| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| con | Exclude protein names matching |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YIL002W-A | 11 | 41 | 98.6% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
| U | YLR154C-H | 1 | 1 | 81.4% | 43 | 4707 | 9.6 | YLR154C-H SGDID:S000028562, Chr XII from 468959-468828, reverse complement, Uncharacterized ORF, "Identified by fungal homology and RT-PCR" |
| U | YLR159C-A | 1 | 1 | 81.4% | 43 | 4707 | 9.6 | YLR159C-A SGDID:S000028566, Chr XII from 485843-485712, reverse complement, Uncharacterized ORF, "Identified by fungal homology and RT-PCR" |
| U | YLR157C-C | 1 | 1 | 81.4% | 43 | 4707 | 9.6 | YLR157C-C SGDID:S000028565, Chr XII from 482191-482060, reverse complement, Uncharacterized ORF, "Identified by fungal homology and RT-PCR" |
| U | YLR156C-A | 1 | 1 | 81.4% | 43 | 4707 | 9.6 | YLR156C-A SGDID:S000028564, Chr XII from 472611-472480, reverse complement, Uncharacterized ORF, "Identified by fungal homology and RT-PCR" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_04_itms_28.23528.23528.4 | 3.8563 | 0.0441 | 90.2% | 3924.1365 | 3928.2205 | 2 | 3.25 | 22.5% | 1 | K.T*TAAPEFRVWSPT*TLLGQALTSLTTVDRTGNGAFW.- | 4 |
| U | YDL130W | 2 | 6 | 67.0% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_8.07048.07048.2 | 4.472 | 0.3489 | 100.0% | 1665.1921 | 1664.815 | 1 | 8.233 | 70.0% | 5 | K.AAGANVDNVWADVYAK.A | 2 |
| * | Jamie_phos_01_itms_32.19661.19661.4 | 5.4872 | 0.4253 | 100.0% | 5451.2563 | 5450.6016 | 1 | 6.785 | 16.4% | 1 | K.DLKEILSGFHNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEES*DDDMGFGLFD.- | 4 |
| U | YBR109C | 4 | 11 | 66.0% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_26.18103.18103.3 | 5.9976 | 0.5221 | 100.0% | 4110.6245 | 4109.526 | 1 | 9.379 | 28.5% | 6 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
| * | Jamie_phos_02_itms_26.18098.18098.4 | 4.4578 | 0.1041 | 97.7% | 4111.8564 | 4109.526 | 1 | 3.653 | 20.4% | 2 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 4 |
| * | Jamie_phos_01_itms_29.17858.17858.3 | 3.8849 | 0.0879 | 95.1% | 3172.5244 | 3169.4692 | 1 | 3.686 | 27.7% | 1 | K.SNDSEQELLEAFKVFDKNGDGLISAAELK.H | 3 |
| * | Jamie_phos_01_itms_36.21842.21842.3 | 5.5192 | 0.5174 | 100.0% | 3367.0444 | 3366.7217 | 1 | 7.593 | 28.3% | 2 | K.LTDAEVDDMLREVSDGSGEINIQQFAALLSK.- | 3 |
| U | YOR257W | 9 | 11 | 62.1% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| U | YKL042W | 39 | 107 | 57.6% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| U | YPL124W | 26 | 72 | 56.9% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| U | YIL149C | 80 | 252 | 49.9% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| U | YKL060C | 7 | 22 | 46.8% | 359 | 39621 | 5.8 | FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_6.09702.09702.2 | 4.0807 | 0.3157 | 100.0% | 1864.7322 | 1864.1082 | 1 | 6.77 | 59.4% | 3 | K.TGVIVGEDVHNLFTYAK.E | 2 |
| * | Jamie_phos_02_itms_10.08446.08446.4 | 3.8967 | 0.1959 | 100.0% | 4350.7764 | 4349.85 | 1 | 4.069 | 18.7% | 1 | R.DSKSPIILQTSNGGAAYFAGKGISNEGQNASIKGAIAAAHYIR.S | 4 |
| * | Jamie_phos_02_itms_6.05661.05661.3 | 3.3849 | 0.2048 | 99.3% | 2242.9143 | 2242.4995 | 1 | 5.77 | 39.3% | 4 | K.GISNEGQNASIKGAIAAAHYIR.S | 3 |
| * | Jamie_phos_04_itms_6.09880.09880.3 | 4.9126 | 0.3901 | 100.0% | 3235.4343 | 3235.423 | 1 | 7.53 | 27.8% | 4 | K.EHGEPLFSSHMLDLSEETDEENISTCVK.Y | 3 |
| * | Jamie_phos_02_itms_9.07945.07945.4 | 3.3461 | 0.2117 | 99.3% | 3236.0566 | 3235.423 | 2 | 5.001 | 22.8% | 1 | K.EHGEPLFSSHMLDLSEETDEENISTCVK.Y | 4 |
| * | Jamie_phos_04_itms_13.14270.14270.4 | 4.8703 | 0.398 | 100.0% | 5039.8564 | 5040.5103 | 1 | 6.052 | 17.8% | 8 | R.MAAMDQWLEMEIGITGGEEDGVNNENADKEDLYTKPEQVYNVYK.A | 42 |
| * | Jamie_phos_02_itms_9.07543.07543.4 | 4.2278 | 0.0536 | 93.7% | 3935.9365 | 3932.348 | 5 | 3.006 | 20.5% | 1 | R.EQVGCKEEKPLFLVFHGGSGSTVQEFHTGIDNGVVK.V | 4 |
| U | YPL131W | 15 | 82 | 46.8% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
| U | YBL003C | 2 | 3 | 44.7% | 132 | 13989 | 10.7 | HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| U | YDR225W | 2 | 3 | 44.7% | 132 | 13989 | 10.7 | HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_57.34586.34586.3 | 5.3077 | 0.413 | 100.0% | 2948.7544 | 2947.4014 | 1 | 7.72 | 34.8% | 2 | R.IGSGAPVYLTAVLEYLAAEILELAGNAAR.D | 3 | |
| Jamie_phos_01_itms_26.15776.15776.3 | 5.28 | 0.3736 | 100.0% | 3239.2444 | 3239.6995 | 1 | 5.852 | 27.6% | 1 | R.NDDELNKLLGNVTIAQGGVLPNIHQNLLPK.K | 3 |
| U | YDR382W | 1 | 1 | 43.6% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14532.14532.3 | 3.534 | 0.1425 | 97.4% | 4688.784 | 4689.7534 | 7 | 4.015 | 16.5% | 1 | K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.- | 3 |
| U | YJR053W | 15 | 29 | 40.1% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| U | YDR356W | 36 | 79 | 38.3% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| U | YOR210W | 1 | 1 | 37.1% | 70 | 8278 | 7.8 | RPB10 SGDID:S000005736, Chr XV from 738320-738532, Verified ORF, "RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_27.16551.16551.3 | 3.9109 | 0.0821 | 94.9% | 2980.6143 | 2981.2427 | 4 | 4.304 | 25.0% | 1 | K.VVGDKWESYLNLLQEDELDEGTALSR.L | 3 |
| U | YCL042W | 1 | 1 | 35.3% | 119 | 13360 | 10.6 | YCL042W SGDID:S000000547, Chr III from 50584-50943, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_31.27356.27356.4 | 3.3483 | 0.1412 | 95.9% | 4666.6567 | 4667.352 | 51 | 4.317 | 15.9% | 1 | K.ILDAALAPRIISGVPTDGQPLSGGPLSWAWCHTT*LKRWALMK.T | 4 |
| U | YNL225C | 15 | 34 | 34.9% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| U | YLR146W-A | 2 | 2 | 33.9% | 62 | 7078 | 4.8 | YLR146W-A SGDID:S000113566, Chr XII from 433871-434059, Uncharacterized ORF, "Putative protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.17906.17906.2 | 3.9019 | 0.3166 | 100.0% | 1733.6921 | 1733.0386 | 1 | 5.488 | 73.1% | 1 | R.MLQNEIQQLFAQLR.D | 2 |
| * | Jamie_phos_01_itms_27.16900.16900.3 | 4.3352 | 0.2809 | 100.0% | 2548.7344 | 2547.8918 | 1 | 5.658 | 35.0% | 1 | R.MLQNEIQQLFAQLRDTNSQIR.C | 3 |
| U | YAL038W | 10 | 22 | 31.6% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| U | YMR116C | 6 | 11 | 29.5% | 319 | 34805 | 6.2 | ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "WD repeat protein (G-beta like protein) involved in translation regulation; required for repression of Gcn4p activity in the absence of amino-acid starvation; core component of the ribosome; ortholog of mammalian RACK1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_8.06843.06843.3 | 4.7112 | 0.3443 | 100.0% | 2404.4644 | 2404.7715 | 1 | 7.612 | 41.2% | 2 | R.DKTLISWKLTGDDQKFGVPVR.S | 3 |
| * | Jamie_phos_01_itms_9.05714.05714.2 | 2.1321 | 0.1072 | 94.2% | 1439.7722 | 1439.5675 | 4 | 3.652 | 59.1% | 1 | R.LWDVATGETYQR.F | 2 |
| * | Jamie_phos_02_itms_5.04718.04718.3 | 3.4761 | 0.3301 | 100.0% | 2187.3245 | 2188.3533 | 7 | 5.685 | 31.2% | 2 | R.VVPNEKADDDSVTIISAGNDK.M | 3 |
| * | Jamie_phos_02_itms_5.04708.04708.2 | 3.4228 | 0.3754 | 100.0% | 2187.7122 | 2188.3533 | 1 | 7.275 | 42.5% | 4 | R.VVPNEKADDDSVTIISAGNDK.M | 2 |
| * | Jamie_phos_01_itms_21.13100.13100.2 | 2.1938 | 0.3163 | 100.0% | 1361.2922 | 1361.5989 | 3 | 5.646 | 63.6% | 1 | K.DGEIMLWNLAAK.K | 2 |
| * | Jamie_phos_02_itms_14.10671.10671.3 | 3.0413 | 0.1252 | 93.3% | 2961.7444 | 2962.248 | 235 | 4.07 | 20.4% | 1 | K.AAEPHAVSLAWSADGQTLFAGYTDNVIR.V | 3 |
| U | YNL064C | 7 | 20 | 28.6% | 409 | 44671 | 6.3 | YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_37.22856.22856.3 | 5.5506 | 0.5729 | 100.0% | 4461.6543 | 4461.7227 | 1 | 10.097 | 26.7% | 1 | R.DIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPR.G | 3 |
| * | Jamie_phos_02_itms_9.07612.07612.3 | 4.2127 | 0.4043 | 100.0% | 2174.2144 | 2174.462 | 2 | 6.848 | 37.5% | 3 | R.GKDIKHEISASLEELYKGR.T | 3 |
| * | Jamie_phos_02_itms_6.05652.05652.2 | 2.7694 | 0.3158 | 100.0% | 1420.0122 | 1419.5743 | 1 | 5.662 | 68.2% | 3 | K.HEISASLEELYK.G | 2 |
| * | Jamie_phos_01_itms_52.31745.31745.3 | 6.9724 | 0.4542 | 100.0% | 3720.7444 | 3720.0837 | 1 | 9.318 | 32.6% | 1 | K.RDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
| * | Jamie_phos_02_itms_39.25776.25776.3 | 5.2675 | 0.461 | 100.0% | 3562.7344 | 3563.8965 | 1 | 8.095 | 29.7% | 8 | R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
| * | Jamie_phos_02_itms_38.25171.25171.3 | 3.6279 | 0.3846 | 100.0% | 3449.6643 | 3448.8079 | 1 | 5.989 | 25.8% | 1 | D.GDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
| * | Jamie_phos_01_itms_12.07856.07856.3 | 4.1191 | 0.3886 | 100.0% | 2213.0942 | 2213.418 | 1 | 6.163 | 40.3% | 3 | K.KATVDECVLADFDPAKYNR.T | 3 |
| U | YEL003W | 1 | 1 | 28.5% | 123 | 14285 | 8.0 | GIM4 SGDID:S000000729, Chr V from 148227-148598, Verified ORF, "Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_38.29730.29730.4 | 2.9346 | 0.1374 | 93.8% | 4066.7766 | 4070.4817 | 19 | 3.644 | 19.1% | 1 | R.KCY*RMIGGALVESDVQTSLPILETKKENIEGTIS*K.M | 4 |
| U | YFL067W | 1 | 1 | 26.9% | 175 | 16473 | 6.8 | YFL067W SGDID:S000001827, Chr VI from 836-1363, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_45.27147.27147.4 | 4.6658 | 0.2629 | 100.0% | 4543.4565 | 4545.971 | 126 | 4.739 | 15.6% | 1 | -.MESIILSIAIFIGVLLGTSVGAGS*GSSISPDVDAGSGSRTSPDVDAG.S | 4 |
| U | YHL015W | 1 | 1 | 26.4% | 121 | 13907 | 9.5 | RPS20 SGDID:S000001007, Chr VIII from 75409-75774, Verified ORF, "Protein component of the small (40S) ribosomal subunit; overproduction suppresses mutations affecting RNA polymerase III-dependent transcription; has similarity to E. coli S10 and rat S20 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_10.08014.08014.4 | 3.0734 | 0.1095 | 92.0% | 3658.8564 | 3663.2156 | 205 | 3.012 | 19.4% | 1 | K.QLENVSSNIVKNAEQHNLVKKGPVRLPT*KVLK.I | 4 |
| U | YHR174W | 11 | 40 | 25.2% | 437 | 46914 | 6.0 | ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" |
| U | YOR373W | 25 | 81 | 24.4% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| U | YER074W | 2 | 4 | 24.4% | 135 | 15329 | 10.5 | RPS24A SGDID:S000000876, Chr V from 306319-306321,306788-307192, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" |
| U | YIL069C | 2 | 4 | 24.4% | 135 | 15329 | 10.5 | RPS24B SGDID:S000001331, Chr IX from 232366-232364,231954-231550, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_20.12237.12237.3 | 2.5539 | 0.1252 | 90.3% | 2030.4243 | 2030.3312 | 250 | 3.846 | 27.9% | 1 | K.LAEVYKAEKDAVSVFGFR.T | 3 | |
| Jamie_phos_03_itms_7.08464.08464.2 | 2.4041 | 0.3263 | 100.0% | 1541.4722 | 1541.7441 | 14 | 5.796 | 50.0% | 3 | K.SVGFGLVYNSVAEAK.K | 2 |
| U | YOR096W | 2 | 2 | 24.2% | 190 | 21622 | 9.8 | RPS7A SGDID:S000005622, Chr XV from 505794-505937,506339-506767, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Bp; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_37.22796.22796.3 | 4.7411 | 0.3298 | 100.0% | 3086.0942 | 3085.4785 | 1 | 6.065 | 27.8% | 1 | K.ILSQAPTELELQVAQAFVELENSSPELK.A | 3 |
| Jamie_phos_03_itms_8.08695.08695.3 | 3.2689 | 0.279 | 100.0% | 2188.2844 | 2189.4294 | 19 | 5.566 | 35.3% | 1 | K.DVQQIDYKLESFQAVYNK.L | 3 |
| U | YOL039W | 2 | 3 | 23.6% | 106 | 10746 | 4.0 | RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_8.08588.08588.2 | 2.6289 | 0.3861 | 100.0% | 1545.1322 | 1545.727 | 1 | 6.786 | 50.0% | 2 | K.AILESVGIEIEDEK.V | 2 |
| * | Jamie_phos_04_itms_15.15888.15888.3 | 4.0683 | 0.3353 | 100.0% | 2618.7844 | 2616.9658 | 6 | 5.667 | 26.0% | 1 | K.AILESVGIEIEDEKVSSVLSALEGK.S | 3 |
| U | Reverse_YPR145C-A | 1 | 1 | 23.1% | 78 | 9249 | 11.0 | YPR145C-A SGDID:S000113589, Chr XVI from 824922-824686, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_7.08505.08505.2 | 1.3195 | 0.208 | 95.9% | 2416.5122 | 2417.6409 | 9 | 3.561 | 32.4% | 1 | R.Y*NQPY*QSDSKKFILKIKR.F | 2 |
| U | Reverse_YOR252W | 1 | 1 | 22.7% | 141 | 16649 | 9.5 | YOR252W SGDID:S000005778, Chr XV from 803777-804202, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_17.16814.16814.4 | 3.0721 | 0.1155 | 92.1% | 3830.2966 | 3833.2761 | 197 | 3.576 | 17.2% | 1 | R.T*HAHDFIPQGKFTDSNVVDQMFKVRALEHVRK.D | 4 |
| U | YLR061W | 1 | 2 | 22.3% | 121 | 13693 | 6.2 | RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_14.08840.08840.3 | 3.1111 | 0.3227 | 100.0% | 3297.6843 | 3299.439 | 1 | 5.361 | 26.9% | 2 | R.FVSTKTNEYRLAFYQVTPEEDEEEDEE.- | 3 |
| U | Reverse_YGL029W | 1 | 1 | 20.0% | 120 | 14417 | 10.4 | CGR1 SGDID:S000002997, Chr VII from 440068-440430, Verified ORF, "Protein involved in nucleolar integrity and processing of the pre-rRNA for the 60S ribosome subunit; transcript is induced in response to cytotoxic stress but not genotoxic stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.20651.20651.3 | 2.5367 | 0.159 | 92.5% | 2783.0942 | 2784.1482 | 397 | 3.573 | 23.9% | 1 | K.VVRSKARLPT*KEAKWVKGSVPT*GK.A | 3 |
| U | YMR230W | 1 | 4 | 20.0% | 105 | 12738 | 9.1 | RPS10B SGDID:S000004843, Chr XIII from 732413-732464,732875-733140, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10" |
| U | YOR293W | 1 | 4 | 20.0% | 105 | 12739 | 8.8 | RPS10A SGDID:S000005819, Chr XV from 867095-867146,867584-867849, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Bp and has similarity to rat ribosomal protein S10" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_21.16633.16633.3 | 4.8317 | 0.4819 | 100.0% | 2741.6643 | 2740.9849 | 1 | 7.611 | 36.2% | 4 | K.TQFSWQYYYYTLTEEGVEYLR.E | 3 |
| U | YDL055C | 5 | 12 | 19.9% | 361 | 39566 | 6.3 | PSA1 SGDID:S000002213, Chr IV from 356759-355674, reverse complement, Verified ORF, "GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase), synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_31.18732.18732.2 | 3.6386 | 0.3737 | 100.0% | 2292.3123 | 2292.5159 | 1 | 6.641 | 50.0% | 1 | K.DNSPFFVLNSDVICEYPFK.E | 2 |
| * | Jamie_phos_01_itms_32.19734.19734.2 | 3.1331 | 0.4013 | 100.0% | 1642.5721 | 1641.9048 | 1 | 6.708 | 53.6% | 1 | K.DFLSGTVLYLNSLAK.R | 2 |
