.805 | 21.0% | 1 | L.FINEEGDWSCIVVENWIIDDKGVLME.R | 3 |
U | YBL051C | 1 | 1 | 2.1% | 668 | 73776 | 6.2 | PIN4 SGDID:S000000147, Chr II from 124762-122756, reverse complement, Verified ORF, "Protein involved in G2/M phase progression and response to DNA damage, interacts with Rad53p; contains an RNA recognition motif, a nuclear localization signal, and several SQ/TQ cluster domains; hyperphosphorylated in response to DNA damage" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.10188.10188.2 | 1.9973 | 0.2023 | 95.7% | 1378.7922 | 1377.661 | 56 | 4.604 | 46.2% | 1 | N.NNSASSTPKISSQG.Q | 2 |
U | YKL182W | 2 | 4 | 2.0% | 2051 | 228689 | 5.9 | FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09567.09567.2 | 3.5516 | 0.427 | 100.0% | 2498.4521 | 2497.2349 | 7 | 6.907 | 32.6% | 2 | K.ILPEPTEGFAADDEPTTPAELVGK.F | 2 |
* | 22_g_01_itms.11245.11245.2 | 4.3468 | 0.3928 | 100.0% | 1855.5521 | 1853.8921 | 1 | 7.534 | 73.3% | 2 | K.DIQIPVYDTFDGSDLR.V | 2 |
U | YNL091W | 1 | 1 | 2.0% | 1240 | 141514 | 5.4 | NST1 SGDID:S000005035, Chr XIV from 452410-456132, Verified ORF, "Protein of unknown function, mediates sensitivity to salt stress; interacts physically with the splicing factor Msl1p and also displays genetic interaction with MSL1" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23409.23409.3 | 3.4156 | 0.1213 | 91.3% | 3237.8643 | 3237.876 | 34 | 3.846 | 25.0% | 1 | N.NRLKLLQELEEEKRKKREKEEKKQK.K | 3 |
U | Reverse_YJL076W | 1 | 1 | 2.0% | 1189 | 128531 | 7.8 | NET1 SGDID:S000003612, Chr X from 295161-298730, Verified ORF, "Core subunit of the RENT complex, which is a complex involved in nucleolar silencing and telophase exit; stimulates transcription by RNA polymerase I and regulates nucleolar structure" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35298.35298.2 | 1.984 | 0.2088 | 92.4% | 2555.2522 | 2559.5322 | 1 | 4.375 | 32.6% | 1 | N.KKAGALLQAARKAASRPTRQPLIN.R | 2 |
U | Reverse_YML010W | 1 | 1 | 2.0% | 1063 | 115650 | 5.2 | SPT5 SGDID:S000004470, Chr XIII from 247677-250868, Verified ORF, "Protein that forms a complex with Spt4p and mediates both activation and inhibition of transcription elongation; Spt4p-Spt5p complex also plays a role in pre-mRNA processing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08623.08623.2 | 2.1757 | 0.2047 | 96.7% | 2484.4722 | 2480.286 | 40 | 4.71 | 30.0% | 1 | E.DFKGYDLRPVIKLMVELNNES.I | 2 |
U | Reverse_YNL327W | 1 | 1 | 2.0% | 1041 | 108495 | 4.8 | EGT2 SGDID:S000005271, Chr XIV from 24047-27172, Verified ORF, "Glycosylphosphatidylinositol (GPI)-anchored cell wall endoglucanase required for proper cell separation after cytokinesis, expression is activated by Swi5p and tightly regulated in a cell cycle-dependent manner" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35458.35458.3 | 2.4073 | 0.3268 | 99.7% | 2075.3643 | 2074.9417 | 111 | 5.07 | 30.0% | 1 | T.TFTSNSSSPASLSISSSSAQE.S | 3 |
U | YJL130C | 3 | 6 | 1.9% | 2214 | 245123 | 5.9 | URA2 SGDID:S000003666, Chr X from 172285-165641, reverse complement, Verified ORF, "Bifunctional carbamoylphosphate synthetase (CPSase)-aspartate transcarbamylase (ATCase), catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07037.07037.2 | 3.3343 | 0.4123 | 100.0% | 1587.8522 | 1586.6896 | 1 | 7.408 | 57.7% | 2 | K.ELTSMDEAESFAEK.V | 2 |
* | 22_g_01_itms.13771.13771.2 | 3.3626 | 0.3253 | 100.0% | 2957.9321 | 2957.4268 | 3 | 5.763 | 32.7% | 1 | R.FSITEEAIADNLDAAEDAIPEQPLEQK.L | 2 |
