DTASelect v2.0.21
/data/1/catclw/Projects/Jamie/December/TiO2_step345/splitted
/garibaldi/people-b/applications/yates/dbase/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
--trypstat -e con --fp 0.1 -p 1
Jump to the summary table.

sequest.params modifications:
*STY80.0
#X0.0
@X0.0
StaticC57.0
trueUse criteria
0.0Minimum peptide confidence
0.1Peptide false positive rate
0.0Minimum protein confidence
1.0Protein false positive rate
1Minimum charge state
16Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
falseMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
trueRemove subset proteins
IgnoreLocus validation handling
conExclude protein names matching
0Minimum modified peptides per locus
1000Minimum redundancy for low coverage loci
1Minimum peptides per locus

Locus Key:

Validation StatusLocusSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Similarity Key:

Locus# of identical peptides# of differing peptides

UYOR257W3840.4%161187514.6CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_8.16444.16444.33.23360.1787100.0%2940.02442940.213564.99920.7%1K.QEIYEAFSLFDMNNDGFLDYHELK.V3
*Jamie_04_itms_3.22063.22063.33.97880.3493100.0%4170.0544170.542515.51720.1%1R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAI.C3
*Jamie_05_itms_4.20943.20943.33.70470.3179100.0%4633.0144633.95316.75924.4%6R.VAKELGETLTDEELRAMIEEFDLDGDGEINENEFIAICTDS.-3

UYBR109C2625.2%147161354.3CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_4.23386.23386.43.26770.2079100.0%4107.97664109.526374.15818.1%1R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q4
*Jamie_03_itms_13.20957.20957.35.37550.5193100.0%4108.4944109.52618.64327.8%5R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q3

UYOR286W1118.8%149166979.6YOR286W SGDID:S000005812, Chr XV from 850277-850726, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_8.16226.16226.32.86550.2015100.0%3026.90433027.54053343.91421.3%1K.HSTGILSRTVSARSPTLVLRTFTTKAPK.I3

UYPL124W4515.0%253292809.5SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_2.10677.10677.44.54930.2207100.0%4382.05664382.572484.22718.0%1R.SSDNINKEGAREDRSSQIHIENEST*EDILKILSSSFHN.-4
*Jamie_03_itms_2.05408.05408.23.60770.3247100.0%1923.05211923.985515.51863.3%2R.SSQIHIENEST*EDILK.I2
*Jamie_03_itms_4.13572.13572.33.15230.1963100.0%2809.55442809.9604644.80926.1%1R.SSQIHIENES*TEDILKILSSSFHN.-3
*Jamie_03_itms_4.13151.13151.33.23970.2378100.0%2889.23442889.96041804.37625.0%1R.SSQIHIENEST*EDILKILSS*SFHN.-3

UYIL061C1113.3%3003444710.0SNP1 SGDID:S000001323, Chr IX from 245556-244654, reverse complement, Verified ORF, "Component of U1 snRNP required for mRNA splicing via spliceosome; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_25.28871.28871.41.78870.5369100.0%4371.37654373.6104812.90810.7%1S.SS*AYSADRYGSSTLDARYRGNRPLLSAATPTAAVTSVY*KS.R4

UYFR028C2212.7%551619078.0CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_17.24023.24023.44.46940.4213100.0%5196.53665197.739717.54518.2%1R.VYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYR.F4
*Jamie_03_itms_5.14398.14398.33.84960.3398100.0%3012.26443013.3398205.71126.0%1K.HFEDIGIQHLDLIFEDGTCPDLSIVK.N3

UYKL060C1112.3%359396215.8FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_6.14632.14632.44.00670.3206100.0%5038.93655040.510315.62918.2%1R.MAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYK.A4

UYPL131W1310.4%297337156.8RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_05_itms_3.14011.14011.36.30560.5109100.0%3500.69433500.794418.74830.8%3K.LGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V3

UYNR040W119.4%2562863610.1YNR040W SGDID:S000005323, Chr XIV from 699692-700462, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_5.26973.26973.32.01810.2119100.0%2584.13432579.9163534.39319.6%1K.TFGPVALGVLPVILAAATKHVT*S*R.L3

UReverse_YBR192W119.3%377421029.6RIM2 SGDID:S000000396, Chr II from 607647-608780, Verified ORF, "Mitochondrial pyrimidine nucleotide transporter; imports pyrimidine nucleoside triphosphates and exports pyrimidine nucleoside monophosphates; member of the mitochondrial carrier family"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_5.14433.14433.43.22250.144993.9%4097.73634093.6348153.5119.6%1K.FLSRFGEQKYVNGIIGLTEKFHTGAQIVY*NISKPR.T4