| * | Jamie_phos_02_itms_8.07344.07344.2 | 2.8956 | 0.3685 | 100.0% | 1751.9321 | 1751.9054 | 1 | 7.636 | 46.4% | 4 | K.STIVGWNSTVGQWCR.L | 2 |
| * | Jamie_phos_05_itms_6.10056.10056.2 | 2.1851 | 0.1454 | 97.0% | 2463.5122 | 2463.7441 | 2 | 3.616 | 31.8% | 1 | R.LEGVTVLGDDVEVKDEIYINGGK.V | 2 |
| * | Jamie_phos_05_itms_6.10033.10033.3 | 3.4617 | 0.1852 | 98.7% | 2465.3943 | 2463.7441 | 2 | 4.284 | 35.2% | 5 | R.LEGVTVLGDDVEVKDEIYINGGK.V | 3 |
| U | YGR254W | 8 | 31 | 19.7% | 437 | 46816 | 6.6 | ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_7.06264.06264.4 | 2.6625 | 0.1778 | 95.6% | 2584.0166 | 2584.8455 | 8 | 3.919 | 28.0% | 1 | R.SVYDSRGNPTVEVELTTEKGVFR.S | 44 | |
| Jamie_phos_01_itms_12.07490.07490.3 | 5.7877 | 0.2107 | 100.0% | 2587.8245 | 2584.8455 | 1 | 4.525 | 37.5% | 20 | R.SVYDSRGNPTVEVELTTEKGVFR.S | 33 | |
| Jamie_phos_01_itms_7.04854.04854.2 | 2.8825 | 0.2473 | 100.0% | 1416.2122 | 1417.556 | 2 | 7.513 | 58.3% | 2 | R.GNPTVEVELTTEK.G | 22 | |
| Jamie_phos_01_itms_10.06623.06623.2 | 2.0883 | 0.0976 | 91.4% | 1877.8322 | 1877.1045 | 59 | 4.522 | 40.6% | 1 | R.GNPTVEVELTTEKGVFR.S | 22 | |
| Jamie_phos_01_itms_32.19614.19614.3 | 7.2078 | 0.5495 | 100.0% | 2985.4143 | 2986.269 | 1 | 9.655 | 41.3% | 2 | K.RYPIVSIEDPFAEDDWEAWSHFFK.T | 33 | |
| Jamie_phos_01_itms_34.20802.20802.3 | 6.5457 | 0.4909 | 100.0% | 2831.4844 | 2830.0815 | 1 | 8.679 | 43.2% | 1 | R.YPIVSIEDPFAEDDWEAWSHFFK.T | 33 | |
| Jamie_phos_05_itms_13.16240.16240.2 | 4.1058 | 0.4771 | 100.0% | 1822.2522 | 1823.0099 | 1 | 9.306 | 65.6% | 2 | R.SGETEDTFIADLVVGLR.T | 22 | |
| * | Jamie_phos_02_itms_6.06008.06008.3 | 3.9997 | 0.3607 | 100.0% | 2441.6343 | 2442.6035 | 82 | 6.044 | 32.1% | 2 | R.IEEELGDNAVFAGENFHHGDKL.- | 3 |
| U | YDL229W | 6 | 7 | 18.3% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| U | YNL209W | 6 | 7 | 18.3% | 613 | 66595 | 5.5 | SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_20.14294.14294.3 | 3.4541 | 0.231 | 100.0% | 2965.1042 | 2965.1511 | 342 | 5.245 | 23.1% | 1 | R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A | 3 | |
| Jamie_phos_05_itms_13.16379.16379.2 | 3.7103 | 0.487 | 100.0% | 2965.3123 | 2965.1511 | 1 | 8.907 | 38.5% | 1 | R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A | 2 | |
| Jamie_phos_01_itms_31.19265.19265.4 | 3.7759 | 0.2019 | 100.0% | 3263.6165 | 3262.774 | 11 | 4.087 | 20.8% | 1 | R.ARFEDLNAALFKSTLEPVEQVLKDAKISK.S | 4 | |
| Jamie_phos_02_itms_6.05739.05739.2 | 3.4015 | 0.0633 | 95.7% | 1460.4321 | 1460.6273 | 3 | 6.117 | 61.5% | 1 | K.SQIDEVVLVGGSTR.I | 2 | |
| Jamie_phos_02_itms_4.04434.04434.2 | 2.1872 | 0.3018 | 100.0% | 1592.3722 | 1592.7495 | 2 | 4.684 | 46.7% | 1 | K.STGKSSNITISNAVGR.L | 2 | |
| Jamie_phos_01_itms_28.16937.16937.3 | 4.4849 | 0.2134 | 100.0% | 2757.1743 | 2756.0825 | 1 | 5.027 | 31.0% | 2 | K.SKIEAALSDALAALQIEDPSADELRK.A | 3 |
| U | YGL008C | 10 | 15 | 17.4% | 918 | 99619 | 5.1 | PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" |
| U | Reverse_YBR217W | 1 | 1 | 17.2% | 186 | 21106 | 6.8 | ATG12 SGDID:S000000421, Chr II from 657827-658387, Verified ORF, "Ubiquitin-like modifier, conjugated via an isopeptide bond to a lysine residue of Atg5p by the E1 enzyme, Atg7p, and the E2 enzyme, Atg10p, a step that is essential for autophagy" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_34.22410.22410.3 | 3.1927 | 0.0948 | 90.8% | 3540.8342 | 3542.749 | 13 | 2.944 | 21.8% | 1 | K.ITEEQEYTGSSSDEVQQDVSIDSALGLQSLRR.S | 3 |
| U | YCR031C | 1 | 1 | 16.8% | 137 | 14537 | 10.7 | RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" |
| U | YJL191W | 1 | 1 | 16.7% | 138 | 14650 | 10.5 | RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_8.08646.08646.3 | 3.5714 | 0.2732 | 100.0% | 2585.5745 | 2585.876 | 1 | 5.352 | 30.7% | 1 | R.IYASFNDTFVHVTDLSGKETIAR.V | 3 |
| U | YPL255W | 5 | 5 | 15.1% | 385 | 45384 | 6.5 | BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_18.11070.11070.4 | 3.6614 | 0.3163 | 100.0% | 2227.9766 | 2227.523 | 1 | 5.709 | 33.3% | 1 | K.SLKKVLDQTISHEAELATSR.E | 4 |
| * | Jamie_phos_01_itms_18.11513.11513.4 | 4.3378 | 0.182 | 100.0% | 2513.0566 | 2512.826 | 44 | 4.809 | 30.2% | 1 | K.SLKKVLDQTISHEAELATSRER.L | 4 |
| * | Jamie_phos_01_itms_8.05171.05171.2 | 2.7358 | 0.2613 | 100.0% | 1770.3722 | 1770.9371 | 1 | 4.836 | 46.7% | 1 | K.VLDQTISHEAELATSR.E | 2 |
| * | Jamie_phos_02_itms_7.06559.06559.3 | 3.5169 | 0.3119 | 100.0% | 2338.2844 | 2338.6814 | 1 | 5.59 | 36.1% | 1 | R.LSDLELKYTNLQIEKDMQR.D | 3 |
| * | Jamie_phos_01_itms_32.19482.19482.2 | 5.0878 | 0.3422 | 100.0% | 2060.132 | 2059.2834 | 1 | 6.348 | 65.6% | 1 | R.DNYESEIHDLLLQLSLR.N | 2 |
| U | Reverse_YLR327C | 1 | 1 | 15.1% | 86 | 9834 | 9.7 | YLR327C SGDID:S000004319, Chr XII from 783387-783127, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_18.13165.13165.2 | 1.9037 | 0.1937 | 98.4% | 1709.1322 | 1707.6309 | 12 | 4.558 | 45.8% | 1 | R.RENNQS*NSGRRT*K.N | 2 |
| U | YJL136C | 1 | 1 | 14.9% | 87 | 9760 | 6.1 | RPS21B SGDID:S000003672, Chr X from 157191-157168,156707-156468, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps21Bp and has similarity to rat S21 ribosomal protein" |
| U | YKR057W | 1 | 1 | 14.9% | 87 | 9746 | 6.1 | RPS21A SGDID:S000001765, Chr XI from 551299-551322,551645-551884, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps21Bp and has similarity to rat S21 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_4.04428.04428.2 | 2.455 | 0.2452 | 100.0% | 1368.5122 | 1368.4893 | 1 | 5.451 | 66.7% | 1 | K.ADDHASVQINVAK.V | 2 |
| U | YLR051C | 1 | 1 | 14.7% | 217 | 25636 | 9.5 | YLR051C SGDID:S000004041, Chr XII from 246978-246325, reverse complement, Uncharacterized ORF, "Protein required for cell viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_32.27937.27937.4 | 3.4068 | 0.1092 | 94.3% | 4292.8164 | 4295.8906 | 378 | 3.545 | 18.3% | 1 | K.YFKRKYNEIQEKST*S*GRKAHYKKMKEMRKKRR.- | 4 |
| U | YPL159C | 1 | 1 | 14.6% | 253 | 29103 | 10.2 | PET20 SGDID:S000006080, Chr XVI from 251667-250906, reverse complement, Uncharacterized ORF, "Protein required for respiratory growth and stability of the mitochondrial genome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_39.27664.27664.4 | 3.5926 | 0.0899 | 93.7% | 4385.4966 | 4379.9565 | 277 | 2.899 | 18.1% | 1 | K.SMNTNELIHVSAKRNTLVDNKTSETLQRKMDEFSKRR.G | 4 |
| U | YMR142C | 1 | 2 | 14.6% | 199 | 22525 | 11.1 | RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14109.14109.3 | 3.8666 | 0.1992 | 100.0% | 2955.4744 | 2955.2512 | 10 | 4.361 | 25.9% | 2 | R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A | 3 |
| U | YBL072C | 3 | 6 | 14.5% | 200 | 22490 | 10.7 | RPS8A SGDID:S000000168, Chr II from 89123-88521, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Ap and has similarity to rat S8 ribosomal protein" |
| U | YER102W | 3 | 6 | 14.5% | 200 | 22490 | 10.7 | RPS8B SGDID:S000000904, Chr V from 363096-363698, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Bp and has similarity to rat S8 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_12.07488.07488.2 | 1.9722 | 0.1019 | 90.6% | 1625.5721 | 1626.7631 | 3 | 3.431 | 46.4% | 1 | R.IETGNFSWASEGISK.K | 2 | |
| Jamie_phos_01_itms_35.21617.21617.2 | 1.8839 | 0.1157 | 91.7% | 1911.9521 | 1914.9371 | 125 | 3.159 | 33.3% | 1 | R.IETGNFSWAS*EGIS*KK.T | 2 | |
| Jamie_phos_02_itms_5.04712.04712.2 | 4.3451 | 0.3828 | 100.0% | 1396.8922 | 1397.4845 | 1 | 8.031 | 83.3% | 4 | K.IESSVESQFSAGR.L | 2 |
| U | YGR192C | 3 | 13 | 14.2% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_14.10606.10606.3 | 4.8921 | 0.3727 | 100.0% | 3266.4844 | 3266.5913 | 1 | 6.446 | 27.6% | 1 | K.IATYQERDPANLPWGSSNVDIAIDSTGVFK.E | 3 |
| Jamie_phos_02_itms_9.07632.07632.2 | 4.0723 | 0.3973 | 100.0% | 2127.612 | 2128.3484 | 1 | 6.995 | 59.4% | 4 | K.FVKLVSWYDNEYGYSTR.V | 2 | |
| Jamie_phos_01_itms_12.07383.07383.2 | 3.6323 | 0.3526 | 100.0% | 1753.0922 | 1753.8651 | 1 | 8.208 | 69.2% | 8 | K.LVSWYDNEYGYSTR.V | 2 |
| U | YOR051C | 2 | 2 | 13.8% | 412 | 47352 | 4.8 | YOR051C SGDID:S000005577, Chr XV from 426085-424847, reverse complement, Uncharacterized ORF, "Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_12.11104.11104.2 | 2.5005 | 0.2159 | 100.0% | 2350.7122 | 2351.4983 | 5 | 5.233 | 35.0% | 1 | R.SQMSVELDDDADLDDELAQLK.G | 2 |
| * | Jamie_phos_01_itms_39.23900.23900.3 | 6.4527 | 0.4616 | 100.0% | 4083.0842 | 4084.3496 | 1 | 7.588 | 26.4% | 1 | K.AKLEDDPDTWVQVAEAYIDLGNLLDNESAEQEEAYK.T | 3 |
| U | YFR031C-A | 2 | 2 | 13.8% | 254 | 27408 | 11.1 | RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" |
| U | YIL018W | 2 | 2 | 13.8% | 254 | 27408 | 11.1 | RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_7.04476.04476.4 | 3.8858 | 0.1791 | 100.0% | 2098.2966 | 2099.3108 | 7 | 4.781 | 30.6% | 1 | R.ASGNYVIIIGHNPDENKTR.V | 4 | |
| Jamie_phos_02_itms_35.23244.23244.2 | 2.2414 | 0.2176 | 100.0% | 2023.6921 | 2022.2723 | 114 | 3.76 | 35.3% | 1 | K.TRVRLPSGAKKVIS*SDAR.G | 2 |
| U | YLR075W | 2 | 2 | 13.6% | 221 | 25361 | 10.0 | RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_34.20850.20850.3 | 3.077 | 0.1644 | 96.2% | 3358.3743 | 3357.7083 | 2 | 4.237 | 22.4% | 1 | K.KATVDEFPLCVHLVSNELEQLSSEALEAAR.I | 3 |
| * | Jamie_phos_01_itms_37.22455.22455.3 | 5.0042 | 0.4128 | 100.0% | 3229.4043 | 3229.5342 | 1 | 7.477 | 31.2% | 1 | K.ATVDEFPLCVHLVSNELEQLSSEALEAAR.I | 3 |
| U | YER042W | 1 | 1 | 13.6% | 184 | 21141 | 7.0 | MXR1 SGDID:S000000844, Chr V from 234936-235490, Verified ORF, "Peptide methionine sulfoxide reductase, reverses the oxidation of methionine residues; involved in oxidative damage repair, providing resistance to oxidative stress and regulation of lifespan" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.21979.21979.3 | 2.7967 | 0.141 | 92.9% | 3219.0544 | 3222.445 | 7 | 4.37 | 22.9% | 1 | K.Y*DPAKDKLITLACGCFWGTEHMY*RK.Y | 3 |
| U | YLR026C | 1 | 1 | 13.5% | 340 | 38807 | 7.0 | SED5 SGDID:S000004016, Chr XII from 196473-195451, reverse complement, Verified ORF, "cis-Golgi t-SNARE syntaxin required for vesicular transport between the ER and the Golgi complex, binds at least 9 SNARE proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_36.21996.21996.4 | 3.3624 | 0.11 | 94.2% | 5062.177 | 5066.0166 | 98 | 3.383 | 14.8% | 1 | K.KASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRK.I | 4 |
| U | YNL252C | 1 | 1 | 13.5% | 281 | 32213 | 9.1 | MRPL17 SGDID:S000005196, Chr XIV from 172287-171442, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_33.20048.20048.4 | 3.583 | 0.0858 | 93.1% | 4110.177 | 4106.7075 | 10 | 3.133 | 18.5% | 1 | R.GLATATATAS*SAPPKIKVGVLLS*RIPIIKSELNELEKK.Y | 4 |
| U | Reverse_YDL043C | 1 | 1 | 13.5% | 266 | 29921 | 8.1 | PRP11 SGDID:S000002201, Chr IV from 376477-375677, reverse complement, Verified ORF, "Subunit of the SF3a splicing factor complex, required for spliceosome assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.21059.21059.4 | 3.163 | 0.1241 | 94.0% | 4225.6963 | 4225.7686 | 385 | 3.099 | 18.1% | 1 | R.LVNLGHKKGGLHREVSSWSMHMTNCLKCVLKGS*HNK.Y | 4 |
| U | YKL096W | 2 | 7 | 13.4% | 239 | 24268 | 4.7 | CWP1 SGDID:S000001579, Chr XI from 260776-261495, Verified ORF, "Cell wall mannoprotein, linked to a beta-1,3- and beta-1,6-glucan heteropolymer through a phosphodiester bond; involved in cell wall organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_7.06482.06482.3 | 5.4538 | 0.4827 | 100.0% | 3471.1443 | 3471.7124 | 1 | 8.404 | 30.6% | 4 | K.LKFDDDKYAVVNEDGSFKEGSESDAATGFSIK.D | 3 |
| * | Jamie_phos_03_itms_6.07101.07101.3 | 4.0384 | 0.1052 | 96.4% | 3231.7744 | 3230.379 | 1 | 4.717 | 25.9% | 3 | K.FDDDKYAVVNEDGSFKEGSESDAATGFSIK.D | 3 |
| U | Reverse_YKL164C | 1 | 1 | 13.2% | 341 | 34622 | 6.5 | PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_42.25620.25620.4 | 3.2438 | 0.1416 | 95.7% | 4614.6963 | 4609.9604 | 171 | 3.328 | 16.7% | 1 | K.TKT*TAQIQGDGIQSVAAATT*KASTTKTTAQIQGDGIQSVAAAKTK.T | 4 |
| U | YJL177W | 1 | 1 | 13.0% | 184 | 20551 | 10.9 | RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins" |
| U | YKL180W | 1 | 1 | 13.0% | 184 | 20549 | 10.9 | RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_6.05577.05577.3 | 2.2132 | 0.1744 | 90.6% | 2701.5244 | 2702.0337 | 1 | 3.901 | 27.2% | 1 | R.INKYESSPSHIELVVTEKEEAVAK.A | 3 |
| U | YGR152C | 1 | 1 | 12.9% | 272 | 30391 | 9.2 | RSR1 SGDID:S000003384, Chr VII from 795497-794679, reverse complement, Verified ORF, "GTP-binding protein of the ras superfamily required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_20.16037.16037.4 | 3.0919 | 0.1468 | 95.6% | 3862.2966 | 3863.1099 | 105 | 3.436 | 18.6% | 1 | K.VKQST*PVNEKHKPSHAVPKSGSSNRTGISAT*SQQK.K | 4 |
| U | YIR032C | 1 | 1 | 12.8% | 195 | 21727 | 5.4 | DAL3 SGDID:S000001471, Chr IX from 415614-415027, reverse complement, Verified ORF, "Ureidoglycolate hydrolase, converts ureidoglycolate to glyoxylate and urea in the third step of allantoin degradation; expression sensitive to nitrogen catabolite repression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14471.14471.4 | 3.1785 | 0.1201 | 93.7% | 2833.7766 | 2835.098 | 443 | 3.412 | 23.6% | 1 | R.TSAEVAY*LVVVAKEIGNKPDLST*LR.A | 4 |
| U | YNL188W | 4 | 8 | 12.7% | 433 | 50653 | 9.3 | KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_12.09744.09744.4 | 5.4698 | 0.3689 | 100.0% | 4723.2163 | 4722.985 | 1 | 5.373 | 21.9% | 5 | R.KREFEPTLAENKAEEYIS*DEDNVKIDEDNIENELQFTPK.I | 4 |
| * | Jamie_phos_01_itms_26.15832.15832.3 | 3.9118 | 0.2872 | 100.0% | 4438.1646 | 4438.6235 | 48 | 5.315 | 18.8% | 1 | R.EFEPTLAENKAEEYIS*DEDNVKIDEDNIENELQFTPK.I | 3 |
| * | Jamie_phos_02_itms_14.10400.10400.3 | 2.8262 | 0.1272 | 91.8% | 3278.1543 | 3279.3625 | 353 | 3.863 | 21.2% | 1 | K.AEEYIS*DEDNVKIDEDNIENELQFTPK.I | 3 |
| * | Jamie_phos_01_itms_19.11642.11642.3 | 3.2894 | 0.266 | 100.0% | 1847.9043 | 1848.101 | 4 | 5.218 | 40.0% | 1 | K.KLDTIIELLKDDTDSK.E | 3 |