* | 22_g_01_itms.13865.13865.3 | 4.0022 | 0.1648 | 98.7% | 2958.2944 | 2957.4268 | 68 | 4.388 | 25.0% | 3 | R.FSITEEAIADNLDAAEDAIPEQPLEQK.L | 3 |
U | Reverse_YNL273W | 1 | 1 | 1.9% | 1238 | 141120 | 6.1 | TOF1 SGDID:S000005217, Chr XIV from 122883-126599, Verified ORF, "Subunit of a replication-pausing checkpoint complex (Tof1p-Mrc1p-Csm3p) that acts at the stalled replication fork to promote sister chromatid cohesion after DNA damage, facilitating gap repair of damaged DNA; interacts with the MCM helicase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07508.07508.3 | 2.9812 | 0.1336 | 90.1% | 2671.9744 | 2672.426 | 13 | 3.797 | 28.3% | 1 | K.NWKKSDDLKQLAIKEDVLAQSGSV.T | 3 |
U | Reverse_YDL215C | 1 | 1 | 1.9% | 1092 | 124332 | 5.7 | GDH2 SGDID:S000002374, Chr IV from 73919-70641, reverse complement, Verified ORF, "NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.25222.25222.2 | 2.1278 | 0.1686 | 94.3% | 2423.652 | 2426.373 | 2 | 4.437 | 35.0% | 1 | E.DKNEVSRTTKIVPGEREKVLK.L | 2 |
U | YGR100W | 1 | 1 | 1.9% | 950 | 109259 | 5.4 | MDR1 SGDID:S000003332, Chr VII from 690249-693101, Verified ORF, "Cytoplasmic GTPase-activating protein for Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08858.08858.3 | 2.9828 | 0.2048 | 97.4% | 2190.3542 | 2186.2532 | 404 | 4.235 | 29.4% | 1 | P.MFRKLIRIGVPNRMRGEI.W | 3 |
U | YMR275C | 1 | 1 | 1.9% | 976 | 109174 | 8.7 | BUL1 SGDID:S000004888, Chr XIII from 818580-815650, reverse complement, Verified ORF, "Ubiquitin-binding component of the Rsp5p E3-ubiquitin ligase complex, functional homolog of Bul2p, disruption causes temperature-sensitive growth, overexpression causes missorting of amino acid permeases" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00240.00240.2 | 2.0824 | 0.1049 | 95.5% | 2103.4321 | 2107.1511 | 6 | 4.484 | 36.1% | 1 | L.SINYTIDARIVGKDQKASK.L | 2 |
U | YLR289W | 1 | 1 | 1.9% | 645 | 73188 | 9.2 | GUF1 SGDID:S000004280, Chr XII from 715091-717028, Verified ORF, "Mitochondrial GTPase of unknown function, similar to E. coli elongation factor-type GTP-binding protein LepA and to LK1236.1 from Caenorhabditis elegans" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.35418.35418.2 | 1.847 | 0.1033 | 97.0% | 1268.0122 | 1266.6079 | 3 | 4.734 | 54.5% | 1 | V.AHVDHGKSTLSD.R | 2 |
U | Reverse_YPL231W | 2 | 2 | 1.8% | 1887 | 206945 | 5.4 | FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.37658.37658.2 | 1.8969 | 0.1081 | 91.8% | 1470.7522 | 1469.8328 | 333 | 4.355 | 36.7% | 1 | Q.LLGQLVEAGISGKGAG.T | 2 |
* | 22_g_01_itms.13163.13163.2 | 2.4082 | 0.1861 | 93.3% | 1427.8722 | 1429.7803 | 101 | 4.422 | 38.2% | 1 | A.AAAPAAAAVPAPAAAAPA.P | 2 |
U | YOR116C | 1 | 1 | 1.8% | 1460 | 162301 | 8.2 | RPO31 SGDID:S000005642, Chr XV from 544145-539763, reverse complement, Verified ORF, "RNA polymerase III subunit C160, part of core enzyme; similar to bacterial beta-prime subunit" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08940.08940.3 | 2.8423 | 0.051 | 93.5% | 2902.5244 | 2900.582 | 50 | 4.02 | 24.0% | 1 | K.TFHFAGVASMNVTLGVPRIKEIINASK.V | 3 |
U | YBL076C | 1 | 1 | 1.8% | 1072 | 122983 | 6.1 | ILS1 SGDID:S000000172, Chr II from 84259-81041, reverse complement, Verified ORF, "Cytoplasmic isoleucine-tRNA synthetase, target of the G1-specific inhibitor reveromycin A" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.11579.11579.2 | 3.0927 | 0.1764 | 99.3% | 1986.5322 | 1983.9988 | 1 | 5.026 | 58.3% | 1 | K.NGVISEDSVLPNAIDDLGR.F | 2 |