UYLR332W118.2%376391465.7MID2 SGDID:S000004324, Chr XII from 790676-791806, Verified ORF, "O-glycosylated plasma membrane protein that acts as a sensor for cell wall integrity signaling and activates the pathway; interacts with Rom2p, a guanine nucleotide exchange factor for Rho1p, and with cell integrity pathway protein Zeo1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_4.13120.13120.32.19240.4249100.0%3074.24443076.80132.60521.7%1F.SFSSDSSTSSSSSASS*DSSSSSSFSISSTS*A.T3

UYNL064C118.1%409446716.3YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_12.32153.32153.32.98780.2078100.0%3564.41433563.8965105.10418.0%1R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V3

UReverse_YKL141W118.1%1982206810.2SDH3 SGDID:S000001624, Chr XI from 179672-180268, Verified ORF, "Cytochrome b subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer of electrons to ubiquinone"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_16.22864.22864.21.51150.149394.1%1796.91221795.99212573.78536.7%1R.IAGGYHIAFLYAFS*GK.I2

UYGL075C117.2%387445858.3MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_13.20917.20917.33.02550.2455100.0%3119.18433118.439514.51726.9%1R.EILENAFIGVDSIPSDFIVSMNLNSPS*K.F3

UYNL225C125.9%581674006.0CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_2.09894.09894.45.90060.3744100.0%4204.49664205.814556.17721.2%2K.ILCDKFDKLTIDEKEILKGCNEEIKIKLERLNER.L4

UYGR234W115.3%399446466.3YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_9.29866.29866.21.20280.2466100.0%2231.3722228.3811984.18517.5%1R.T*NQKVGAQPNALAT*TVLAAAK.N2

UYJR053W345.2%574660875.9BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_3.11003.11003.32.37410.2648100.0%3531.95433535.8586494.90619.0%1K.KLASWFIPRDET*IISVDEETIMDESTVNSK.R3
*Jamie_03_itms_3.11003.11003.22.05320.26100.0%2354.97222356.514614.29740.0%2R.DETIISVDEETIMDESTVNSK.R3
*Jamie_03_itms_3.10922.10922.33.10810.2402100.0%2356.01442356.5146354.74230.0%1R.DETIISVDEETIMDESTVNSK.R3

UReverse_YBL097W113.7%754862304.7BRN1 SGDID:S000000193, Chr II from 40828-43092, Verified ORF, "Essential protein required for chromosome condensation, likely to function as an intrinsic component of the condensation machinery, may influence multiple aspects of chromosome transmission and dynamics"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_5.14033.14033.42.84780.16191.2%3528.29663524.962494.17922.8%1K.FLPDIILEQDLEKMKIT*EFEVLT*TELVR.N4

UYOL122C113.3%575632646.6SMF1 SGDID:S000005482, Chr XV from 91418-89691, reverse complement, Verified ORF, "Divalent metal ion transporter with a broad specificity for di-valent and tri-valent metals; post-translationally regulated by levels of metal ions; member of the Nramp family of metal transport proteins"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_05_itms_6.30571.30571.22.80770.2633100.0%2143.8722142.352334.8136.1%1G.T*IFMLALLLSGQSAGVVCT*.M2

UYGL006W113.0%11731308617.4PMC1 SGDID:S000002974, Chr VII from 485925-489446, Verified ORF, "Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_23.27418.27418.43.32230.1672100.0%4282.73634280.5713223.36517.2%1K.YLKTDKNAGIS*LPEISNYRKTNRYKNY*GDNSLPER.I4

UYLR188W113.0%695759509.8MDL1 SGDID:S000004178, Chr XII from 528302-530389, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane, mediates export of peptides generated upon proteolysis of mitochondrial proteins, plays a role in the regulation of cellular resistance to oxidative stress"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_12.20087.20087.32.78890.1717100.0%2370.74442372.871124.12630.0%1K.LT*CVMMILAPPLGAMALIYGR.K3

UReverse_YOL087C112.9%11161253826.7YOL087C SGDID:S000005447, Chr XV from 158636-155286, reverse complement, Uncharacterized ORF, "Hypothetical protein"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_13.20778.20778.43.34180.142397.0%3877.65653876.22973224.55818.8%1K.DKNNKKS*ESNYGTDLTLSNT*LDKKKLSFIKKR.L4

UYBR133C112.7%827951536.4HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_4.13165.13165.22.95310.2656100.0%2581.35232581.662415.60238.1%1K.DTVQDEDDFTVEFSQSSLNEFK.I2

UYAL047C112.7%622721055.1SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_4.13773.13773.22.85450.2334100.0%1998.43211999.176116.31153.1%1R.ETLEETLELSSDYVLEK.M2