| U | YNL310C | 1 | 1 | 12.7% | 205 | 23542 | 9.8 | ZIM17 SGDID:S000005254, Chr XIV from 52523-51906, reverse complement, Verified ORF, "Heat shock protein with a zinc finger motif; essential for protein import into mitochondria; may act with Pam18p to facilitate recognition and folding of imported proteins by Ssc1p (mtHSP70) in the mitochondrial matrix" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14770.14770.3 | 2.8713 | 0.1242 | 92.0% | 3164.5745 | 3161.7144 | 121 | 3.321 | 23.0% | 1 | K.KDDKKVHLGS*FKVDKPKMMIAFTCKK.C | 3 |
| U | YIL148W | 1 | 3 | 12.5% | 128 | 14554 | 9.8 | RPL40A SGDID:S000001410, Chr IX from 68708-68715,69150-69528, Verified ORF, "Fusion protein, identical to Rpl40Bp, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" |
| U | YLR167W | 1 | 3 | 10.5% | 152 | 17216 | 9.9 | RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" |
| U | YLL039C | 1 | 15 | 4.2% | 381 | 42826 | 7.6 | UBI4 SGDID:S000003962, Chr XII from 65206-64061, reverse complement, Verified ORF, "Ubiquitin, becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response" |
| U | YKR094C | 1 | 3 | 12.5% | 128 | 14554 | 9.8 | RPL40B SGDID:S000001802, Chr XI from 618392-618385,618016-617638, reverse complement, Verified ORF, "Fusion protein, identical to Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_6.06734.06734.2 | 2.73 | 0.266 | 100.0% | 1765.2922 | 1764.9244 | 1 | 6.627 | 53.3% | 3 | K.TITLEVESSDTIDNVK.S | 2 |
| U | YER083C | 1 | 1 | 12.3% | 285 | 31493 | 9.5 | GET2 SGDID:S000000885, Chr V from 327027-326170, reverse complement, Verified ORF, "Subunit of the GET complex; required for meiotic nuclear division and for the retrieval of HDEL proteins from the Golgi to the ER in an ERD2 dependent fashion; may be involved in cell wall function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_63.37992.37992.4 | 3.2293 | 0.0904 | 90.8% | 4299.0166 | 4303.955 | 153 | 3.194 | 19.1% | 1 | K.WVFFLLPYLYLIT*RPNSSVWPAYAFTQSAWFAPLR.N | 4 |
| U | YGL011C | 1 | 1 | 12.3% | 252 | 28001 | 6.2 | SCL1 SGDID:S000002979, Chr VII from 475252-474494, reverse complement, Verified ORF, "Alpha subunit of the 20S core complex of the 26S proteasome involved in the degradation of ubiquitinated substrates; essential for growth; detected in the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_13.14530.14530.4 | 3.4615 | 0.0939 | 93.1% | 3381.7766 | 3379.85 | 5 | 3.566 | 21.7% | 1 | K.VVEFAITHMIDALGTEFSKNDLEVGVATKDK.F | 4 |
| U | Reverse_YGL183C | 1 | 1 | 12.3% | 219 | 26083 | 9.4 | MND1 SGDID:S000003151, Chr VII from 157291-157289,157205-156549, reverse complement, Verified ORF, "Protein required for recombination and meiotic nuclear division; forms a complex with Hop2p, which is involved in chromosome pairing and repair of meiotic double-strand breaks" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_38.29546.29546.4 | 2.8629 | 0.1403 | 93.6% | 3422.7766 | 3424.9658 | 22 | 3.363 | 23.1% | 1 | K.KY*LYDILIEINDTTKELHVKKLRIQQK.N | 4 |
| U | YHR152W | 1 | 1 | 12.1% | 173 | 19912 | 9.4 | SPO12 SGDID:S000001195, Chr VIII from 401437-401958, Verified ORF, "Nucleolar protein of unknown function, positive regulator of exit from mitosis; involved in regulating the release of Cdc14p from the nucleolus in early anaphase; proposed to play similar role in meiosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_10.06303.06303.4 | 3.0135 | 0.1089 | 92.1% | 2541.4966 | 2537.7495 | 169 | 3.135 | 27.5% | 1 | R.IFRKKSTSNLKS*SHTT*SNLVK.K | 4 |
| U | YOR134W | 2 | 2 | 12.0% | 409 | 46216 | 7.5 | BAG7 SGDID:S000005660, Chr XV from 578564-579793, Verified ORF, "Rho GTPase activating protein (RhoGAP), stimulates the intrinsic GTPase activity of Rho1p, which plays a role in actin cytoskeleton organization and control of cell wall synthesis; structurally and functionally related to Sac7p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_22.15330.15330.2 | 1.6795 | 0.1644 | 95.6% | 2073.7322 | 2074.1687 | 170 | 3.834 | 34.4% | 1 | K.SGKY*LKENALDT*TGIFR.I | 2 |
| * | Jamie_phos_04_itms_23.20799.20799.4 | 2.8182 | 0.16 | 95.2% | 3424.9766 | 3423.719 | 9 | 4.154 | 21.5% | 1 | R.T*LSAESLSPRLSKLLGNVGNSSNTGIKDPTER.V | 4 |
| U | Reverse_YGR006W | 1 | 1 | 12.0% | 251 | 28377 | 6.7 | PRP18 SGDID:S000003238, Chr VII from 506074-506829, Verified ORF, "Splicing factor involved in the positioning of the 3' splice site during the second catalytic step of splicing, recruited to the spliceosome by Slu7p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_28.19326.19326.4 | 3.5022 | 0.1668 | 98.0% | 3503.2966 | 3504.9521 | 87 | 4.022 | 21.3% | 1 | R.KIST*IWLRTREDIMINAANRGGQIKSHASR.A | 4 |
| U | YGL147C | 1 | 2 | 12.0% | 191 | 21569 | 9.7 | RPL9A SGDID:S000003115, Chr VII from 228334-227759, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_14.10525.10525.3 | 4.0153 | 0.2157 | 100.0% | 2710.9443 | 2710.105 | 1 | 5.012 | 33.0% | 2 | R.NKDIRKFLDGIYVSHKGFITEDL.- | 3 |
| U | YNL302C | 1 | 1 | 11.8% | 144 | 15891 | 9.6 | RPS19B SGDID:S000005246, Chr XIV from 62943-62924,62372-61958, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps19Ap and has similarity to rat S19 ribosomal protein" |
| U | YOL121C | 1 | 1 | 11.8% | 144 | 15917 | 9.6 | RPS19A SGDID:S000005481, Chr XV from 92849-92830,92439-92025, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps19Bp and has similarity to rat S19 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_32.19580.19580.2 | 3.138 | 0.3315 | 100.0% | 1930.2122 | 1930.1271 | 1 | 5.886 | 43.8% | 1 | R.DVAAQDFINAYASFLQR.Q | 2 |
| U | YLR044C | 3 | 7 | 11.5% | 563 | 61495 | 6.2 | PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_31.18912.18912.2 | 2.1956 | 0.2276 | 100.0% | 2290.3123 | 2291.6091 | 4 | 4.736 | 32.5% | 1 | K.QVNVNTVFGLPGDFNLSLLDK.I | 2 |
| Jamie_phos_02_itms_6.05899.05899.2 | 4.014 | 0.3978 | 100.0% | 1999.1522 | 1999.1063 | 1 | 6.951 | 47.2% | 4 | R.WAGNANELNAAYAADGYAR.I | 2 | |
| * | Jamie_phos_01_itms_22.13520.13520.3 | 4.7843 | 0.3364 | 100.0% | 2744.0645 | 2744.2065 | 1 | 6.098 | 33.3% | 2 | R.TTYVTQRPVYLGLPANLVDLNVPAK.L | 3 |
| U | YBL002W | 1 | 1 | 11.5% | 131 | 14237 | 10.1 | HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" |
| U | YDR224C | 1 | 1 | 11.5% | 131 | 14252 | 10.1 | HTB1 SGDID:S000002632, Chr IV from 914706-914311, reverse complement, Verified ORF, "One of two nearly identical (see HTB2) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_33.19997.19997.2 | 2.6158 | 0.1569 | 98.6% | 1772.4321 | 1773.0137 | 268 | 4.653 | 39.3% | 1 | K.SMSILNSFVNDIFER.I | 2 |
| U | YGR159C | 2 | 2 | 11.4% | 414 | 44535 | 4.9 | NSR1 SGDID:S000003391, Chr VII from 807661-806417, reverse complement, Verified ORF, "Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_5.05812.05812.2 | 3.0827 | 0.3475 | 100.0% | 1770.0122 | 1770.8926 | 1 | 6.403 | 57.1% | 1 | R.GYGYVDFENKSYAEK.A | 2 |
| * | Jamie_phos_02_itms_25.17101.17101.3 | 3.7583 | 0.3386 | 100.0% | 3536.3342 | 3536.8762 | 1 | 5.761 | 27.4% | 1 | K.FGDTPSEPSDTLFLGNLSFNADRDAIFELFAK.H | 3 |
| U | Reverse_YNL190W | 1 | 4 | 11.3% | 204 | 21966 | 10.4 | YNL190W SGDID:S000005134, Chr XIV from 282396-283010, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_04_itms_24.21122.21122.3 | 2.647 | 0.1662 | 94.3% | 2743.3442 | 2738.8906 | 29 | 4.059 | 27.3% | 4 | K.STKNFKGY*KHTGTHNPT*KSKSTK.N | 3 |
| U | YLR249W | 5 | 13 | 11.2% | 1044 | 115945 | 6.0 | YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.18046.18046.4 | 3.7601 | 0.1145 | 95.8% | 3353.0566 | 3351.6995 | 2 | 4.112 | 25.3% | 1 | R.HEIASEVASFLNGNIIEHDVPEHFFGELAK.G | 4 |
| * | Jamie_phos_01_itms_21.12930.12930.3 | 4.6776 | 0.4016 | 100.0% | 3846.3843 | 3847.9705 | 1 | 7.77 | 28.8% | 3 | K.RAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I | 3 |
| * | Jamie_phos_01_itms_24.14636.14636.3 | 3.7264 | 0.3162 | 100.0% | 3692.5144 | 3691.783 | 1 | 5.02 | 24.2% | 1 | R.AVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I | 3 |
| * | Jamie_phos_03_itms_12.11380.11380.3 | 4.5024 | 0.3491 | 100.0% | 3155.8743 | 3156.3862 | 5 | 6.517 | 25.0% | 2 | R.TVYVEHDIDGTHSDTSVLDFVFESGVGTK.E | 3 |
| * | Jamie_phos_01_itms_23.14162.14162.3 | 5.1433 | 0.3486 | 100.0% | 2776.1643 | 2777.0564 | 1 | 6.448 | 34.8% | 6 | K.AYEELSNTDLEFKFPEPGYLEGVK.T | 3 |
| U | Reverse_YLR026C | 1 | 1 | 11.2% | 340 | 38807 | 7.0 | SED5 SGDID:S000004016, Chr XII from 196473-195451, reverse complement, Verified ORF, "cis-Golgi t-SNARE syntaxin required for vesicular transport between the ER and the Golgi complex, binds at least 9 SNARE proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.16985.16985.4 | 4.1736 | 0.107 | 97.5% | 4313.8564 | 4318.615 | 384 | 3.039 | 16.2% | 1 | K.SHQVASPQKSSQNSTNGNVDT*KKLQSLQVLSQEIAY*IK.R | 4 |
| U | YBL016W | 1 | 1 | 11.0% | 353 | 40772 | 7.1 | FUS3 SGDID:S000000112, Chr II from 192454-193515, Verified ORF, "Mitogen-activated protein kinase involved in mating pheromone response; activated by phoshporylation by Ste7p; provides specificity during the mating vs. filamentous growth response by phosphorylating transcriptional and cytoplasmic targets" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_39.23829.23829.4 | 3.791 | 0.1871 | 99.3% | 4280.7363 | 4275.812 | 5 | 3.376 | 18.0% | 1 | R.IVY*NISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKK.I | 4 |
| U | YGR048W | 1 | 1 | 10.8% | 361 | 39810 | 6.2 | UFD1 SGDID:S000003280, Chr VII from 589830-590915, Verified ORF, "Protein that interacts with Cdc48p and Npl4p, involved in recognition of polyubiquitinated proteins and their presentation to the 26S proteasome for degradation; involved in transporting proteins from the ER to the cytosol" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_35.21351.21351.4 | 3.9919 | 0.0842 | 95.2% | 4193.4165 | 4193.638 | 95 | 2.97 | 18.9% | 1 | K.KNS*FGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLSK.F | 4 |
| U | YJL190C | 1 | 4 | 10.8% | 130 | 14626 | 9.9 | RPS22A SGDID:S000003726, Chr X from 75301-74909, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| U | YLR367W | 1 | 4 | 10.8% | 130 | 14626 | 9.9 | RPS22B SGDID:S000004359, Chr XII from 856441-856573,857057-857316, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_10.06123.06123.3 | 4.1509 | 0.3086 | 100.0% | 1751.0044 | 1751.8522 | 1 | 5.745 | 53.8% | 4 | K.HGYIGEFEYIDDHR.S | 3 |
| U | Reverse_YBR234C | 1 | 1 | 10.7% | 384 | 42475 | 7.0 | ARC40 SGDID:S000000438, Chr II from 686587-685433, reverse complement, Verified ORF, "Essential subunit of the ARP2/3 complex, which is required for the motility and integrity of cortical actin patches" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_34.27138.27138.4 | 3.1817 | 0.1865 | 97.7% | 4494.6567 | 4495.5986 | 2 | 4.383 | 18.8% | 1 | K.FKRLAS*IGFTSSEDNNGS*LEDTNGSATLASSKNNDSKDLNK.A | 4 |
| U | Reverse_YBL064C | 1 | 1 | 10.7% | 261 | 29496 | 8.9 | PRX1 SGDID:S000000160, Chr II from 101158-100373, reverse complement, Verified ORF, "Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase activity, has a role in reduction of hydroperoxides; induced during respiratory growth and under conditions of oxidative stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17144.17144.4 | 3.4757 | 0.1022 | 94.1% | 3337.4565 | 3339.6438 | 40 | 3.51 | 22.8% | 1 | K.DTLQLADIVRLVES*T*NRGVTSPYTFILR.I | 4 |
| U | YIL070C | 1 | 1 | 10.5% | 266 | 30132 | 4.6 | MAM33 SGDID:S000001332, Chr IX from 231069-230269, reverse complement, Verified ORF, "Acidic protein of the mitochondrial matrix involved in oxidative phosphorylation; related to the human complement receptor gC1q-R" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_34.20775.20775.3 | 3.7999 | 0.185 | 99.3% | 3300.8044 | 3298.5867 | 4 | 4.33 | 23.1% | 1 | R.GVNEELASFISAYSEFKENNEYISWLEK.M | 3 |
| U | YDR050C | 1 | 4 | 10.5% | 248 | 26795 | 6.0 | TPI1 SGDID:S000002457, Chr IV from 556469-555723, reverse complement, Verified ORF, "Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_15.11202.11202.3 | 5.179 | 0.3703 | 100.0% | 2764.5544 | 2764.1077 | 1 | 6.7 | 37.0% | 4 | K.DKADVDGFLVGGASLKPEFVDIINSR.N | 3 |
| U | YNR014W | 1 | 1 | 10.4% | 212 | 23077 | 8.4 | YNR014W SGDID:S000005297, Chr XIV from 652467-653105, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_34.20784.20784.3 | 2.5895 | 0.2701 | 99.5% | 2331.1743 | 2332.2458 | 181 | 4.476 | 26.2% | 1 | R.SS*SRSSSSSSCSSATSKACSPR.G | 3 |
| U | Reverse_YBR145W | 1 | 1 | 10.3% | 351 | 37648 | 6.4 | ADH5 SGDID:S000000349, Chr II from 533756-534811, Verified ORF, "Alcohol dehydrogenase isoenzyme V; involved in ethanol production" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_37.26214.26214.4 | 2.7037 | 0.1356 | 91.2% | 3819.5764 | 3817.3643 | 173 | 3.679 | 19.0% | 1 | R.YGMALAYQIALSGLGGCAGSIT*VWQGPIVNARKLAK.Y | 4 |
| U | YLR193C | 1 | 1 | 10.3% | 175 | 20108 | 9.8 | YLR193C SGDID:S000004183, Chr XII from 540538-540011, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_14.17000.17000.2 | 1.7662 | 0.1182 | 90.6% | 2157.392 | 2156.3342 | 3 | 3.312 | 41.2% | 1 | K.FSS*GFNMGIKSKVEDWSR.T | 2 |
| U | YOL028C | 1 | 1 | 10.2% | 245 | 27387 | 9.7 | YAP7 SGDID:S000005388, Chr XV from 271370-270633, reverse complement, Verified ORF, "Putative basic leucine zipper (bZIP) transcription factor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_21.13208.13208.4 | 2.4715 | 0.2353 | 97.8% | 3048.0964 | 3053.2207 | 172 | 4.096 | 23.6% | 1 | K.LLESEFS*DT*KENLQKSIALNNELQK.A | 4 |
| U | YIL053W | 2 | 4 | 10.0% | 271 | 30439 | 6.6 | RHR2 SGDID:S000001315, Chr IX from 255050-255865, Verified ORF, "Constitutively expressed isoform of DL-glycerol-3-phosphatase; involved in glycerol biosynthesis, induced in response to both anaerobic and, along with the Hor2p/Gpp2p isoform, osmotic stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_20.16210.16210.3 | 2.4375 | 0.1599 | 91.9% | 2597.0344 | 2597.7913 | 52 | 4.117 | 27.4% | 1 | R.VGEYNAETDEVELIFDDYLYAK.D | 3 |