U | Reverse_YBR038W | 1 | 1 | 1.8% | 963 | 109882 | 8.6 | CHS2 SGDID:S000000242, Chr II from 311897-314788, Verified ORF, "Chitin synthase II, requires activation from zymogenic form in order to catalyze the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for the synthesis of chitin in the primary septum during cytokinesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32575.32575.2 | 2.3288 | 0.172 | 92.9% | 2181.8523 | 2181.8909 | 55 | 5.184 | 37.5% | 1 | A.Y*RNPAVPS*NHASDRYFQ.T | 2 |
U | YBR086C | 1 | 1 | 1.8% | 946 | 105854 | 9.0 | IST2 SGDID:S000000290, Chr II from 423035-420195, reverse complement, Verified ORF, "Plasma membrane protein that may be involved in osmotolerance, localizes to the mother cell in small-budded cells and to the bud in medium- and large-budded cells; mRNA is transported to the bud tip by an actomyosin-driven process" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34887.34887.3 | 2.4962 | 0.2619 | 92.1% | 1781.8744 | 1778.7655 | 274 | 4.787 | 35.9% | 1 | K.VPTVGS*YGVAGATLPET*.I | 3 |
U | Reverse_YKL171W | 1 | 1 | 1.8% | 928 | 103956 | 8.8 | YKL171W SGDID:S000001654, Chr XI from 127480-130266, Uncharacterized ORF, "Putative protein of unknown function; predicted protein kinase; implicated in proteasome function; epitope-tagged protein localizes to the cytoplasm" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07741.07741.3 | 2.8184 | 0.1534 | 95.1% | 2170.8542 | 2169.0916 | 206 | 4.133 | 35.9% | 1 | R.CREAFPIKSRKFEDWSI.V | 3 |
U | Reverse_YLR386W | 1 | 1 | 1.8% | 880 | 99772 | 5.5 | VAC14 SGDID:S000004378, Chr XII from 893628-896270, Verified ORF, "Protein involved in regulated synthesis of PtdIns(3,5)P(2), in control of trafficking of some proteins to the vacuole lumen via the MVB, and in maintenance of vacuole size and acidity; activator of Fab1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.06762.06762.3 | 2.4732 | 0.1163 | 91.4% | 1840.5243 | 1844.2029 | 161 | 3.856 | 31.7% | 1 | S.LLKLLVSLIKSLFPIF.V | 3 |
U | Reverse_YAL041W | 1 | 1 | 1.8% | 854 | 96940 | 8.5 | CDC24 SGDID:S000000039, Chr I from 62841-65405, Verified ORF, "Guanine nucleotide exchange factor (GEF or GDP-release factor) for Cdc42p; required for polarity establishment and maintenance, and mutants have morphological defects in bud formation and shmooing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.45170.45170.2 | 2.1248 | 0.1985 | 94.8% | 1531.2322 | 1533.9216 | 87 | 4.465 | 35.7% | 1 | S.ASISASTSSKKKLIL.S | 2 |
U | Reverse_YHR072W | 1 | 1 | 1.8% | 731 | 83461 | 6.5 | ERG7 SGDID:S000001114, Chr VIII from 239100-241295, Verified ORF, "Lanosterol synthase, an essential enzyme that catalyzes the cyclization of squalene 2,3-epoxide, a step in ergosterol biosynthesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07407.07407.2 | 2.346 | 0.1788 | 90.7% | 1501.6921 | 1503.7517 | 3 | 4.323 | 58.3% | 1 | Q.CPFIGSDPEQLLK.F | 2 |
U | YHL024W | 1 | 1 | 1.8% | 713 | 80109 | 5.8 | RIM4 SGDID:S000001016, Chr VIII from 56647-58788, Verified ORF, "Putative RNA-binding protein required for the expression of early and middle sporulation genes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38005.38005.2 | 1.7755 | 0.1444 | 96.5% | 1415.2722 | 1412.7035 | 52 | 4.665 | 50.0% | 1 | H.NRKFSGKNGGSNF.N | 2 |