UYOR048C112.4%10061159346.8RAT1 SGDID:S000005574, Chr XV from 421650-418630, reverse complement, Verified ORF, "Nuclear 5' to 3' single-stranded RNA exonuclease, involved in RNA metabolism, including rRNA and snRNA processing as well as mRNA transcription termination"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_15.22212.22212.32.6270.170894.1%2862.29442866.052213.36828.3%1K.TY*MT*CDGVLNLPSVETLLQHLGSR.E3

UYOR373W282.2%851941047.0NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_2.07026.07026.23.87310.3226100.0%2142.95212143.265917.15350.0%2R.VEDITSISEVNTSFNETEK.Q2
*Jamie_03_itms_2.07278.07278.23.92020.3824100.0%2222.69212223.265916.48858.3%6R.VEDITSISEVNTS*FNETEK.Q2

UYMR164C112.2%758850507.8MSS11 SGDID:S000004774, Chr XIII from 589549-587273, reverse complement, Verified ORF, "Transcription factor involved in regulation of invasive growth and starch degradation; controls the activation of MUC1 and STA2 in response to nutritional signals"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_05_itms_9.34967.34967.21.1970.3509100.0%2020.93212023.84913115.02218.8%1N.TRNNTAEET*TPT*NDNNA.N2

UYDR135C112.0%15151711208.4YCF1 SGDID:S000002542, Chr IV from 727546-722999, reverse complement, Verified ORF, "Vacuolar glutathione S-conjugate transporter of the ATP-binding cassette family, has a role in detoxifying metals such as cadmium, mercury, and arsenite; also transports unconjugated bilirubin; similar to human cystic fibrosis protein CFTR"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_10.18762.18762.43.74190.1428100.0%3472.61653474.806414.72323.3%1R.ESSIPVEGELEQLQKLNDLDFGNSDAISLRR.A4

UYOR069W111.9%675764845.2VPS5 SGDID:S000005595, Chr XV from 453769-455796, Verified ORF, "Nexin-1 homolog required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to the late Golgi apparatus; structural component of the retromer membrane coat complex; forms a retromer subcomplex with Vps17p"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_03_itms_16.23249.23249.21.69980.1407100.0%1778.29221778.9193234.37950.0%1K.EFQT*LERRYNLTK.K2

UYLR413W111.8%675726985.1YLR413W SGDID:S000004405, Chr XII from 951152-953179, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_18.38175.38175.11.23890.255100.0%1329.01329.6294303.9131.8%1I.LLPICALLTLTT.F1

UYMR092C111.5%615673265.6AIP1 SGDID:S000004698, Chr XIII from 453478-451631, reverse complement, Verified ORF, "Actin cortical patch component, interacts with the actin depolymerizing factor cofilin; required to restrict cofilin localization to cortical patches; contains WD repeats"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_18.38208.38208.11.22280.2408100.0%979.04978.9023424.40437.5%1T.PSTLVS*S*GA.D1

UYPL058C111.1%15111710646.8PDR12 SGDID:S000005979, Chr XVI from 450374-445839, reverse complement, Verified ORF, "Plasma membrane weak-acid-inducible ATP-binding cassette (ABC) transporter, required for weak organic acid resistance, strongly induced by sorbate and benzoate, regulated by War1p, mutants exhibit sorbate hypersensitivity"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_7.28590.28590.21.67590.3138100.0%1909.81211911.9427215.69237.5%1M.DNNTGYLVNPTATENCQ.Y2

UYDL112W111.1%14361650476.1TRM3 SGDID:S000002270, Chr IV from 258915-263225, Verified ORF, "2'-O-ribose methyltransferase, catalyzes the ribose methylation of the guanosine nucleotide at position 18 of tRNAs"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_05_itms_5.27717.27717.21.20380.2356100.0%2065.73222064.1332333.79723.3%1K.LEEHAQT*IISLSY*SRR.S2

UYMR176W110.6%14111627006.8ECM5 SGDID:S000004788, Chr XIII from 611739-615974, Verified ORF, "Non-essential protein of unknown function, contains ATP/GTP-binding site motif A; null mutant exhibits cellular volume up to four times greater than wild-type, also large drooping buds with elongated necks"
FilenameXCorrDeltCNConf%ObsM+H+CalcM+H+SpRZScoreIon%#Sequence
*Jamie_04_itms_19.38487.38487.11.10110.248100.0%1004.891006.23281654.17835.7%1T.IPLKVSYW.T1
ProteinsPeptide IDsSpectra
Unfiltered105935466567160
Filtered344464
Forward matches304060
Decoy matches444
Forward FP rate13.33%10.0%6.67%

/data/1/catclw/Projects/Jamie/December/TiO2_step345/splitted