| * | Jamie_phos_03_itms_21.16557.16557.3 | 4.9637 | 0.2882 | 100.0% | 3183.0842 | 3182.4614 | 1 | 5.458 | 29.8% | 3 | R.VGEYNAETDEVELIFDDYLYAKDDLLK.W | 3 |
| U | YDL192W | 2 | 7 | 9.9% | 181 | 20529 | 7.4 | ARF1 SGDID:S000002351, Chr IV from 116322-116867, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_11.06782.06782.3 | 2.4227 | 0.2074 | 96.4% | 2346.8643 | 2345.3604 | 76 | 4.498 | 26.5% | 1 | R.HY*YRNT*EGVIFVVDSNDR.S | 3 |
| * | Jamie_phos_03_itms_6.07091.07091.2 | 4.319 | 0.3096 | 100.0% | 1566.2522 | 1565.6799 | 1 | 7.519 | 73.1% | 6 | R.NTEGVIFVVDSNDR.S | 2 |
| U | YGL075C | 3 | 18 | 9.8% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_13.08258.08258.2 | 2.5159 | 0.3024 | 100.0% | 1183.0721 | 1183.1771 | 2 | 5.422 | 65.0% | 16 | K.NTEGAGIST*PR.K | 2 |
| * | Jamie_phos_01_itms_7.04616.04616.2 | 2.1556 | 0.0725 | 90.1% | 1314.8322 | 1314.5248 | 49 | 3.297 | 50.0% | 1 | K.ALEVQVEELKR.E | 2 |
| * | Jamie_phos_03_itms_45.31195.31195.2 | 1.729 | 0.1297 | 91.6% | 2092.672 | 2092.269 | 26 | 3.79 | 36.7% | 1 | K.IVWFFEDQTDLETEYR.S | 2 |
| U | Reverse_YDR259C | 1 | 1 | 9.7% | 383 | 43597 | 8.7 | YAP6 SGDID:S000002667, Chr IV from 975776-974625, reverse complement, Verified ORF, "Putative basic leucine zipper (bZIP) transcription factor; overexpression increases sodium and lithium tolerance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_40.24260.24260.4 | 4.1362 | 0.1519 | 98.8% | 4144.4165 | 4148.352 | 23 | 4.58 | 19.0% | 1 | K.QSTS*PQAIQPSPHENLNKESANYTAMSSSGQNYMDPR.I | 4 |
| U | YMR186W | 5 | 20 | 9.6% | 705 | 80900 | 4.8 | HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" |
| U | YPL240C | 5 | 20 | 9.6% | 709 | 81406 | 4.9 | HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_8.07179.07179.2 | 3.3132 | 0.2638 | 100.0% | 1783.6122 | 1784.016 | 1 | 5.427 | 65.4% | 2 | R.LFLKDDQLEYLEEK.R | 2 | |
| Jamie_phos_01_itms_48.29501.29501.3 | 3.4129 | 0.1111 | 94.3% | 3748.4043 | 3748.2214 | 1 | 3.764 | 21.9% | 1 | R.VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSR.E | 3 | |
| Jamie_phos_03_itms_8.09046.09046.2 | 2.882 | 0.3531 | 100.0% | 2510.3523 | 2511.699 | 1 | 6.634 | 45.0% | 3 | K.TLVDITKDFELEETDEEKAER.E | 2 | |
| Jamie_phos_03_itms_8.09045.09045.3 | 6.273 | 0.4592 | 100.0% | 2510.6343 | 2511.699 | 1 | 7.387 | 42.5% | 10 | K.TLVDITKDFELEETDEEKAER.E | 3 | |
| Jamie_phos_03_itms_8.09064.09064.4 | 3.5435 | 0.1859 | 99.3% | 2511.8965 | 2511.699 | 1 | 4.527 | 35.0% | 4 | K.TLVDITKDFELEETDEEKAER.E | 4 |
| U | YBR118W | 3 | 5 | 9.6% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| U | YPR080W | 3 | 5 | 9.6% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_7.04390.04390.3 | 3.6933 | 0.3276 | 100.0% | 1560.9844 | 1561.7812 | 1 | 6.352 | 42.9% | 3 | K.SHINVVVIGHVDSGK.S | 3 | |
| Jamie_phos_02_itms_5.04776.04776.2 | 2.4291 | 0.2269 | 100.0% | 1561.5122 | 1561.7812 | 1 | 5.735 | 57.1% | 1 | K.SHINVVVIGHVDSGK.S | 2 | |
| Jamie_phos_01_itms_24.14615.14615.3 | 3.9818 | 0.3217 | 100.0% | 3322.7344 | 3321.8418 | 2 | 5.736 | 23.2% | 1 | K.TLLEAIDAIEQPSRPTDKPLRLPLQDVYK.I | 3 |
| U | YIL094C | 1 | 1 | 9.4% | 371 | 40069 | 8.0 | LYS12 SGDID:S000001356, Chr IX from 187629-186514, reverse complement, Verified ORF, "Homo-isocitrate dehydrogenase, an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine, in which homo-isocitrate is oxidatively decarboxylated to alpha-ketoadipate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_70.42176.42176.4 | 3.4447 | 0.2008 | 99.0% | 3653.0964 | 3653.0537 | 270 | 3.84 | 21.1% | 1 | R.LS*ACRGLASNAARKSLT*IGLIPGDGIGKEVIPAGK.Q | 4 |
| U | YAL047C | 4 | 7 | 9.3% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_9.14052.14052.2 | 2.0305 | 0.1155 | 92.7% | 1998.2322 | 1999.1761 | 4 | 3.778 | 40.6% | 1 | R.ETLEETLELSSDYVLEK.M | 2 |
| * | Jamie_phos_01_itms_29.17580.17580.3 | 3.7157 | 0.1765 | 99.8% | 2331.5044 | 2330.5542 | 1 | 4.331 | 44.1% | 1 | R.FEKT*LDT*QLEIVIEILHK.E | 3 |
| * | Jamie_phos_01_itms_29.17996.17996.3 | 3.3047 | 0.0661 | 92.8% | 1846.3444 | 1846.088 | 1 | 3.349 | 60.7% | 1 | K.TLDT*QLEIVIEILHK.E | 3 |
| * | Jamie_phos_02_itms_9.07916.07916.3 | 4.618 | 0.2635 | 100.0% | 2616.7144 | 2614.823 | 1 | 5.533 | 42.0% | 4 | K.LNEQSHLLDSLELEENSSSVIEK.Q | 3 |
| U | YGL196W | 1 | 1 | 9.3% | 428 | 47828 | 7.6 | YGL196W SGDID:S000003164, Chr VII from 129888-131174, Uncharacterized ORF, "Putative protein of unknown function; deletion mutant is viable and has no detectable phenotype" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_55.33606.33606.4 | 3.1698 | 0.1123 | 92.9% | 4651.2563 | 4650.9395 | 166 | 3.319 | 16.2% | 1 | K.LTSSEIKEVIEPYGFY*AHAGHSY*SSTSINDTQNLLMEEVK.A | 4 |
| U | YKL104C | 4 | 6 | 9.2% | 717 | 80047 | 6.4 | GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_6.04261.04261.3 | 3.268 | 0.3295 | 100.0% | 1600.0443 | 1600.7405 | 11 | 5.441 | 40.4% | 1 | R.DVTFVSHCGIAHTR.W | 3 |
| * | Jamie_phos_03_itms_11.10954.10954.3 | 4.6068 | 0.1919 | 100.0% | 3263.5745 | 3263.4583 | 9 | 4.499 | 25.9% | 3 | R.HSQS*RAFLSEDGSPTPVEFFVSSDAASVVK.H | 3 |
| * | Jamie_phos_03_itms_11.10965.10965.3 | 4.9549 | 0.3055 | 100.0% | 3264.1143 | 3263.4583 | 2 | 5.556 | 29.3% | 1 | R.HS*QSRAFLSEDGSPTPVEFFVSSDAASVVK.H | 3 |
| * | Jamie_phos_03_itms_9.09565.09565.3 | 3.9045 | 0.2786 | 100.0% | 2650.0444 | 2649.9658 | 1 | 6.104 | 34.5% | 1 | K.KVLFLEDDDLAHIYDGELHIHR.S | 3 |
| U | YNL308C | 2 | 2 | 9.1% | 591 | 68654 | 5.1 | KRI1 SGDID:S000005252, Chr XIV from 55896-54121, reverse complement, Verified ORF, "Essential nucleolar protein required for 40S ribosome biogenesis; physically and functionally interacts with Krr1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_7.06155.06155.3 | 3.1379 | 0.1946 | 98.3% | 2680.5842 | 2680.8567 | 17 | 4.411 | 29.3% | 1 | R.MNILSGDALKEDDEEYEHATVDGK.Q | 3 |
| * | Jamie_phos_01_itms_29.17622.17622.3 | 4.385 | 0.2907 | 100.0% | 3581.0942 | 3581.6978 | 3 | 6.245 | 28.4% | 1 | K.VISLDLNNNEEDDEEFEDAAEKFENAYNFR.Y | 3 |
| U | YPL237W | 1 | 1 | 9.1% | 285 | 31574 | 9.5 | SUI3 SGDID:S000006158, Chr XVI from 100496-101353, Verified ORF, "Beta subunit of the translation initiation factor eIF2, involved in the identification of the start codon; proposed to be involved in mRNA binding" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14853.14853.2 | 2.5803 | 0.1136 | 96.0% | 2688.2322 | 2689.8872 | 89 | 4.307 | 26.0% | 1 | K.SVSADAEAEKEPTDDIAEALGELSLK.K | 2 |
| U | YDR418W | 1 | 2 | 9.1% | 165 | 17823 | 9.4 | RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
| U | YEL054C | 1 | 2 | 9.1% | 165 | 17823 | 9.4 | RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_7.04450.04450.2 | 3.1704 | 0.2733 | 100.0% | 1299.1522 | 1298.4819 | 1 | 5.9 | 67.9% | 2 | R.AVGGEVGASAALAPK.I | 2 |
| U | YLR340W | 1 | 9 | 9.0% | 312 | 33717 | 4.8 | RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_37.22526.22526.3 | 6.3078 | 0.469 | 100.0% | 3186.7144 | 3185.5579 | 1 | 7.663 | 32.4% | 9 | K.DLLAVAIAASYHYPEIEDLVDRIENPEK.Y | 3 |
| U | Reverse_YOR100C | 1 | 1 | 8.9% | 327 | 34754 | 9.8 | CRC1 SGDID:S000005626, Chr XV from 514278-513295, reverse complement, Verified ORF, "Mitochondrial inner membrane carnitine transporter, required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_11.07174.07174.4 | 3.2806 | 0.0856 | 90.6% | 3173.2166 | 3169.5596 | 340 | 3.389 | 22.0% | 1 | K.FLSAIGGEKVITKAAQIFSGKS*ST*QLVVK.V | 4 |
| U | Reverse_YLR372W | 1 | 1 | 8.7% | 345 | 39465 | 9.3 | SUR4 SGDID:S000004364, Chr XII from 867353-868390, Verified ORF, "Elongase, involved in fatty acid and sphingolipid biosynthesis; synthesizes very long chain 20-26-carbon fatty acids from C18-CoA primers; involved in regulation of sphingolipid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_21.14910.14910.4 | 2.922 | 0.1466 | 94.2% | 3042.5366 | 3038.25 | 41 | 4.355 | 22.4% | 1 | R.SSVKTNS*TKVGTSSGSAVSGSVESEKKVTK.K | 4 |
| U | Reverse_YKL108W | 1 | 1 | 8.6% | 453 | 52272 | 9.0 | SLD2 SGDID:S000001591, Chr XI from 234070-235431, Verified ORF, "Protein required for DNA replication, phosphorylated in S phase by S-phase cyclin-dependent kinases (Cdks), phosphorylation is essential for DNA replication and for complex formation with Dpb11p; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_38.27135.27135.4 | 3.3456 | 0.097 | 92.7% | 4401.5767 | 4397.5835 | 132 | 2.895 | 16.2% | 1 | K.ATPKQESS*VVGSSAEPDHEFETDSIQST*SGLFEAVKRRK.L | 4 |
| U | YOR184W | 1 | 1 | 8.6% | 395 | 43416 | 6.5 | SER1 SGDID:S000005710, Chr XV from 679357-680544, Verified ORF, "3-phosphoserine aminotransferase, catalyzes the formation of phosphoserine from 3-phosphohydroxypyruvate, required for serine and glycine biosynthesis; regulated by the general control of amino acid biosynthesis mediated by Gcn4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_58.34998.34998.4 | 2.9526 | 0.1583 | 95.6% | 3731.2966 | 3735.226 | 126 | 3.447 | 18.7% | 1 | K.KSILKNIS*GASDETLHELGVPITPIAFDYPTVVK.N | 4 |
| U | YGL245W | 3 | 3 | 8.5% | 708 | 80843 | 7.5 | GUS1 SGDID:S000003214, Chr VII from 39023-41149, Verified ORF, "Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_32.19548.19548.3 | 4.5072 | 0.3365 | 100.0% | 3140.1843 | 3140.4248 | 1 | 5.491 | 27.9% | 1 | R.FDDTNPSKEKEEFQDSILEDLDLLGIK.G | 3 |
| * | Jamie_phos_01_itms_29.17576.17576.4 | 6.0291 | 0.445 | 100.0% | 3469.1765 | 3468.7527 | 1 | 8.071 | 31.0% | 1 | R.FDDTNPSKEKEEFQDSILEDLDLLGIKGDR.I | 4 |
| * | Jamie_phos_03_itms_14.12304.12304.3 | 4.0896 | 0.27 | 100.0% | 3525.8342 | 3526.7485 | 1 | 5.351 | 27.6% | 1 | K.DRLEEDESFEDFLTPQTEFHTDAIADLNVK.D | 3 |
| U | YKL046C | 1 | 1 | 8.5% | 449 | 49565 | 4.7 | DCW1 SGDID:S000001529, Chr XI from 352268-350919, reverse complement, Verified ORF, "Putative mannosidase, GPI-anchored membrane protein required for cell wall biosynthesis in bud formation;homologous to Dfg5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_31.27091.27091.4 | 3.2986 | 0.1065 | 93.3% | 4411.0566 | 4414.722 | 24 | 3.584 | 18.5% | 1 | R.WDADSCGGGLRWQIFVWNS*GYDYKNTVSNGALFHIAAR.L | 4 |
| U | YGR279C | 1 | 1 | 8.5% | 386 | 40173 | 4.8 | SCW4 SGDID:S000003511, Chr VII from 1049964-1048804, reverse complement, Verified ORF, "Cell wall protein with similarity to glucanases; scw4 scw10 double mutants exhibit defects in mating" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.17811.17811.3 | 2.8778 | 0.206 | 97.7% | 3534.8643 | 3535.8525 | 39 | 4.552 | 18.8% | 1 | R.GITYTPYESSGACKSASEVASDLAQLTDFPVIR.L | 3 |
| U | Reverse_YOR382W | 1 | 1 | 8.5% | 153 | 15302 | 8.4 | FIT2 SGDID:S000005909, Chr XV from 1059527-1059988, Verified ORF, "Mannoprotein that is incorporated into the cell wall via a glycosylphosphatidylinositol (GPI) anchor, involved in the retention of siderophore-iron in the cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_16.09848.09848.2 | 1.8514 | 0.1305 | 93.8% | 1574.4521 | 1573.5272 | 61 | 3.924 | 50.0% | 1 | K.T*YTADSNSVVVT*R.T | 2 |
| U | YNL061W | 2 | 9 | 8.4% | 618 | 69812 | 5.0 | NOP2 SGDID:S000005005, Chr XIV from 510541-512397, Verified ORF, "Probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; localized to the nucleolus; constituent of 66S pre-ribosomal particles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_13.08408.08408.4 | 5.8865 | 0.2942 | 100.0% | 2978.0566 | 2975.1873 | 1 | 5.116 | 33.3% | 8 | K.SRKEEEEVVEEDKDLPEVDLEELSK.A | 4 |
| * | Jamie_phos_02_itms_9.07718.07718.3 | 3.8655 | 0.2087 | 100.0% | 3202.1643 | 3202.409 | 45 | 4.437 | 23.1% | 1 | R.KEALEEGIIHSDFATFEDEEDDKYIEK.S | 3 |
| U | Reverse_YGR154C | 1 | 1 | 8.4% | 356 | 41301 | 8.8 | YGR154C SGDID:S000003386, Chr VII from 797873-796803, reverse complement, Uncharacterized ORF, "Omega-class glutathione transferase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_26.16042.16042.4 | 3.6365 | 0.1227 | 95.8% | 3496.9365 | 3492.9512 | 172 | 3.331 | 20.7% | 1 | K.QLNEFLT*KVETEYIKGNEALGVKYVGLNIK.P | 4 |
| U | YDR515W | 1 | 1 | 8.3% | 447 | 50943 | 9.3 | SLF1 SGDID:S000002923, Chr IV from 1473419-1474762, Verified ORF, "RNA binding protein that associates with polysomes; proposed to be involved in regulating mRNA translation; involved in the copper-dependent mineralization of copper sulfide complexes on cell surface in cells cultured in copper salts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_11.08565.08565.4 | 3.5913 | 0.1299 | 96.2% | 4063.4165 | 4059.52 | 3 | 3.449 | 19.0% | 1 | K.LAPIPTTSPWKSSSPDSNTVIPVEELRDISKT*AKPSK.N | 4 |
| U | YHR068W | 1 | 1 | 8.3% | 387 | 42892 | 5.8 | DYS1 SGDID:S000001110, Chr VIII from 232135-233298, Verified ORF, "Deoxyhypusine synthase, catalyzes formation of deoxyhypusine, the first step in hypusine biosynthesis; triggers posttranslational hypusination of translation elongation factor eIF-5A and regulates its intracellular levels; tetrameric" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_10.08157.08157.3 | 2.8243 | 0.1429 | 93.5% | 3378.9543 | 3378.5059 | 8 | 4.394 | 21.0% | 1 | R.NGADYAVYINTGQEYDGSDAGARPDEAVSWGK.I | 3 |
| U | YFR034C | 1 | 3 | 8.3% | 312 | 34089 | 7.8 | PHO4 SGDID:S000001930, Chr VI from 225946-225008, reverse complement, Verified ORF, "Basic helix-loop-helix (bHLH) transcription factor; binds cooperatively with Pho2p to the PHO5 promoter; function is regulated by phosphorylation at multiple sites and by phosphate availability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04486.04486.3 | 3.9557 | 0.351 | 100.0% | 2615.8442 | 2616.7178 | 1 | 6.939 | 32.0% | 3 | K.TSSSAEGVVVASES*PVIAPHGSSHSR.S | 3 |
| U | YNL282W | 1 | 1 | 8.2% | 195 | 22612 | 9.6 | POP3 SGDID:S000005226, Chr XIV from 107687-108274, Verified ORF, "Subunit of both RNase MRP, which cleaves pre-rRNA, and nuclear RNase P, which cleaves tRNA precursors to generate mature 5' ends" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_22.15342.15342.2 | 1.7704 | 0.1318 | 92.3% | 1789.3522 | 1792.1265 | 97 | 3.214 | 36.7% | 1 | R.PTSVKLLKTT*VPIVSK.K | 2 |