U | Reverse_YNL008C | 1 | 1 | 1.8% | 669 | 76741 | 6.5 | ASI3 SGDID:S000004953, Chr XIV from 618221-616212, reverse complement, Verified ORF, "Putative integral membrane E3 ubiquitin ligase; genetic interactions suggest a role in negative regulation of amino acid uptake" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39292.39292.2 | 2.1413 | 0.3158 | 96.3% | 1333.1322 | 1332.549 | 4 | 5.79 | 54.5% | 1 | L.TPAS*VITSNPS*V.F | 2 |
U | YIL166C | 1 | 2 | 1.8% | 542 | 61898 | 8.9 | YIL166C SGDID:S000001428, Chr IX from 32566-30938, reverse complement, Uncharacterized ORF, "Hypothetical protein, member of the Dal5p subfamily of the major facilitator family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34274.34274.3 | 2.3713 | 0.1377 | 99.0% | 1199.5743 | 1201.6105 | 4 | 4.616 | 50.0% | 2 | H.KGKSLFTEYE.E | 3 |
U | Reverse_YLR096W | 1 | 1 | 1.7% | 1147 | 128338 | 9.4 | KIN2 SGDID:S000004086, Chr XII from 332591-336034, Verified ORF, "Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; closely related to Kin1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23319.23319.2 | 2.5021 | 0.2081 | 95.1% | 2230.132 | 2233.1003 | 9 | 4.473 | 34.2% | 1 | P.GTYPQAKLLEPAAFYLSGCF.T | 2 |
U | YGR094W | 1 | 1 | 1.7% | 1104 | 125770 | 7.0 | VAS1 SGDID:S000003326, Chr VII from 672190-675504, Verified ORF, "Mitochondrial and cytoplasmic valyl-tRNA synthetase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39306.39306.3 | 2.3292 | 0.1716 | 91.7% | 2022.5643 | 2023.1075 | 15 | 3.869 | 33.3% | 1 | K.TGEVIINPLKEDGSPKTPK.E | 3 |
U | YDL215C | 1 | 1 | 1.7% | 1092 | 124332 | 5.7 | GDH2 SGDID:S000002374, Chr IV from 73919-70641, reverse complement, Verified ORF, "NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.07088.07088.3 | 3.0881 | 0.1111 | 91.8% | 1975.5243 | 1971.951 | 193 | 3.874 | 33.3% | 1 | P.NDDPAGVDISSQDLLKGDI.E | 3 |
U | YMR273C | 1 | 1 | 1.7% | 915 | 103358 | 6.4 | ZDS1 SGDID:S000004886, Chr XIII from 813979-811232, reverse complement, Verified ORF, "Protein that interacts with silencing proteins at the telomere, involved in transcriptional silencing; has a role in localization of Bcy1p, a regulatory subunit of protein kinase A; implicated in mRNA nuclear export" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33180.33180.3 | 2.1093 | 0.0601 | 93.4% | 1717.3143 | 1713.8845 | 205 | 3.969 | 35.0% | 1 | A.ITLARTLSMAGSYSDK.K | 3 |
U | YLR258W | 1 | 1 | 1.7% | 705 | 80079 | 6.4 | GSY2 SGDID:S000004248, Chr XII from 660718-662835, Verified ORF, "Glycogen synthase, similar to Gsy1p; expression induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regulated by cAMP-dependent, Snf1p and Pho85p kinases as well as by the Gac1p-Glc7p phosphatase" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39729.39729.2 | 1.6754 | 0.101 | 90.6% | 1321.0922 | 1320.7163 | 14 | 4.303 | 59.1% | 1 | K.SKAPITVAQYKD.H | 2 |
U | Reverse_YIL026C | 1 | 1 | 1.6% | 1150 | 133009 | 5.1 | IRR1 SGDID:S000001288, Chr IX from 307927-304475, reverse complement, Verified ORF, "Subunit of the cohesin complex, which is required for sister chromatid cohesion during mitosis and meiosis and interacts with centromeres and chromosome arms, essential for viability" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33302.33302.3 | 2.3064 | 0.028 | 92.8% | 2063.9343 | 2067.8604 | 396 | 3.951 | 30.9% | 1 | D.PDNNETNAHDTERESNPQ.L | 3 |
U | Reverse_YGL216W | 1 | 1 | 1.6% | 805 | 91090 | 7.1 | KIP3 SGDID:S000003184, Chr VII from 84884-87301, Verified ORF, "Kinesin-related motor protein involved in mitotic spindle positioning " |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.36534.36534.2 | 1.662 | 0.2211 | 95.3% | 1207.9321 | 1205.5438 | 249 | 4.532 | 41.7% | 1 | S.DGLGPFNAEAGSA.E | 2 |