| U | YDL013W | 2 | 2 | 8.1% | 619 | 71071 | 6.7 | HEX3 SGDID:S000002171, Chr IV from 429064-430923, Verified ORF, "Ring finger protein involved in the DNA damage response with possible recombination role; genetically identified by synthetic lethality with SGS1 (DNA helicase) and TOP3 (DNA topoisomerase); sporulation role; interacts with Slx8p and Lin1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.22022.22022.3 | 2.7062 | 0.1368 | 91.7% | 3308.0044 | 3308.3853 | 5 | 4.079 | 26.0% | 1 | R.DALNRFVRSDSRSRNSQRTHITAS*S*ER.P | 3 |
| * | Jamie_phos_01_itms_59.35880.35880.3 | 3.2637 | 0.1163 | 94.3% | 3040.9443 | 3044.2947 | 74 | 3.448 | 26.1% | 1 | K.Y*KFHCPYQTLARPSMLDRDLS*KR.T | 3 |
| U | YLR314C | 1 | 1 | 8.1% | 520 | 60039 | 5.5 | CDC3 SGDID:S000004306, Chr XII from 764137-762575, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_25.15212.15212.4 | 4.0017 | 0.2117 | 100.0% | 4895.0166 | 4895.943 | 15 | 5.194 | 16.3% | 1 | K.TLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQR.H | 4 |
| U | YPR165W | 1 | 1 | 8.1% | 209 | 23152 | 6.2 | RHO1 SGDID:S000006369, Chr XVI from 875364-875993, Verified ORF, "GTP-binding protein of the rho subfamily of Ras-like proteins, involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_7.07921.07921.2 | 2.8105 | 0.3055 | 100.0% | 2037.7122 | 2038.1809 | 1 | 5.666 | 53.1% | 1 | R.RVELALWDTAGQEDYDR.L | 2 |
| U | Reverse_YDR036C | 1 | 1 | 8.0% | 500 | 56288 | 8.3 | EHD3 SGDID:S000002443, Chr IV from 524709-523207, reverse complement, Verified ORF, "Protein of unconfirmed function, plays an indirect role in endocytic membrane trafficking, member of a family of enoyl-CoA hydratase/isomerases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_54.32630.32630.4 | 3.693 | 0.2052 | 99.8% | 4598.4966 | 4598.021 | 334 | 4.547 | 16.7% | 1 | K.IEQAFAKGEASGEYQRLNNMIDEIT*GNKSLNFCAEIVNLK.E | 4 |
| U | YHR203C | 1 | 4 | 8.0% | 261 | 29410 | 10.1 | RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| U | YJR145C | 1 | 4 | 8.0% | 261 | 29410 | 10.1 | RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_11.08799.08799.3 | 5.1941 | 0.3863 | 100.0% | 2387.4844 | 2387.614 | 1 | 7.182 | 41.2% | 4 | R.HDGGFDLVHIKDSLDNTFVTR.L | 3 |
| U | YBR242W | 1 | 1 | 8.0% | 238 | 27577 | 6.9 | YBR242W SGDID:S000000446, Chr II from 704665-705381, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_39.23633.23633.2 | 2.0862 | 0.2017 | 99.1% | 2285.9922 | 2286.3403 | 19 | 4.221 | 33.3% | 1 | K.KSCSGS*VEAGKT*RLTTEWK.P | 2 |
| U | Reverse_YML092C | 1 | 1 | 8.0% | 250 | 27162 | 5.7 | PRE8 SGDID:S000004557, Chr XIII from 86739-85987, reverse complement, Verified ORF, "20S proteasome beta-type subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_32.27876.27876.2 | 1.9752 | 0.1289 | 94.7% | 2162.4922 | 2164.3918 | 14 | 4.21 | 31.6% | 1 | R.YDPGMGSYVAGIDPT*LLSVK.S | 2 |
| U | YOL109W | 1 | 1 | 8.0% | 113 | 12589 | 5.4 | ZEO1 SGDID:S000005469, Chr XV from 110296-110637, Verified ORF, "Peripheral membrane protein of the plasma membrane that interacts with Mid2p; regulates the cell integrity pathway mediated by Pkc1p and Slt2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_12.09606.09606.2 | 1.3449 | 0.1705 | 93.2% | 888.8522 | 890.9689 | 75 | 4.344 | 56.2% | 1 | K.QASAAVSEK.K | 2 |
| U | YDR181C | 1 | 1 | 7.9% | 481 | 55410 | 9.5 | SAS4 SGDID:S000002589, Chr IV from 827350-825905, reverse complement, Verified ORF, "Subunit of the SAS complex (Sas2p, Sas4p, Sas5p), which acetylates free histones and nucleosomes and regulates transcriptional silencing; required for the HAT activity of Sas2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_36.28472.28472.4 | 2.8246 | 0.1546 | 94.4% | 4088.6165 | 4087.4314 | 381 | 3.775 | 16.2% | 1 | K.SKEMNALRNNAASISPTLSEKAPLGSISSCT*ASQISQR.S | 4 |
| U | Reverse_YMR239C | 1 | 1 | 7.9% | 471 | 54071 | 8.6 | RNT1 SGDID:S000004852, Chr XIII from 749676-748261, reverse complement, Verified ORF, "RNAase III; cleaves a stem-loop structure at the 3' end of U2 snRNA to ensure formation of the correct U2 3' end" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_36.22271.22271.4 | 3.8617 | 0.0947 | 95.4% | 4404.5767 | 4409.0234 | 313 | 2.995 | 17.6% | 1 | -.ST*DSFKRKKNKQSPDKLVSESRPIAARQKAYFDLMKK.D | 4 |
| U | YER098W | 2 | 2 | 7.8% | 754 | 86244 | 7.4 | UBP9 SGDID:S000000900, Chr V from 355462-357726, Verified ORF, "Ubiquitin-specific protease that cleaves ubiquitin-protein fusions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_30.20262.20262.4 | 4.3644 | 0.2381 | 100.0% | 4373.6167 | 4374.726 | 116 | 4.517 | 17.1% | 1 | R.KATSLKKTKGSGDPSIAKSPSAKSSTS*S*IPSNLASHERRSK.F | 4 |
| * | Jamie_phos_04_itms_36.28548.28548.2 | 1.8173 | 0.144 | 95.2% | 2267.2922 | 2267.4106 | 11 | 3.441 | 35.3% | 1 | R.NEKFGWLLYDDETVES*IK.E | 2 |
| U | Reverse_YML107C | 1 | 1 | 7.8% | 334 | 39207 | 9.0 | PML39 SGDID:S000004575, Chr XIII from 56269-55265, reverse complement, Verified ORF, "Protein required for nuclear retention of unspliced pre-mRNAs along with Mlp1p and Pml1p; anchored to the nuclear pore complex via Mlp1p and Mlp2p; associated with the subset of nuclear pores farthest from the nucleolus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_53.32211.32211.3 | 2.7725 | 0.1252 | 90.7% | 3365.7544 | 3366.8513 | 61 | 3.852 | 24.0% | 1 | K.KKYRWKTILREGLT*NRYKGPLLKT*NK.D | 3 |
| U | YHL033C | 1 | 1 | 7.8% | 256 | 28125 | 10.0 | RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" |
| U | YLL045C | 1 | 1 | 7.8% | 256 | 28112 | 10.0 | RPL8B SGDID:S000003968, Chr XII from 48628-47858, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_7.06505.06505.2 | 2.8839 | 0.344 | 100.0% | 2016.3722 | 2017.2438 | 4 | 5.822 | 44.7% | 1 | K.TSAVAALTEVRAEDEAALAK.L | 2 |
| U | Reverse_YDR183W | 1 | 1 | 7.8% | 230 | 26623 | 5.2 | PLP1 SGDID:S000002591, Chr IV from 829580-830272, Verified ORF, "Protein with a possible role in folding of beta-tubulin; has similarity to phosducins, which are GTPase inhibitors" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_8.05128.05128.2 | 1.8804 | 0.1253 | 92.4% | 2147.4722 | 2146.105 | 123 | 3.653 | 32.4% | 1 | -.IDLDSDS*ESRDHNTSAFR.E | 2 |
| U | YBR197C | 1 | 1 | 7.8% | 217 | 24203 | 9.1 | YBR197C SGDID:S000000401, Chr II from 615851-615198, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; YBR197C is not an essential gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18438.18438.2 | 1.927 | 0.1687 | 96.9% | 1878.7722 | 1877.0616 | 122 | 3.854 | 34.4% | 1 | K.NLTTPPALNPLT*TSISR.G | 2 |
| U | YDR055W | 1 | 1 | 7.7% | 444 | 45777 | 9.2 | PST1 SGDID:S000002462, Chr IV from 563524-564858, Verified ORF, "Cell wall protein that contains a putative GPI-attachment site; secreted by regenerating protoplasts; up-regulated by activation of the cell integrity pathway, as mediated by Rlm1p; upregulated by cell wall damage via disruption of FKS1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_27.22866.22866.4 | 2.4837 | 0.1594 | 91.9% | 3332.0964 | 3333.4583 | 304 | 3.548 | 19.2% | 1 | K.AEEKKFTSGDIKAAASASSVSS*SGASSSSSKSSK.G | 4 |
| U | YDL137W | 1 | 2 | 7.7% | 181 | 20658 | 7.4 | ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_7.08049.08049.2 | 3.1055 | 0.3212 | 100.0% | 1579.6721 | 1579.7068 | 1 | 6.941 | 57.7% | 2 | R.NTEGVIFVIDSNDR.S | 2 |
| U | Reverse_YBR006W | 1 | 1 | 7.6% | 497 | 54189 | 6.6 | UGA2 SGDID:S000000210, Chr II from 247012-248505, Verified ORF, "Succinate semialdehyde dehydrogenase involved in the utilization of gamma-aminobutyrate (GABA) as a nitrogen source; part of the 4-aminobutyrate and glutamate degradation pathways; localized to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_39.27445.27445.4 | 2.9498 | 0.1179 | 91.9% | 4523.0566 | 4526.024 | 44 | 3.305 | 18.5% | 1 | R.ITFVRNHPNLPQITAGYLRPAEEAY*WEFYSAAYKIEGK.A | 4 |
| U | YBR003W | 1 | 1 | 7.6% | 473 | 52560 | 8.8 | COQ1 SGDID:S000000207, Chr II from 242811-244232, Verified ORF, "Hexaprenyl pyrophosphate synthetase, catalyzes the first step in ubiquinone (coenzyme Q) biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_14.12253.12253.4 | 3.3487 | 0.0772 | 90.1% | 3943.8965 | 3938.575 | 87 | 3.376 | 17.6% | 1 | K.SSFAVALNAASKLVTPKILWNNPIS*LVSKEMNTLAK.N | 4 |
| U | YMR309C | 2 | 3 | 7.5% | 812 | 93204 | 5.0 | NIP1 SGDID:S000004926, Chr XIII from 895425-892987, reverse complement, Verified ORF, "Subunit of the eukaryotic translation initiation factor 3 (eIF3), involved in the assembly of preinitiation complex and start codon selection" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_5.04675.04675.3 | 3.1567 | 0.2812 | 100.0% | 2583.0244 | 2582.8765 | 14 | 5.98 | 28.3% | 1 | K.VVAQVEDAVNNTQQADLKNKAVAR.A | 3 |
| * | Jamie_phos_01_itms_31.19184.19184.4 | 4.7938 | 0.2459 | 100.0% | 4269.9365 | 4270.647 | 1 | 4.708 | 22.2% | 2 | K.LLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKR.I | 4 |
| U | YML106W | 1 | 1 | 7.5% | 226 | 24664 | 6.0 | URA5 SGDID:S000004574, Chr XIII from 56773-57453, Verified ORF, "One of two orotate phosphoribosyltransferase isozymes (see also URA10) that catalyze the fifth enzymatic step in de novo biosynthesis of pyrimidines, converting orotate into orotidine-5'-phosphate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04469.04469.3 | 3.2112 | 0.2586 | 100.0% | 1752.8043 | 1752.9248 | 1 | 5.532 | 40.6% | 1 | K.DHGEGGIIVGSALENKR.I | 3 |
| U | YDR002W | 1 | 1 | 7.5% | 201 | 22953 | 6.1 | YRB1 SGDID:S000002409, Chr IV from 453042-453647, Verified ORF, "Ran GTpase binding protein; involved in nuclear protein import and RNA export, ubiquitin-mediated protein degradation during the cell cycle; shuttles between the nucleus and cytoplasm; is essential; homolog of human RanBP1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_42.25432.25432.2 | 2.2833 | 0.0922 | 92.3% | 1854.1122 | 1856.9384 | 1 | 2.949 | 50.0% | 1 | K.KAEKPETKKDEEDT*K.E | 2 |
| U | Reverse_YNL330C | 1 | 1 | 7.4% | 433 | 48904 | 5.5 | RPD3 SGDID:S000005274, Chr XIV from 19302-18001, reverse complement, Verified ORF, "Histone deacetylase; regulates transcription and silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17358.17358.4 | 3.3756 | 0.0764 | 90.1% | 3847.3364 | 3842.1565 | 126 | 3.567 | 19.9% | 1 | R.IRHPKMPHGAGYAYNGVDADY*FY*AVRRKDSPK.V | 4 |
| U | YKR048C | 1 | 1 | 7.4% | 417 | 47885 | 4.3 | NAP1 SGDID:S000001756, Chr XI from 526282-525029, reverse complement, Verified ORF, "Protein that interacts with mitotic cyclin Clb2p; required for the regulation of microtubule dynamics during mitosis; controls bud morphogenesis; involved in the transport of H2A and H2B histones to the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_22.13391.13391.3 | 3.524 | 0.2677 | 100.0% | 3561.2644 | 3562.731 | 7 | 5.126 | 22.5% | 1 | K.GQEIVESLNETELLVDEEEKAQNDSEEEQVK.G | 3 |
| U | YGL001C | 1 | 1 | 7.4% | 349 | 38706 | 6.7 | ERG26 SGDID:S000002969, Chr VII from 496506-495457, reverse complement, Verified ORF, "C-3 sterol dehydrogenase, catalyzes the second of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_35.21506.21506.3 | 3.5433 | 0.271 | 90.9% | 2873.6042 | 2872.253 | 12 | 5.033 | 23.0% | 1 | N.NLFDWTYAGNVADAHVLAAQKLLDPK.T | 3 |
| U | YLR195C | 1 | 1 | 7.3% | 455 | 52838 | 7.4 | NMT1 SGDID:S000004185, Chr XII from 543306-541939, reverse complement, Verified ORF, "N-myristoyl transferase, catalyzes the cotranslational, covalent attachment of myristic acid to the N-terminal glycine residue of several proteins involved in cellular growth and signal transduction" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_16.18292.18292.4 | 2.9746 | 0.1428 | 94.3% | 3941.6565 | 3940.398 | 31 | 3.475 | 19.3% | 1 | K.QVIFSYVVEQPDGKITDFFSFY*SLPFTILNNTK.Y | 4 |
| U | YLL063C | 1 | 1 | 7.2% | 474 | 52837 | 7.4 | AYT1 SGDID:S000003986, Chr XII from 16072-14648, reverse complement, Verified ORF, "Acetyltransferase; catalyzes trichothecene 3-O-acetylation, suggesting a possible role in trichothecene biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_18.19320.19320.4 | 3.3545 | 0.1369 | 95.9% | 3880.6165 | 3879.3403 | 310 | 3.633 | 18.2% | 1 | K.SNLGRAVDVRKRLGLPETYPGLLVNMT*FNTGS*LK.S | 4 |
| U | YCR107W | 1 | 1 | 7.2% | 363 | 40911 | 6.8 | AAD3 SGDID:S000000704, Chr III from 313886-314977, Verified ORF, "Putative aryl-alcohol dehydrogenase with similarity to P. chrysosporium aryl-alcohol dehydrogenase; mutational analysis has not yet revealed a physiological role" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_32.19689.19689.3 | 2.93 | 0.1732 | 96.0% | 2821.9443 | 2824.1174 | 9 | 3.446 | 25.0% | 1 | K.IS*EALAKIAEEHGTESVTAIAIAYVR.S | 3 |
| U | YER179W | 1 | 1 | 7.2% | 334 | 36613 | 5.9 | DMC1 SGDID:S000000981, Chr V from 548416-548547,548640-549512, Verified ORF, "Meiosis-specific protein required for repair of double-strand breaks and pairing between homologous chromosomes; homolog of Rad51p and the bacterial RecA protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_14.15191.15191.3 | 2.643 | 0.1377 | 90.9% | 2646.4443 | 2641.9587 | 12 | 3.575 | 27.2% | 1 | R.EMGGGEGKVAYIDTEGTFRPERIK.Q | 3 |
| U | YLR441C | 1 | 1 | 7.1% | 255 | 28743 | 10.0 | RPS1A SGDID:S000004433, Chr XII from 1018904-1018137, reverse complement, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein" |
| U | YML063W | 1 | 1 | 7.1% | 255 | 28812 | 10.0 | RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_04_itms_6.09424.09424.2 | 2.2106 | 0.1087 | 94.0% | 1847.0721 | 1848.0375 | 2 | 4.472 | 44.1% | 1 | K.FDVGALMALHGEGSGEEK.G | 2 |
| U | YDR381W | 2 | 2 | 7.1% | 226 | 24956 | 11.3 | YRA1 SGDID:S000002789, Chr IV from 1236548-1236832,1237599-1237994, Verified ORF, "Nuclear protein that binds to RNA and to Mex67p, required for export of poly(A)+ mRNA from the nucleus; member of the REF (RNA and export factor binding proteins) family; another family member, Yra2p, can substitute for Yra1p function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14363.14363.2 | 3.1884 | 0.264 | 100.0% | 1832.9922 | 1834.0046 | 1 | 5.909 | 57.1% | 1 | K.SLEDLDKEMADYFEK.K | 2 |