U | Reverse_YLR399C | 1 | 1 | 1.6% | 686 | 76978 | 6.0 | BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.37828.37828.2 | 1.5582 | 0.1061 | 91.2% | 1281.8522 | 1283.5981 | 5 | 4.329 | 50.0% | 1 | D.FYTPLNMSVPD.V | 2 |
U | YIL173W | 1 | 1 | 1.5% | 1549 | 174427 | 5.3 | VTH1 SGDID:S000001435, Chr IX from 11492-16141, Verified ORF, "Putative membrane glycoprotein with strong similarity to Vth2p and Pep1p/Vps10p, may be involved in vacuolar protein sorting" |
U | YJL222W | 1 | 1 | 1.5% | 1549 | 174401 | 5.3 | VTH2 SGDID:S000003758, Chr X from 11475-16124, Verified ORF, "Putative membrane glycoprotein with strong similarity to Vth1p and Pep1p/Vps10p, may be involved in vacuolar protein sorting" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
22_g_01_itms.17451.17451.2 | 2.5706 | 0.3056 | 99.6% | 2528.4321 | 2526.4329 | 305 | 5.188 | 22.7% | 1 | Y.NLIALSDICDKSKGKSVLVKPLQ.L | 2 |
U | Reverse_YDR217C | 1 | 1 | 1.5% | 1309 | 148397 | 5.3 | RAD9 SGDID:S000002625, Chr IV from 903474-899545, reverse complement, Verified ORF, "DNA damage-dependent checkpoint protein, required for cell-cycle arrest in G1/S, intra-S, and G2/M; transmits checkpoint signal by activating Rad53p and Chk1p; hyperphosphorylated by Mec1p and Tel1p; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.46015.46015.3 | 2.2642 | 0.1895 | 96.2% | 2033.5743 | 2037.0657 | 409 | 4.175 | 26.4% | 1 | E.LGVVVYENGDFTVADGIRI.D | 3 |
U | Reverse_YDL195W | 1 | 1 | 1.5% | 1273 | 138703 | 5.7 | SEC31 SGDID:S000002354, Chr IV from 107209-111030, Verified ORF, "Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.38326.38326.3 | 2.4456 | 0.1046 | 94.3% | 1889.2144 | 1886.0387 | 1 | 4.067 | 36.1% | 1 | A.NAPIGNLPTPTSLINPPAV.S | 3 |
U | Reverse_YGR170W | 1 | 1 | 1.5% | 1138 | 130065 | 7.9 | PSD2 SGDID:S000003402, Chr VII from 837147-840563, Verified ORF, "Phosphatidylserine decarboxylase of the Golgi and vacuolar membranes, converts phosphatidylserine to phosphatidylethanolamine" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39222.39222.3 | 2.6933 | 0.1593 | 93.9% | 2047.8544 | 2049.147 | 30 | 4.039 | 34.4% | 1 | S.KNHKGRQLHLLRSGIYE.K | 3 |
U | Reverse_YKR086W | 1 | 1 | 1.5% | 1071 | 121652 | 8.2 | PRP16 SGDID:S000001794, Chr XI from 599499-602714, Verified ORF, "RNA helicase in the DEAH-box family involved in the second catalytic step of splicing, exhibits ATP-dependent RNA unwinding activity" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.27686.27686.3 | 2.5189 | 0.1231 | 96.0% | 1802.7843 | 1803.0526 | 10 | 4.166 | 40.0% | 1 | F.KKANMTASTIILKLDR.R | 3 |
U | YLR095C | 1 | 1 | 1.5% | 812 | 93446 | 5.8 | IOC2 SGDID:S000004085, Chr XII from 332116-329678, reverse complement, Verified ORF, "Member of a complex (Isw1b) with Isw1p and Ioc4p that exhibits nucleosome-stimulated ATPase activity and acts within coding regions to coordinate transcription elongation with termination and processing, contains a PHD finger motif" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08195.08195.2 | 2.2185 | 0.147 | 95.3% | 1213.8522 | 1212.6112 | 326 | 4.476 | 50.0% | 1 | G.TVGPLQTGDVPE.L | 2 |