| * | Jamie_phos_01_itms_20.12494.12494.3 | 3.0268 | 0.2379 | 100.0% | 1963.3444 | 1962.1787 | 1 | 4.484 | 41.7% | 1 | K.SLEDLDKEMADYFEKK.- | 3 |
| U | YML028W | 1 | 4 | 7.1% | 196 | 21590 | 5.1 | TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_9.09756.09756.2 | 4.3215 | 0.4316 | 100.0% | 1563.2722 | 1563.7478 | 1 | 7.598 | 76.9% | 4 | R.DYGVLIEEEGVALR.G | 2 |
| U | YKR002W | 1 | 1 | 7.0% | 568 | 64552 | 7.9 | PAP1 SGDID:S000001710, Chr XI from 442875-444581, Verified ORF, "Poly(A) polymerase, one of three factors required for mRNA 3'-end polyadenylation, forms multiprotein complex with polyadenylation factor I (PF I), also required for mRNA nuclear export; may also polyadenylate rRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_25.17034.17034.4 | 3.4114 | 0.1506 | 97.4% | 4374.7363 | 4371.8003 | 194 | 3.394 | 17.9% | 1 | K.KNMS*DGMARDAGGKIFTY*GSYRLGVHGPGSDIDTLVVVPK.H | 4 |
| U | YNL301C | 1 | 3 | 7.0% | 186 | 20563 | 11.7 | RPL18B SGDID:S000005245, Chr XIV from 64562-64451,64018-63570, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Ap and has similarity to rat L18 ribosomal protein" |
| U | YOL120C | 1 | 3 | 7.0% | 186 | 20563 | 11.7 | RPL18A SGDID:S000005480, Chr XV from 94401-94290,93842-93394, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Bp and has similarity to rat L18 ribosomal protein; intron of RPL18A pre-mRNA forms stem-loop structures that are a target for Rnt1p cleavage leading to degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_5.05252.05252.2 | 3.8837 | 0.3615 | 100.0% | 1332.3722 | 1332.4967 | 1 | 7.085 | 79.2% | 3 | K.TVVVVGTVTDDAR.I | 2 |
| U | YLR045C | 2 | 2 | 6.9% | 888 | 100918 | 8.6 | STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_47.28791.28791.4 | 3.14 | 0.1014 | 91.5% | 3781.8164 | 3782.1309 | 32 | 3.648 | 20.3% | 1 | K.TLPNFSIASGST*HSTIET*NKQTGPMENKFLLKK.S | 4 |
| * | Jamie_phos_05_itms_7.12530.12530.3 | 2.9198 | 0.1391 | 93.7% | 3056.9343 | 3056.1365 | 1 | 3.874 | 29.6% | 1 | K.NGTGVSSVSDDLDIDFNDSFASEESYKR.A | 3 |
| U | Reverse_YKL188C | 2 | 2 | 6.9% | 853 | 97126 | 8.9 | PXA2 SGDID:S000001671, Chr XI from 88791-86230, reverse complement, Verified ORF, "Subunit of a heterodimeric peroxisomal ATP-binding cassette transporter complex (Pxa1p-Pxa2p), required for import of long-chain fatty acids into peroxisomes; similarity to human adrenoleukodystrophy transporter and ALD-related proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_17.10515.10515.4 | 3.0422 | 0.1157 | 92.2% | 2656.0566 | 2658.8447 | 444 | 3.506 | 23.9% | 1 | R.KS*TEQGTPSTIRQGKNANFLANSK.S | 4 |
| * | Jamie_phos_01_itms_45.27222.27222.4 | 3.6988 | 0.2799 | 92.0% | 4061.1765 | 4060.1963 | 55 | 5.179 | 17.6% | 1 | G.DESDT*SHKSVITLEEKSSEDEERDVATEKGEEIKK.N | 4 |
| U | YGR041W | 1 | 1 | 6.9% | 547 | 60751 | 6.7 | BUD9 SGDID:S000003273, Chr VII from 577491-579134, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a unipolar budding pattern instead of the wild-type bipolar pattern, and bud at the distal pole" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_41.28495.28495.4 | 3.7865 | 0.2852 | 100.0% | 3862.4565 | 3866.8909 | 268 | 4.991 | 18.9% | 1 | R.NSSNGSSAETNLNGHSSSGTIS*TSVLLNMGSAEKHAGT*.T | 4 |
| U | Reverse_YLL002W | 1 | 1 | 6.9% | 436 | 50096 | 9.4 | RTT109 SGDID:S000003925, Chr XII from 146290-147600, Verified ORF, "Protein with a role in regulation of Ty1 transposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_38.27009.27009.4 | 3.285 | 0.1923 | 98.2% | 3543.5764 | 3548.9304 | 179 | 4.255 | 21.3% | 1 | K.PDDPFLPINYVALS*NEKSTFIDGVQWLPYK.M | 4 |
| U | YDL027C | 1 | 1 | 6.9% | 420 | 48312 | 9.9 | YDL027C SGDID:S000002185, Chr IV from 404954-403692, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_15.09159.09159.4 | 3.5813 | 0.0884 | 93.7% | 3291.4565 | 3294.595 | 26 | 3.456 | 22.0% | 1 | K.ILQES*ETSNSS*KTLNTIIAIKSVNTLLSK.H | 4 |
| U | Reverse_YER028C | 1 | 1 | 6.9% | 394 | 43119 | 9.9 | MIG3 SGDID:S000000830, Chr V from 211875-210691, reverse complement, Verified ORF, "Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_21.15150.15150.4 | 3.5257 | 0.0914 | 93.5% | 3333.6165 | 3332.4602 | 14 | 3.683 | 22.4% | 1 | R.KLEDSRS*FSKPCGQVTCKHPKEGT*HTR.G | 4 |
| U | Reverse_YPL272C | 1 | 1 | 6.8% | 517 | 59389 | 6.0 | YPL272C SGDID:S000006193, Chr XVI from 28164-26611, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_27.16430.16430.4 | 3.2008 | 0.1062 | 92.3% | 3979.8965 | 3981.2358 | 210 | 3.64 | 17.6% | 1 | R.KLT*TAILPLTLRSDDKSSNTGLTVEDSHWDADNER.S | 4 |
| U | YBL100W-A | 1 | 1 | 6.8% | 438 | 49898 | 7.5 | YBL100W-A SGDID:S000002148, Chr II from 29932-31248, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YOR343W-A | 1 | 1 | 6.8% | 438 | 49868 | 7.5 | YOR343W-A SGDID:S000007355, Chr XV from 970573-971889, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YOR192C-A | 1 | 1 | 6.8% | 438 | 49736 | 7.9 | YOR192C-A SGDID:S000007353, Chr XV from 709732-708416, reverse complement, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YLR410W-A | 1 | 1 | 6.8% | 438 | 49772 | 7.7 | YLR410W-A SGDID:S000007379, Chr XII from 941480-942796, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YGR161W-A | 1 | 1 | 6.8% | 438 | 49762 | 7.2 | YGR161W-A SGDID:S000007369, Chr VII from 811743-813059, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YFL002W-B | 1 | 1 | 6.8% | 438 | 49762 | 7.2 | YFL002W-B SGDID:S000007404, Chr VI from 138199-139515, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YDR261W-A | 1 | 1 | 6.8% | 438 | 49724 | 7.7 | YDR261W-A SGDID:S000007396, Chr IV from 981456-982772, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YDR034C-C | 1 | 1 | 6.8% | 438 | 49689 | 7.7 | YDR034C-C SGDID:S000007344, Chr IV from 519352-518036, reverse complement, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | YCL020W | 1 | 1 | 6.8% | 438 | 49841 | 7.5 | YCL020W SGDID:S000000525, Chr III from 85101-86417, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_6.05788.05788.3 | 3.5378 | 0.3115 | 100.0% | 3485.8442 | 3485.573 | 2 | 5.089 | 24.1% | 1 | R.VNNDHINESTVSSQYLS*DDNELSLRPATER.I | 3 |
| U | YBR177C | 1 | 1 | 6.7% | 451 | 51255 | 7.8 | EHT1 SGDID:S000000381, Chr II from 586157-584802, reverse complement, Verified ORF, "Possible serine hydrolase, may be involved in lipid metabolism, null mutant slightly temperature sensitive at 37C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_27.23056.23056.4 | 2.6346 | 0.184 | 95.7% | 3532.6965 | 3533.8442 | 132 | 4.045 | 18.4% | 1 | K.WPAINPFHWGY*NGTVSHIVGENGS*IKLHLK.D | 4 |
| U | YGR285C | 1 | 1 | 6.7% | 433 | 49020 | 8.3 | ZUO1 SGDID:S000003517, Chr VII from 1063159-1061858, reverse complement, Verified ORF, "Cytosolic ribosome-associated chaperone, contains a DnaJ domain; together with Ssz1p, acts as a chaperone for nascent polypeptide chains" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.17540.17540.3 | 3.1621 | 0.1876 | 97.7% | 3288.8044 | 3289.4443 | 63 | 4.199 | 21.4% | 1 | K.TVDESNVDPDELLFDTELADEDLLTHDAR.D | 3 |
| U | YDR171W | 2 | 3 | 6.7% | 375 | 42817 | 5.1 | HSP42 SGDID:S000002578, Chr IV from 806616-807743, Verified ORF, "Small cytosolic stress-induced chaperone that forms barrel-shaped oligomers and suppresses the aggregation of non-native proteins; oligomer dissociation is not required for function; involved in cytoskeleton reorganization after heat shock" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_16.09749.09749.3 | 4.0547 | 0.2795 | 100.0% | 2955.1143 | 2956.1895 | 1 | 6.248 | 32.3% | 2 | K.KRIAIEEIPDEELEFEENPNPTVEN.- | 3 |
| * | Jamie_phos_01_itms_24.14871.14871.2 | 3.7041 | 0.3406 | 100.0% | 2671.632 | 2671.828 | 1 | 6.906 | 47.7% | 1 | R.IAIEEIPDEELEFEENPNPTVEN.- | 2 |
| U | Reverse_YJR144W | 1 | 1 | 6.7% | 269 | 30090 | 9.3 | MGM101 SGDID:S000003905, Chr X from 700797-701606, Verified ORF, "Protein involved in mitochondrial genome maintenance; component of the mitochondrial nucleoid, required for the repair of oxidative mtDNA damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_21.14635.14635.2 | 1.5292 | 0.1911 | 96.0% | 1880.1721 | 1881.9083 | 2 | 3.268 | 35.3% | 1 | R.VAGAT*ATNSTGTSVVT*RK.Q | 2 |
| U | YGL123W | 1 | 2 | 6.7% | 254 | 27450 | 10.4 | RPS2 SGDID:S000003091, Chr VII from 277623-278387, Verified ORF, "Protein component of the small (40S) subunit, essential for control of translational accuracy; has similarity to E. coli S5 and rat S2 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07566.07566.2 | 2.7323 | 0.1358 | 98.1% | 1837.0122 | 1836.052 | 1 | 4.685 | 53.1% | 2 | K.LLQLAGVEDVYTQSNGK.T | 2 |
| U | YLR429W | 1 | 1 | 6.5% | 651 | 72553 | 5.9 | CRN1 SGDID:S000004421, Chr XII from 990773-992728, Verified ORF, "Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_60.36387.36387.4 | 3.2833 | 0.1315 | 95.4% | 4399.2563 | 4402.7275 | 449 | 3.567 | 15.4% | 1 | K.SPEQEKSATPPSSIT*AAKT*AITASSKEEPSAARTSPKSLGLK.K | 4 |
| U | YPL097W | 1 | 1 | 6.5% | 492 | 55287 | 9.1 | MSY1 SGDID:S000006018, Chr XVI from 364949-366427, Verified ORF, "Mitochondrial tyrosyl-tRNA synthetase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_50.30135.30135.3 | 3.0326 | 0.1614 | 95.9% | 3822.1143 | 3824.3262 | 1 | 4.13 | 23.4% | 1 | K.IFT*FLNSSEIKKIVETHIKSPSLRYGQT*LLAK.E | 3 |
| U | Reverse_YNL166C | 1 | 1 | 6.5% | 448 | 49694 | 4.9 | BNI5 SGDID:S000005110, Chr XIV from 323567-322221, reverse complement, Verified ORF, "Protein involved in organization of septins at the mother-bud neck, may interact directly with the Cdc11p septin, localizes to bud neck in a septin-dependent manner" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_35.27846.27846.3 | 2.9809 | 0.1336 | 93.6% | 3277.0444 | 3279.4736 | 38 | 3.974 | 20.5% | 1 | K.NAS*S*FKDLVLEADLKNEGGLTNNQPMPSK.F | 3 |
| U | YHR169W | 1 | 1 | 6.5% | 431 | 47879 | 9.6 | DBP8 SGDID:S000001212, Chr VIII from 442182-443477, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box family involved in biogenesis of the 40S ribosomal subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_14.15369.15369.4 | 2.6878 | 0.158 | 93.7% | 3063.6565 | 3068.4553 | 3 | 3.746 | 24.7% | 1 | K.PHFIIAT*PGRLAHHIMSSGDDTVGGLMR.A | 4 |
| U | YPR162C | 1 | 1 | 6.4% | 529 | 60706 | 6.8 | ORC4 SGDID:S000006366, Chr XVI from 868300-866711, reverse complement, Verified ORF, "Subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_25.19379.19379.4 | 3.269 | 0.1045 | 92.9% | 4089.5764 | 4085.3105 | 237 | 4.026 | 17.2% | 1 | R.T*IDNEKCKDSDPGFGSLQRRLLQQLYGT*LPTDEK.I | 4 |
| U | YDR233C | 1 | 1 | 6.4% | 295 | 32916 | 9.0 | RTN1 SGDID:S000002641, Chr IV from 930351-929464, reverse complement, Verified ORF, "Protein of unknown function; has similarity to mammalian reticulon proteins; member of the RTNLA (reticulon-like A) subfamily" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_11.15098.15098.2 | 1.6919 | 0.1193 | 90.2% | 1964.2922 | 1966.9677 | 3 | 3.645 | 38.9% | 1 | K.S*KTAPVS*STAGPQTASTSK.L | 2 |
| U | Reverse_YHR078W | 1 | 1 | 6.3% | 552 | 63331 | 7.4 | YHR078W SGDID:S000001120, Chr VIII from 256362-258020, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_37.26154.26154.4 | 2.9674 | 0.1284 | 92.9% | 4139.8965 | 4141.4844 | 13 | 3.752 | 19.6% | 1 | R.LS*QLVKHSPLSYETYFKNIFNGMSSVDENS*GVEMK.S | 4 |
| U | YML085C | 2 | 3 | 6.3% | 447 | 49800 | 5.1 | TUB1 SGDID:S000004550, Chr XIII from 99400-99376,99259-97941, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules" |
| U | YML124C | 2 | 3 | 6.3% | 445 | 49694 | 5.2 | TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_14.12679.12679.3 | 2.9731 | 0.1328 | 93.7% | 3243.6243 | 3243.531 | 1 | 3.621 | 24.1% | 1 | R.AFVHWYVGEGMEEGEFTEAREDLAALER.D | 3 | |
| Jamie_phos_04_itms_12.13702.13702.4 | 5.0481 | 0.3007 | 100.0% | 3243.8564 | 3243.531 | 1 | 6.002 | 28.4% | 2 | R.AFVHWYVGEGMEEGEFTEAREDLAALER.D | 4 |
| U | YDR083W | 1 | 1 | 6.3% | 383 | 44729 | 9.2 | RRP8 SGDID:S000002490, Chr IV from 612069-613220, Verified ORF, "Protein involved in rRNA processing; involved in pre-rRNA cleavage at site A2; mutation is synthetically lethal with a gar1 mutation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_6.05666.05666.3 | 4.0219 | 0.3707 | 100.0% | 2659.5244 | 2659.9043 | 1 | 6.698 | 35.9% | 1 | K.LKEETEAELKEQVEDIPSEGSVAK.D | 3 |
| U | Reverse_YLR413W | 1 | 1 | 6.2% | 675 | 72698 | 5.1 | YLR413W SGDID:S000004405, Chr XII from 951152-953179, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_13.11704.11704.4 | 3.6959 | 0.0803 | 93.4% | 4666.2964 | 4671.1045 | 5 | 3.805 | 17.5% | 1 | K.LSSFLS*SVTSTPITSNMITELADCTAT*INKSSAFLEFVPSLK.T | 4 |
| U | Reverse_YMR120C | 1 | 1 | 6.2% | 592 | 65263 | 6.6 | ADE17 SGDID:S000004727, Chr XIII from 509279-507501, reverse complement, Verified ORF, "Enzyme of 'de novo' purine biosynthesis containing both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities, isozyme of Ade16p; ade16 ade17 mutants require adenine and histidine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_43.26082.26082.4 | 3.9504 | 0.0482 | 91.6% | 4119.3364 | 4115.7173 | 240 | 3.155 | 17.6% | 1 | K.IAITAVTLDIIAQETLNKNQSVIEKFTSQNIIADNRK.Q | 4 |
| U | YDR312W | 1 | 1 | 6.2% | 453 | 51856 | 9.0 | SSF2 SGDID:S000002720, Chr IV from 1087576-1088937, Verified ORF, "Protein required for ribosomal large subunit maturation, functionally redundant with Ssf1p; member of the Brix family" |
| U | YHR066W | 1 | 1 | 6.2% | 453 | 51764 | 9.3 | SSF1 SGDID:S000001108, Chr VIII from 229337-230698, Verified ORF, "Constituent of 66S pre-ribosomal particles, required for ribosomal large subunit maturation; functionally redundant with Ssf2p; member of the Brix family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_50.30176.30176.3 | 2.8847 | 0.147 | 94.2% | 3248.0645 | 3243.816 | 38 | 3.803 | 23.1% | 1 | R.KSNKLKDFVVMCGPLGVTHLFMFTQSEK.T | 3 |
| U | Reverse_YIL006W | 1 | 1 | 6.2% | 373 | 41954 | 8.6 | YIA6 SGDID:S000001268, Chr IX from 344059-345180, Verified ORF, "Mitochondrial NAD+ transporter, involved in the transport of NAD+ into the mitochondria (see also YEA6); member of the mitochondrial carrier subfamily; disputed role as a pyruvate transporter; has putative mouse and human orthologs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_37.24235.24235.3 | 2.5198 | 0.1653 | 93.2% | 2677.1343 | 2679.0356 | 19 | 4.334 | 23.9% | 1 | R.LIEHPYTVASAIMKS*VS*SAMILR.Q | 3 |
| U | YDR130C | 1 | 1 | 6.2% | 291 | 33186 | 9.8 | FIN1 SGDID:S000002537, Chr IV from 716617-715742, reverse complement, Verified ORF, "Spindle pole body-related intermediate filament protein, forms cell cycle-specific filaments between spindle pole bodies in mother and daughter cells, able to self-assemble, expression induced during S/G2, localization cell-cycle dependent" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_49.31658.31658.2 | 1.8709 | 0.1082 | 90.5% | 2132.872 | 2131.1807 | 62 | 3.619 | 32.4% | 1 | R.SLRDIGNT*IGRNNIPS*DK.D | 2 |
| U | YDR385W | 3 | 10 | 6.1% | 842 | 93289 | 6.3 | EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| U | YOR133W | 3 | 10 | 6.1% | 842 | 93289 | 6.3 | EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_7.06601.06601.2 | 4.4207 | 0.391 | 100.0% | 2146.7322 | 2146.371 | 1 | 7.41 | 61.1% | 7 | K.STAISLYSEMSDEDVKEIK.Q | 2 | |
| Jamie_phos_02_itms_5.04974.04974.2 | 2.3506 | 0.1969 | 99.5% | 1686.1122 | 1686.9432 | 1 | 4.766 | 42.9% | 2 | K.LEIVLKGDEKDLEGK.A | 2 | |
| Jamie_phos_01_itms_15.09130.09130.3 | 3.7587 | 0.1995 | 100.0% | 2111.9944 | 2110.3484 | 2 | 4.544 | 42.2% | 1 | R.HGMKEEVPGWQEYYDKL.- | 3 |
| U | Reverse_YMR136W | 1 | 1 | 6.1% | 560 | 63139 | 8.7 | GAT2 SGDID:S000004744, Chr XIII from 541198-542880, Verified ORF, "Protein containing GATA family zinc finger motifs; similar to Gln3p and Dal80p; expression repressed by leucine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_3.02807.02807.4 | 4.0986 | 0.106 | 96.9% | 3924.0166 | 3923.529 | 363 | 4.648 | 16.7% | 1 | R.LLLNSSKSGFKKTVKRYFLGCANCLTRTGYPGKR.W | 4 |
| U | YAL012W | 2 | 9 | 6.1% | 394 | 42542 | 6.5 | CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_12.11385.11385.2 | 4.0412 | 0.3952 | 100.0% | 1775.9722 | 1775.9476 | 1 | 7.012 | 63.3% | 8 | R.ISVGIEDTDDLLEDIK.Q | 2 |
| * | Jamie_phos_01_itms_35.21318.21318.3 | 3.5282 | 0.0973 | 94.2% | 2633.3643 | 2630.9092 | 57 | 4.147 | 26.1% | 1 | R.ISVGIEDTDDLLEDIKQALKQATN.- | 3 |
| U | YML070W | 1 | 1 | 6.0% | 584 | 62207 | 5.4 | DAK1 SGDID:S000004535, Chr XIII from 133475-135229, Verified ORF, "Dihydroxyacetone kinase, required for detoxification of dihydroxyacetone (DHA); involved in stress adaptation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_49.29820.29820.4 | 3.8661 | 0.2536 | 90.3% | 3896.4565 | 3891.4197 | 318 | 4.924 | 18.6% | 1 | Q.ILNAIRLVNENASGVLLIVKNYTGDVLHFGLS*AER.A | 4 |
| U | Reverse_YBR297W | 1 | 1 | 6.0% | 468 | 54194 | 7.5 | MAL33 SGDID:S000000501, Chr II from 800517-801923, Verified ORF, "MAL-activator protein, part of complex locus MAL3; nonfunctional in genomic reference strain S288C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07614.07614.4 | 3.2505 | 0.1332 | 95.3% | 3245.7366 | 3244.2954 | 25 | 3.381 | 23.5% | 1 | K.LSDET*CSGS*TSETALADFFCKGPVTFVR.I | 4 |
| U | YLR457C | 1 | 1 | 6.0% | 319 | 37354 | 10.2 | NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_11.06987.06987.3 | 2.8351 | 0.1572 | 95.7% | 2381.1543 | 2381.562 | 134 | 4.187 | 31.9% | 1 | R.ENDEIKPLKIDLS*PS*PIRR.T | 3 |
| U | Reverse_YLR004C | 1 | 1 | 5.9% | 523 | 58531 | 8.3 | YLR004C SGDID:S000003994, Chr XII from 159504-157933, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_23.18187.18187.4 | 2.617 | 0.1364 | 90.4% | 3415.4966 | 3417.4739 | 17 | 3.466 | 21.1% | 1 | R.LAVDADDVNIS*STSVSCSDANAAKKEVDMS*R.Q | 4 |
| U | YMR100W | 1 | 1 | 5.8% | 620 | 72251 | 6.9 | MUB1 SGDID:S000004706, Chr XIII from 466299-468161, Verified ORF, "Protein of unknown function, deletion causes multi-budding phenotype; has similarity to Aspergillus nidulans samB gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_36.25473.25473.4 | 3.1408 | 0.1232 | 93.7% | 4351.5767 | 4345.958 | 84 | 3.899 | 17.6% | 1 | R.GTEQIRKKVVMSGVLS*VLVTVLDNYLLYHKNY*DFIK.D | 4 |
| U | YLL024C | 1 | 1 | 5.8% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.17997.17997.4 | 5.9606 | 0.1067 | 100.0% | 4228.3765 | 4225.668 | 1 | 5.667 | 23.1% | 1 | K.KAEETIAWLDSNTTATKEEFDDQLKELQEVANPIMSK.L | 4 |
| U | Reverse_YJR065C | 1 | 1 | 5.8% | 449 | 49542 | 5.8 | ARP3 SGDID:S000003826, Chr X from 559072-557723, reverse complement, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_25.18838.18838.3 | 2.8597 | 0.228 | 98.4% | 2960.5745 | 2958.172 | 98 | 4.721 | 24.0% | 1 | R.QKRHS*IVS*VDVGTSKTGSLLESQAIR.N | 3 |
| U | Reverse_YPR005C | 1 | 1 | 5.8% | 294 | 32994 | 8.8 | HAL1 SGDID:S000006209, Chr XVI from 566668-565784, reverse complement, Verified ORF, "Cytoplasmic protein involved in halotolerance; decreases intracellular Na+ (via Ena1p) and increases intracellular K+ by decreasing efflux; expression repressed by Ssn6p-Tup1p and Sko1p and induced by NaCl, KCl, and sorbitol through Gcn4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.21109.21109.2 | 1.6433 | 0.1452 | 92.2% | 1918.5122 | 1916.2255 | 2 | 3.838 | 40.6% | 1 | R.EIPS*LGSKPIPTKVIQK.H | 2 |
| U | Reverse_YIL031W | 2 | 2 | 5.7% | 1034 | 116882 | 6.8 | ULP2 SGDID:S000001293, Chr IX from 292632-295736, Verified ORF, "Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins, plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_11.09018.09018.3 | 2.8828 | 0.1365 | 93.1% | 3003.2344 | 3003.2886 | 169 | 4.047 | 22.9% | 1 | K.S*PY*IRKPKPSPMMIDHTSSLAQDNK.I | 3 |
| * | Jamie_phos_03_itms_30.22198.22198.4 | 2.9248 | 0.1479 | 94.6% | 3875.0964 | 3877.2847 | 26 | 3.632 | 20.7% | 1 | R.KPPLSAS*S*RPSSARSSNLTDLPKLSNFKRKRASM.- | 4 |
| U | YLR276C | 2 | 3 | 5.7% | 594 | 68060 | 9.2 | DBP9 SGDID:S000004266, Chr XII from 696832-695048, reverse complement, Verified ORF, "ATP-dependent RNA helicase of the DEAD-box family involved in biogenesis of the 60S ribosomal subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_10.10366.10366.3 | 3.7936 | 0.0622 | 91.9% | 4056.2644 | 4056.2068 | 2 | 4.756 | 20.5% | 2 | K.NVYQLLIATDDTEYIKEEDDEIEEGHNTENQEEK.S | 3 |
| * | Jamie_phos_04_itms_8.11538.11538.4 | 3.3367 | 0.2328 | 100.0% | 4057.4565 | 4056.2068 | 28 | 4.438 | 19.7% | 1 | K.NVYQLLIATDDTEYIKEEDDEIEEGHNTENQEEK.S | 4 |
| U | Reverse_YGL003C | 1 | 1 | 5.7% | 566 | 62822 | 8.6 | CDH1 SGDID:S000002971, Chr VII from 494178-492478, reverse complement, Verified ORF, "Cell-cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C), which directs ubiquitination of mitotic cyclins resulting in exit from mitosis; targets the APC/C to specific substrates including CDC20, ASE1 and CIN8" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_53.32060.32060.4 | 3.0186 | 0.1094 | 91.1% | 3621.8564 | 3625.893 | 173 | 3.158 | 18.8% | 1 | R.RPTVPTSHPSFEELGAAEPPPTSVRELEY*GHR.T | 4 |
| U | Reverse_YDL038C | 1 | 1 | 5.7% | 583 | 58523 | 4.4 | YDL038C SGDID:S000002196, Chr IV from 384078-382327, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_20.20858.20858.4 | 2.9869 | 0.1281 | 93.0% | 3445.0166 | 3443.5742 | 5 | 3.646 | 19.8% | 1 | K.IISTASSRSSSASDVPTLT*VISSSSTAS*IGQQR.S | 4 |
| U | YPR041W | 1 | 1 | 5.7% | 405 | 45261 | 5.1 | TIF5 SGDID:S000006245, Chr XVI from 648701-649918, Verified ORF, "Translation initiation factor eIF-5; N-terminal domain functions as a GTPase-activating protein to mediate hydrolysis of ribosome-bound GTP; C-terminal domain is the core of ribosomal preinitiation complex formation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.15005.15005.3 | 3.4024 | 0.1901 | 98.7% | 2766.5044 | 2763.7554 | 2 | 3.861 | 27.3% | 1 | R.RAAKPFITWLETAES*DDDEEDDE.- | 3 |
| U | YER068W | 1 | 1 | 5.6% | 587 | 65354 | 8.1 | MOT2 SGDID:S000000870, Chr V from 293048-294811, Verified ORF, "Component of the CCR4-NOT transcription regulatory complex, which represses transcription, at least in part, by inhibiting functional TBP-DNA interactions and also aids in transcription elongation; interacts with C-terminal region of Not1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_8.06900.06900.3 | 3.5046 | 0.2834 | 100.0% | 3428.5745 | 3429.6135 | 1 | 5.468 | 23.4% | 1 | R.SGIHNNISTSTAGSNTNLLSENFTGTPS*PAAMR.A | 3 |
| U | YHR019C | 2 | 11 | 5.6% | 554 | 62207 | 5.8 | DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14288.14288.4 | 5.6167 | 0.4712 | 100.0% | 3579.2166 | 3579.7717 | 1 | 7.139 | 26.1% | 6 | K.DAITWLNEHDIKNEEGEDFKFGDDIAEAAER.K | 4 |
| * | Jamie_phos_03_itms_12.11031.11031.3 | 4.8653 | 0.3575 | 100.0% | 3580.7644 | 3579.7717 | 1 | 7.375 | 26.7% | 5 | K.DAITWLNEHDIKNEEGEDFKFGDDIAEAAER.K | 3 |
| U | Reverse_YOL094C | 1 | 1 | 5.6% | 323 | 36149 | 9.1 | RFC4 SGDID:S000005454, Chr XV from 142554-141583, reverse complement, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14750.14750.3 | 2.7357 | 0.1081 | 90.5% | 2159.0044 | 2156.3574 | 460 | 3.438 | 29.4% | 1 | R.DITEKNGVIDSLVQPRY*K.E | 3 |
| U | Reverse_YNR034W | 1 | 1 | 5.6% | 321 | 35653 | 7.6 | SOL1 SGDID:S000005317, Chr XIV from 690323-691288, Verified ORF, "Protein with a possible role in tRNA export; shows similarity to 6-phosphogluconolactonase non-catalytic domains but does not exhibit this enzymatic activity; homologous to Sol2p, Sol3p, and Sol4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_40.28395.28395.2 | 1.7834 | 0.1442 | 94.8% | 2002.9722 | 2001.9042 | 4 | 3.313 | 38.2% | 1 | K.SET*NGNGNLSTGSMQTS*R.S | 2 |
| U | YBL057C | 1 | 7 | 5.6% | 214 | 23128 | 5.4 | PTH2 SGDID:S000000153, Chr II from 113447-112803, reverse complement, Verified ORF, "One of two (see also PTH1) mitochondrially-localized peptidyl-tRNA hydrolases; dispensable for cell growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_6.05715.05715.2 | 3.1929 | 0.1909 | 100.0% | 1431.1322 | 1431.6042 | 3 | 4.905 | 59.1% | 7 | K.SSAT*LLRSKEMK.E | 2 |
| U | Reverse_YLR424W | 1 | 1 | 5.5% | 708 | 83049 | 5.3 | YLR424W SGDID:S000004416, Chr XII from 973391-975517, Uncharacterized ORF, "Essential protein present in native splicing complexes; identified as a suppressor of prp38-1, a spliceosomal maturation mutation; cold sensitive alleles accumulate pre-mRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_40.24449.24449.4 | 3.5931 | 0.126 | 96.0% | 4091.3765 | 4090.5493 | 2 | 2.918 | 19.7% | 1 | R.SQTEIPTT*IGSGDKGLGKGAVYGMSS*LLKAGIGYTKTLK.S | 4 |
| U | YER021W | 2 | 8 | 5.5% | 523 | 60393 | 5.6 | RPN3 SGDID:S000000823, Chr V from 196947-198518, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid, similar to the p58 subunit of the human 26S proteasome; temperature-sensitive alleles cause metaphase arrest, suggesting a role for the proteasome in cell cycle control" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_18.12780.12780.3 | 6.6644 | 0.4218 | 100.0% | 3469.0745 | 3468.6685 | 1 | 8.443 | 38.4% | 6 | K.INHEDGFIETTELLNIYDSEDPQQVFDER.I | 3 |
| * | Jamie_phos_03_itms_16.13455.13455.2 | 2.4092 | 0.2911 | 100.0% | 2312.412 | 2312.4517 | 2 | 5.241 | 38.9% | 2 | T.TELLNIYDSEDPQQVFDER.I | 2 |
| U | YGR059W | 1 | 1 | 5.5% | 512 | 59845 | 7.4 | SPR3 SGDID:S000003291, Chr VII from 607567-609105, Verified ORF, "Sporulation-specific homolog of the yeast CDC3/10/11/12 family of bud neck microfilament genes; septin protein involved in sporulation; regulated by ABFI" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_16.09921.09921.4 | 3.2767 | 0.0869 | 90.8% | 3293.0566 | 3288.577 | 386 | 3.044 | 22.2% | 1 | -.MKS*KGSRLST*DCPVEFPKIVSGFAEEVK.I | 4 |
| U | Reverse_YNL240C | 1 | 1 | 5.5% | 491 | 54151 | 7.6 | NAR1 SGDID:S000005184, Chr XIV from 199978-198503, reverse complement, Verified ORF, "Nuclear architecture related protein; component of the cytosolic iron-sulfur (FeS) protein assembly machinery, required for maturation of cytosolic and nuclear FeS proteins; homologous to human Narf" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14316.14316.4 | 3.5739 | 0.1031 | 94.9% | 3253.9365 | 3257.5977 | 180 | 3.519 | 20.5% | 1 | R.KRLAT*INRKRESGSGS*TLKRVLNQINR.F | 4 |
| U | YLR063W | 1 | 1 | 5.5% | 365 | 42041 | 7.9 | YLR063W SGDID:S000004053, Chr XII from 264158-265255, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_51.31187.31187.2 | 2.5268 | 0.3813 | 100.0% | 2324.3323 | 2321.5059 | 5 | 5.592 | 36.8% | 1 | E.LVALASIFTLS*RDFS*SKFAS.A | 2 |
| U | Reverse_YDR354W | 1 | 1 | 5.5% | 380 | 41374 | 6.7 | TRP4 SGDID:S000002762, Chr IV from 1184738-1185880, Verified ORF, "Anthranilate phosphoribosyl transferase of the tryptophan biosynthetic pathway, catalyzes the phosphoribosylation of anthranilate, subject to the general control system of amino acid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_38.23112.23112.2 | 1.7295 | 0.1416 | 93.1% | 2261.1921 | 2263.2747 | 343 | 3.576 | 27.5% | 1 | K.FMDCGLTGILDGAGS*NSTS*AK.G | 2 |
| U | YGL017W | 1 | 1 | 5.4% | 503 | 57931 | 6.3 | ATE1 SGDID:S000002985, Chr VII from 459859-461370, Verified ORF, "Arginyl-tRNA-protein transferase, catalyzes post-translational conjugation of arginine to the amino termini of acceptor proteins which are then subject to degradation via the N-end rule pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.21003.21003.4 | 3.1836 | 0.0955 | 90.9% | 3040.5366 | 3046.4038 | 23 | 3.583 | 24.4% | 1 | K.VTKELYLVDSETGRGEGFPTDNVVKYK.N | 4 |