U | YLR337C | 1 | 1 | 1.5% | 817 | 82594 | 9.9 | VRP1 SGDID:S000004329, Chr XII from 805106-802653, reverse complement, Verified ORF, "Proline-rich, actin-associated protein involved in cytoskeletal organization and cytokinesis; related to mammalian Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP)" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08415.08415.3 | 2.0676 | 0.1114 | 91.8% | 1217.6643 | 1215.6373 | 63 | 3.873 | 36.4% | 1 | K.NPTKSPPPPPSP.S | 3 |
U | YKL029C | 1 | 2 | 1.5% | 669 | 74376 | 8.2 | MAE1 SGDID:S000001512, Chr XI from 384368-382359, reverse complement, Verified ORF, "Mitochondrial malic enzyme, catalyzes the oxidative decarboxylation of malate to pyruvate, which is a key intermediate in sugar metabolism and a precursor for synthesis of several amino acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09523.09523.2 | 3.0109 | 0.0908 | 95.3% | 1342.1122 | 1339.5992 | 14 | 4.474 | 72.2% | 2 | R.DFDECLQWVK.A | 2 |
U | YNR016C | 3 | 4 | 1.4% | 2233 | 250351 | 6.3 | ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.08801.08801.2 | 4.6689 | 0.4208 | 100.0% | 2060.0122 | 2059.9702 | 1 | 7.613 | 55.6% | 1 | R.AVS*VSDLSYVANSQSSPLR.E | 2 |
* | 22_g_01_itms.08814.08814.3 | 4.1877 | 0.2376 | 94.8% | 2061.4443 | 2059.9702 | 10 | 4.844 | 36.1% | 1 | R.AVS*VSDLSYVANSQSSPLR.E | 3 |
* | 22_g_01_itms.09529.09529.2 | 2.9249 | 0.2984 | 99.3% | 1522.9922 | 1521.6749 | 2 | 5.056 | 58.3% | 2 | R.ETESGFEYGLFDK.G | 2 |
U | YER132C | 1 | 1 | 1.4% | 1753 | 195382 | 7.8 | PMD1 SGDID:S000000934, Chr V from 430445-425184, reverse complement, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Mds3p, for growth under alkaline conditions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.21886.21886.2 | 2.5328 | 0.2867 | 96.8% | 2546.3523 | 2547.3586 | 1 | 5.605 | 30.4% | 1 | N.QISHLGSSASLPNS*PILPVLNIPL.P | 2 |
U | YJR041C | 1 | 1 | 1.4% | 1174 | 135117 | 6.4 | URB2 SGDID:S000003802, Chr X from 513677-510153, reverse complement, Verified ORF, "Nucleolar protein required for normal metabolism of the rRNA primary transcript, proposed to be involved in ribosome biogenesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33513.33513.3 | 2.6452 | 0.1655 | 96.0% | 2015.4543 | 2018.1367 | 10 | 4.158 | 34.4% | 1 | F.GYKSYLLLFNAIKEFLV.S | 3 |
U | Reverse_YLR335W | 1 | 1 | 1.4% | 720 | 77881 | 7.2 | NUP2 SGDID:S000004327, Chr XII from 797430-799592, Verified ORF, "Protein involved in nucleocytoplasmic transport, binds to either the nucleoplasmic or cytoplasmic faces of the nuclear pore complex depending on Ran-GTP levels; also has a role in chromatin organization" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12605.12605.2 | 1.4222 | 0.393 | 94.3% | 1142.5322 | 1141.4679 | 179 | 5.389 | 38.9% | 1 | N.QS*DAAHKTGF.T | 2 |
U | Reverse_YMR190C | 1 | 1 | 1.3% | 1447 | 163837 | 6.3 | SGS1 SGDID:S000004802, Chr XIII from 645257-640914, reverse complement, Verified ORF, "Nucleolar DNA helicase of the RecQ family involved in maintenance of genome integrity, regulates chromosome synapsis and meiotic crossing over; has similarity to human BLM and WRN helicases implicated in Bloom and Werner syndromes" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.23583.23583.3 | 3.2225 | 0.1678 | 93.7% | 2313.5942 | 2314.2307 | 50 | 4.025 | 33.3% | 1 | L.NTRNFSQKLFVPEKLELNH.I | 3 |
U | Reverse_YMR280C | 1 | 1 | 1.3% | 1433 | 160485 | 9.0 | CAT8 SGDID:S000004893, Chr XIII from 831328-827027, reverse complement, Verified ORF, "Zinc cluster transcriptional activator necessary for derepression of a variety of genes under non-fermentative growth conditions, active after diauxic shift, binds carbon source responsive elements" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.20992.20992.2 | 2.2745 | 0.0528 | 91.9% | 2107.3123 | 2110.2751 | 295 | 4.371 | 29.4% | 1 | L.FKDLREVKVNPAKLLLNI.S | 2 |
U | YDR080W | 1 | 1 | 1.3% | 992 | 113412 | 4.9 | VPS41 SGDID:S000002487, Chr IV from 604004-606982, Verified ORF, "Vacuolar membrane protein that is a subunit of the homotypic vacuole fusion and vacuole protein sorting (HOPS) complex; essential for membrane docking and fusion at the Golgi-to-endosome and endosome-to-vacuole stages of protein transport" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34183.34183.2 | 1.4191 | 0.0347 | 95.8% | 1321.2522 | 1322.5712 | 264 | 4.569 | 41.7% | 1 | A.SEPTASSKEEGSN.I | 2 |
U | YOR217W | 1 | 1 | 1.3% | 861 | 94903 | 9.2 | RFC1 SGDID:S000005743, Chr XV from 749301-751886, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.17559.17559.3 | 2.2633 | 0.12 | 94.0% | 1306.1643 | 1308.651 | 252 | 4.042 | 35.0% | 1 | T.PLMIQENYLST.R | 3 |
U | Reverse_YDR422C | 1 | 1 | 1.2% | 863 | 96259 | 6.6 | SIP1 SGDID:S000002830, Chr IV from 1317907-1315316, reverse complement, Verified ORF, "Alternate beta-subunit of the Snf1p kinase complex, may confer substrate specificity; vacuolar protein containing KIS (Kinase-Interacting Sequence) and ASC (Association with Snf1 kinase Complex) domains involved in protein interactions" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.45464.45464.3 | 2.3362 | 0.1561 | 97.0% | 1201.5543 | 1202.7081 | 79 | 4.225 | 50.0% | 1 | S.RRSNSVSRIK.K | 3 |
U | YPR095C | 1 | 1 | 1.1% | 1226 | 137583 | 7.3 | SYT1 SGDID:S000006299, Chr XVI from 724715-721035, reverse complement, Verified ORF, "Guanine nucleotide exchange factor (GEF) for Arf proteins; involved in vesicular transport; suppressor of ypt3 mutations; member of the Sec7-domain family" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.40159.40159.2 | 1.7946 | 0.0727 | 94.5% | 1343.9321 | 1341.6691 | 23 | 4.456 | 45.8% | 1 | F.KSGFSFVPGSTID.V | 2 |
U | Reverse_YDL223C | 1 | 1 | 1.1% | 1046 | 113616 | 6.4 | HBT1 SGDID:S000002382, Chr IV from 60406-57266, reverse complement, Verified ORF, "Substrate of the Hub1p ubiquitin-like protein that localizes to the shmoo tip (mating projection); mutants are defective for mating projection formation, thereby implicating Hbt1p in polarized cell morphogenesis" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.39217.39217.2 | 1.6189 | 0.1049 | 90.3% | 1179.7722 | 1179.5282 | 20 | 4.298 | 55.0% | 1 | E.PNNTFDKADSA.I | 2 |
U | YDL140C | 1 | 1 | 1.0% | 1733 | 191610 | 5.6 | RPO21 SGDID:S000002299, Chr IV from 210562-205361, reverse complement, Verified ORF, "RNA polymerase II largest subunit B220, part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.09813.09813.3 | 2.7986 | 0.1827 | 93.4% | 1916.3944 | 1915.9772 | 134 | 4.004 | 33.8% | 1 | L.VSRGGCGNTQPTIRKDGL.K | 3 |
U | Reverse_YER008C | 1 | 1 | 1.0% | 1336 | 154694 | 5.4 | SEC3 SGDID:S000000810, Chr V from 171817-167807, reverse complement, Verified ORF, "Non-essential subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, Exo84p) which mediates targeting of post-Golgi vesicles to sites of active exocytosis; Sec3p specifically is a spatial landmark for secretion" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.00530.00530.3 | 1.8426 | 0.0172 | 92.0% | 1291.3143 | 1290.6178 | 139 | 3.898 | 33.3% | 1 | E.GSLNSTNLGAIED.S | 3 |
U | YLR096W | 1 | 1 | 1.0% | 1147 | 128338 | 9.4 | KIN2 SGDID:S000004086, Chr XII from 332591-336034, Verified ORF, "Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; closely related to Kin1p" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.12523.12523.3 | 2.1163 | 0.1655 | 96.6% | 1401.3243 | 1403.7283 | 119 | 4.216 | 43.2% | 1 | P.KSHSRTISDYIP.S | 3 |
U | YHL035C | 1 | 1 | 0.9% | 1592 | 180925 | 8.5 | YHL035C SGDID:S000001027, Chr VIII from 32754-27976, reverse complement, Uncharacterized ORF, "Protein of unknown function, member of the ATP-binding cassette (ABC) family, potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.45519.45519.2 | 2.0562 | 0.223 | 99.3% | 1673.6522 | 1670.9553 | 1 | 5.042 | 53.8% | 1 | L.RVTKINIELTNRDV.T | 2 |
U | Reverse_YLR278C | 1 | 1 | 0.8% | 1341 | 151278 | 8.3 | YLR278C SGDID:S000004268, Chr XII from 704026-700001, reverse complement, Uncharacterized ORF, "Protein of unknown function, localizes to the nucleus; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.31513.31513.2 | 1.373 | 0.1624 | 91.6% | 1063.9922 | 1062.4816 | 196 | 4.335 | 45.0% | 1 | D.NSNSLNAANAS.N | 2 |
U | YDR093W | 1 | 1 | 0.7% | 1612 | 182617 | 6.2 | DNF2 SGDID:S000002500, Chr IV from 631277-636115, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport; potential Cdc28p substrate" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.32312.32312.2 | 1.9343 | 0.2944 | 100.0% | 1267.7122 | 1265.5935 | 41 | 5.757 | 59.1% | 1 | A.DMILLSTSDVDG.A | 2 |
U | YOR207C | 1 | 1 | 0.7% | 1149 | 129456 | 8.2 | RET1 SGDID:S000005733, Chr XV from 733457-730008, reverse complement, Verified ORF, "Second-largest subunit of RNA polymerase III, which is responsible for the transcription of tRNA and 5S RNA genes, and other low molecular weight RNAs" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.46190.46190.2 | 1.3974 | 0.2579 | 96.2% | 1081.4321 | 1081.5325 | 127 | 4.655 | 64.3% | 1 | G.FGRCETRR.K | 2 |
U | YHR165C | 1 | 1 | 0.4% | 2413 | 279502 | 7.3 | PRP8 SGDID:S000001208, Chr VIII from 436950-429709, reverse complement, Verified ORF, "Component of the U4/U6-U5 snRNP complex, involved in the second catalytic step of splicing" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.16899.16899.2 | 1.4381 | 0.2145 | 95.3% | 837.33215 | 836.3824 | 34 | 4.531 | 56.2% | 1 | E.EAAGASTVM.K | 2 |
U | YLL040C | 1 | 1 | 0.3% | 3144 | 357850 | 5.6 | VPS13 SGDID:S000003963, Chr XII from 63644-54210, reverse complement, Verified ORF, "Protein of unknown function; heterooligomeric or homooligomeric complex; peripherally associated with membranes; homologous to human COH1; involved in sporulation, vacuolar protein sorting and protein-Golgi retention" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.34156.34156.2 | 1.4357 | 0.2409 | 96.9% | 919.8522 | 921.54095 | 89 | 4.753 | 57.1% | 1 | N.TQIVVSFK.G | 2 |
U | YGL195W | 1 | 1 | 0.3% | 2672 | 296697 | 5.3 | GCN1 SGDID:S000003163, Chr VII from 131531-139549, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn20p; proposed to stimulate Gcn2p activation by an uncharged tRNA" |
Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
---|---|---|---|---|---|---|---|---|---|---|---|---|
* | 22_g_01_itms.33256.33256.2 | 1.2322 | 0.1801 | 90.4% | 925.89215 | 925.47833 | 53 | 4.283 | 56.2% | 1 | L.QAAAYAAFI.Q | 2 |
Proteins | Peptide IDs | Spectra | |
Unfiltered | 10414 | 56894 | 62111 |
Filtered | 350 | 529 | 1261 |
Forward matches | 240 | 416 | 1145 |
Decoy matches | 110 | 113 | 116 |
Forward FP rate | 45.83% | 27.16% | 10.13% |