| U | YNL071W | 1 | 1 | 5.4% | 482 | 51818 | 7.8 | LAT1 SGDID:S000005015, Chr XIV from 491524-492972, Verified ORF, "Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex, which catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.22009.22009.3 | 2.8619 | 0.1197 | 90.8% | 3053.1243 | 3053.5295 | 190 | 3.482 | 22.0% | 1 | K.LLKLRQSLNAT*ANDKYKLSINDLLVK.A | 3 |
| U | YNL178W | 1 | 2 | 5.4% | 240 | 26503 | 9.4 | RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_5.04852.04852.2 | 2.1958 | 0.1344 | 96.4% | 1440.0521 | 1438.5339 | 1 | 4.714 | 62.5% | 2 | R.ELAEEGYSGVEVR.V | 2 |
| U | YPL043W | 1 | 1 | 5.3% | 685 | 77825 | 9.1 | NOP4 SGDID:S000005964, Chr XVI from 469936-471993, Verified ORF, "Nucleolar protein, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; constituent of 66S pre-ribosomal particles; contains four RNA recognition motifs (RRMs)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_70.42419.42419.4 | 3.7641 | 0.1264 | 97.2% | 4058.5764 | 4061.59 | 170 | 3.344 | 17.6% | 1 | R.GFGFVS*FAVEDDTKEALAKARKTKFNGHILRVDIAK.R | 4 |
| U | YJR064W | 1 | 1 | 5.3% | 562 | 61914 | 5.5 | CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_54.32781.32781.3 | 4.0836 | 0.2282 | 100.0% | 3101.4844 | 3100.4473 | 4 | 5.151 | 22.4% | 1 | K.SQDDEIGDGTTGVVVLASALLDQALELIQK.G | 3 |
| U | YFR028C | 6 | 18 | 5.3% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_4.04600.04600.3 | 4.7572 | 0.5037 | 100.0% | 2989.3743 | 2991.04 | 1 | 7.336 | 30.0% | 2 | R.KVVIES*NNSDDESMQDTNGTSNHYPK.V | 3 |
| * | Jamie_phos_04_itms_3.04918.04918.3 | 5.2942 | 0.3308 | 100.0% | 2990.9343 | 2991.04 | 1 | 5.73 | 37.0% | 8 | R.KVVIESNNS*DDESMQDTNGTSNHYPK.V | 3 |
| * | Jamie_phos_02_itms_4.04436.04436.3 | 3.1681 | 0.1613 | 96.4% | 3334.0444 | 3333.4382 | 2 | 3.578 | 25.9% | 1 | R.KVVIES*NNSDDESMQDTNGTSNHYPKVSR.K | 3 |
| * | Jamie_phos_02_itms_4.04514.04514.3 | 4.1932 | 0.2947 | 100.0% | 2862.1743 | 2862.866 | 11 | 5.127 | 29.2% | 5 | K.VVIESNNS*DDESMQDTNGTSNHYPK.V | 3 |
| * | Jamie_phos_01_itms_7.04468.04468.3 | 3.6902 | 0.2525 | 100.0% | 3205.0144 | 3205.2642 | 13 | 4.61 | 25.0% | 1 | K.VVIESNNSDDES*MQDTNGTSNHYPKVSR.K | 3 |
| * | Jamie_phos_02_itms_4.04499.04499.3 | 3.3948 | 0.16 | 97.8% | 3205.5842 | 3205.2642 | 20 | 4.135 | 22.2% | 1 | K.VVIESNNS*DDESMQDTNGTSNHYPKVSR.K | 3 |
| U | Reverse_YPL181W | 1 | 1 | 5.3% | 506 | 57053 | 4.9 | CTI6 SGDID:S000006102, Chr XVI from 203420-204940, Verified ORF, "Protein that relieves transcriptional repression by binding to the Cyc8p-Tup1p corepressor and recruiting the SAGA complex to the repressed promoter; contains a PHD finger domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.16918.16918.3 | 3.1351 | 0.2112 | 98.5% | 3263.6042 | 3260.3008 | 56 | 4.079 | 22.1% | 1 | K.RDLLKKDSDGPDLSYQDT*SADDMS*NRR.R | 3 |
| U | Reverse_YGL129C | 1 | 1 | 5.3% | 488 | 55562 | 9.8 | RSM23 SGDID:S000003097, Chr VII from 269194-267728, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the small subunit, has similarity to mammalian apoptosis mediator proteins; null mutation prevents induction of apoptosis by overproduction of metacaspase Mca1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_14.12682.12682.3 | 2.6894 | 0.1374 | 91.4% | 2859.3245 | 2863.1106 | 132 | 3.665 | 24.0% | 1 | K.S*DVAYAHAQSLLVTKGVGPEGT*IIFK.K | 3 |
| U | YDR432W | 1 | 1 | 5.3% | 414 | 45407 | 5.5 | NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_36.21728.21728.2 | 4.1586 | 0.4649 | 100.0% | 2438.7722 | 2438.6501 | 1 | 8.174 | 54.8% | 1 | R.DFDGTGALEFPSEEILVEALER.L | 2 |
| U | YCR012W | 2 | 2 | 5.3% | 416 | 44738 | 7.6 | PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_8.06955.06955.2 | 1.9971 | 0.2401 | 100.0% | 1579.6322 | 1580.7319 | 1 | 5.204 | 50.0% | 1 | K.VLENTEIGDSIFDK.A | 2 |
| * | Jamie_phos_02_itms_10.08452.08452.3 | 3.0776 | 0.1119 | 92.9% | 2346.5044 | 2346.6396 | 11 | 3.557 | 28.6% | 1 | K.VLENTEIGDSIFDKAGAEIVPK.L | 3 |
| U | Reverse_YKL093W | 1 | 1 | 5.3% | 339 | 36935 | 6.4 | MBR1 SGDID:S000001576, Chr XI from 264433-265452, Verified ORF, "Protein involved in mitochondrial functions and stress response; overexpression suppresses growth defects of hap2, hap3, and hap4 mutants" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_15.15702.15702.2 | 2.0523 | 0.1816 | 98.2% | 1956.4321 | 1957.1194 | 48 | 4.508 | 32.4% | 1 | R.MTTNNSSSSTFYSTTKAK.R | 2 |
| U | YER036C | 2 | 2 | 5.2% | 610 | 68377 | 6.5 | YER036C SGDID:S000000838, Chr V from 225198-223366, reverse complement, Uncharacterized ORF, "ATPase of the ATP-binding cassette (ABC) family involved in ribosome biogenesis, has similarity to Gcn20p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14859.14859.2 | 3.1437 | 0.3091 | 100.0% | 2103.8323 | 2104.3184 | 4 | 6.507 | 44.1% | 1 | K.TILEDGPESELLEPLYER.M | 2 |
| * | Jamie_phos_01_itms_18.11127.11127.2 | 2.0642 | 0.1278 | 95.7% | 1834.4922 | 1834.9854 | 2 | 4.088 | 53.8% | 1 | R.DKYSNISQDFQFWR.G | 2 |
| U | YBL039C | 1 | 1 | 5.2% | 579 | 64710 | 6.0 | URA7 SGDID:S000000135, Chr II from 145731-143992, reverse complement, Verified ORF, "Major CTP synthase isozyme (see also URA8), catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_17.10419.10419.4 | 3.4846 | 0.0998 | 93.9% | 3482.7366 | 3483.076 | 30 | 3.438 | 21.8% | 1 | K.IALVGKYTNLKDSYLSVIKALEHSSMKCRR.K | 4 |
| U | YLR004C | 1 | 1 | 5.2% | 523 | 58531 | 8.3 | YLR004C SGDID:S000003994, Chr XII from 159504-157933, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_8.04980.04980.4 | 3.3559 | 0.1524 | 97.0% | 2829.5366 | 2828.0283 | 38 | 3.745 | 24.4% | 1 | K.AANADSCSVSTSSINVDDADVALRFLK.Q | 4 |
| U | YGL234W | 2 | 2 | 5.1% | 802 | 86068 | 5.3 | ADE5,7 SGDID:S000003203, Chr VII from 56482-58890, Verified ORF, "Bifunctional enzyme of the 'de novo' purine nucleotide biosynthetic pathway, contains aminoimidazole ribotide synthetase and glycinamide ribotide synthetase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_27.16782.16782.3 | 3.0824 | 0.1077 | 91.9% | 2420.1243 | 2420.6794 | 2 | 3.659 | 28.3% | 1 | K.ADGIAAGKGVIIPSS*IDESVQAIK.D | 3 |
| * | Jamie_phos_03_itms_34.24676.24676.2 | 1.9124 | 0.1654 | 96.9% | 2168.2322 | 2165.235 | 233 | 3.789 | 31.2% | 1 | K.DS*KT*NQLVPEVLEYNVR.F | 2 |
| U | YCL057W | 1 | 1 | 5.1% | 712 | 81934 | 5.8 | PRD1 SGDID:S000000562, Chr III from 24768-26906, Verified ORF, "Zinc metalloendopeptidase, found in the cytoplasm and intermembrane space of mitochondria; with Cym1p, involved in degradation of mitochondrial proteins and of presequence peptides cleaved from imported proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_35.21462.21462.4 | 4.0207 | 0.1517 | 98.5% | 4122.6167 | 4119.3447 | 142 | 3.309 | 17.1% | 1 | R.DGKYGHAANFGLSSSFMIDDT*TRSYPVT*ALVCNFSK.S | 4 |
| U | YGL026C | 1 | 1 | 5.1% | 707 | 76626 | 6.5 | TRP5 SGDID:S000002994, Chr VII from 448540-446417, reverse complement, Verified ORF, "Tryptophan synthase involved in tryptophan biosynthesis, regulated by the general control system of amino acid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_35.25041.25041.4 | 2.6451 | 0.169 | 94.3% | 3948.8564 | 3951.2188 | 250 | 3.519 | 17.1% | 1 | R.EHFQS*VGS*VADGVVIGSKIVTLCGDAPEGKRYDVAK.E | 4 |
| U | Reverse_YAL047C | 1 | 1 | 5.1% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_26.24109.24109.4 | 2.6745 | 0.2334 | 98.1% | 3610.2966 | 3613.658 | 6 | 3.335 | 22.0% | 1 | K.SSPSDRS*ELQSGAPSS*QALSLFEEKDQKSEAR.S | 4 |
| U | YNL094W | 1 | 1 | 5.1% | 587 | 66134 | 6.2 | APP1 SGDID:S000005038, Chr XIV from 447613-449376, Uncharacterized ORF, "Protein of unknown function, interacts with Rvs161p and Rvs167p; computational analysis of protein-protein interactions in large-scale studies suggests a possible role in actin filament organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_29.21291.21291.4 | 2.6317 | 0.1364 | 90.6% | 3639.0566 | 3634.9634 | 5 | 4.062 | 22.4% | 1 | R.T*RRRPPPPPIPSTQKPSLTEEQTES*IRMSR.R | 4 |
| U | YDR235W | 1 | 1 | 5.1% | 544 | 65145 | 8.0 | PRP42 SGDID:S000002643, Chr IV from 933498-935132, Verified ORF, "U1 snRNP protein involved in splicing, required for U1 snRNP biogenesis; contains multiple tetriatricopeptide repeats" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_61.36808.36808.3 | 2.9923 | 0.1691 | 96.2% | 3359.4844 | 3355.8774 | 10 | 3.715 | 24.1% | 1 | K.YS*KWLINS*KNDLLGAKNVLLMGLKFSLK.K | 3 |
| U | YCR066W | 1 | 1 | 5.1% | 487 | 55230 | 7.6 | RAD18 SGDID:S000000662, Chr III from 231495-232958, Verified ORF, "Protein involved in postreplication repair; binds single-stranded DNA and has single-stranded DNA dependent ATPase activity; forms heterodimer with Rad6p; contains RING-finger motif" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_9.05855.05855.4 | 2.9252 | 0.1162 | 90.9% | 2954.8564 | 2955.2603 | 80 | 3.886 | 23.6% | 1 | K.KPKISTTFPTESNPHNKS*SSRFKVR.T | 4 |
| U | YMR187C | 1 | 1 | 5.1% | 431 | 50288 | 8.9 | YMR187C SGDID:S000004799, Chr XIII from 635983-634688, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_10.06242.06242.3 | 2.6685 | 0.1757 | 95.6% | 2499.2043 | 2500.002 | 136 | 4.29 | 28.6% | 1 | K.WVYLSIVKTAGNKYYKGIGLPK.I | 3 |
| U | YML125C | 1 | 1 | 5.1% | 312 | 35287 | 5.5 | YML125C SGDID:S000004594, Chr XIII from 21700-20762, reverse complement, Uncharacterized ORF, "Essential protein required for maturation of Gas1p and Pho8p; GFP-fusion protein localizes to the endoplasmic reticulum; null mutants have a cell separation defect" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_28.23686.23686.2 | 1.6623 | 0.1355 | 91.7% | 1914.4321 | 1916.0923 | 2 | 3.62 | 40.0% | 1 | K.VS*LLYANETENDILLK.D | 2 |
| U | Reverse_YNL144C | 1 | 1 | 5.0% | 740 | 84202 | 6.5 | YNL144C SGDID:S000005088, Chr XIV from 355044-352822, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_36.21930.21930.4 | 4.4832 | 0.2362 | 96.0% | 3888.5366 | 3889.9102 | 88 | 4.323 | 19.9% | 1 | D.TQSSEGALSGS*DNPGNSDHSADS*VSPPLLSLSRSRSK.N | 4 |
| U | YDR014W | 1 | 1 | 4.9% | 647 | 74722 | 5.9 | RAD61 SGDID:S000002421, Chr IV from 474043-475986, Verified ORF, "Protein of unknown function; mutation confers radiation sensitivity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_30.20150.20150.4 | 3.0656 | 0.1008 | 90.7% | 3721.7366 | 3716.0864 | 59 | 3.537 | 21.5% | 1 | K.IITSSDT*S*MAFMKDEKLSAFNFLDGSKASKRK.R | 4 |
| U | Reverse_YLR103C | 1 | 1 | 4.9% | 650 | 74249 | 4.8 | CDC45 SGDID:S000004093, Chr XII from 345942-343990, reverse complement, Verified ORF, "DNA replication initiation factor; recruited to MCM pre-RC complexes at replication origins; promotes release of MCM from Mcm10p, recruits elongation machinery; mutants in human homolog may cause velocardiofacial and DiGeorge syndromes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14060.14060.4 | 3.3381 | 0.0775 | 90.1% | 3815.5764 | 3810.7625 | 306 | 2.738 | 18.3% | 1 | R.KRLNTLKQAS*NDEEEEGDTDDNNDNNIKVS*DK.D | 4 |
| U | YLR058C | 1 | 1 | 4.9% | 469 | 52219 | 7.4 | SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, involved in one-carbon metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_20.12543.12543.3 | 2.5396 | 0.1483 | 91.9% | 2637.7744 | 2638.9316 | 102 | 3.899 | 26.1% | 1 | K.LITSHLVDTDPEVDSIIKDEIER.Q | 3 |
| U | Reverse_YPL053C | 1 | 1 | 4.9% | 446 | 52128 | 5.5 | KTR6 SGDID:S000005974, Chr XVI from 458455-457115, reverse complement, Verified ORF, "Probable mannosylphosphate transferase involved in the synthesis of core oligosaccharides in protein glycosylation pathway; member of the KRE2/MNT1 mannosyltransferase family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_26.15916.15916.4 | 3.3287 | 0.1024 | 93.8% | 2707.4165 | 2712.004 | 249 | 3.256 | 27.8% | 1 | K.AIPQLS*KPLYPTVYQES*MQKTK.P | 4 |
| U | YDL014W | 1 | 1 | 4.9% | 327 | 34465 | 10.2 | NOP1 SGDID:S000002172, Chr IV from 427361-428344, Verified ORF, "Nucleolar protein, component of the small subunit processome complex, which is required for processing of pre-18S rRNA; has similarity to mammalian fibrillarin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_6.07256.07256.2 | 1.9074 | 0.248 | 100.0% | 1769.7722 | 1769.872 | 25 | 4.356 | 43.3% | 1 | K.ANCIDSTVDAETVFAR.E | 2 |
| U | Reverse_YGR083C | 1 | 1 | 4.8% | 651 | 70852 | 9.4 | GCD2 SGDID:S000003315, Chr VII from 646819-644864, reverse complement, Verified ORF, "Delta subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.21586.21586.4 | 3.0992 | 0.1059 | 91.8% | 3649.2566 | 3649.226 | 35 | 3.182 | 20.0% | 1 | R.GEFLPRSDVVIVKINKKLS*IANHLLLET*LVK.S | 4 |
| U | YCL040W | 1 | 1 | 4.8% | 500 | 55377 | 6.2 | GLK1 SGDID:S000000545, Chr III from 50838-52340, Verified ORF, "Glucokinase, catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18371.18371.3 | 2.9304 | 0.1087 | 90.7% | 2699.1543 | 2696.9275 | 99 | 3.375 | 25.0% | 1 | K.SKIPDDLLDDENVTSDDLFGFLAR.R | 3 |
| U | Reverse_YLR378C | 1 | 1 | 4.8% | 480 | 52937 | 9.4 | SEC61 SGDID:S000004370, Chr XII from 877177-875735, reverse complement, Verified ORF, "Essential subunit of Sec61 complex (Sec61p, Sbh1p, and Sss1p); forms a channel for SRP-dependent protein import and retrograde transport of misfolded proteins out of the ER; with Sec63 complex allows SRP-independent protein import into ER" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_70.42225.42225.3 | 2.8235 | 0.1436 | 93.7% | 2781.2043 | 2779.1003 | 43 | 3.657 | 25.0% | 1 | R.Y*ISTERKGNIVMGQDKFQKAIDR.P | 3 |
| U | Reverse_YBR087W | 1 | 1 | 4.8% | 354 | 39942 | 8.2 | RFC5 SGDID:S000000291, Chr II from 423759-424823, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_17.14189.14189.2 | 1.9755 | 0.2176 | 99.3% | 2061.2522 | 2063.3455 | 76 | 4.099 | 37.5% | 1 | K.LRY*VGPGFISELLAMCR.T | 2 |
| U | YOR017W | 1 | 1 | 4.6% | 800 | 93408 | 9.3 | PET127 SGDID:S000005543, Chr XV from 361411-363813, Verified ORF, "Protein with a role in mitochondrial RNA stability and/or processing, located in the mitochondrial membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_32.19754.19754.4 | 3.5576 | 0.1914 | 99.0% | 4473.1367 | 4468.845 | 350 | 3.854 | 17.1% | 1 | K.KRNGICSIDS*DRSLDREIVLSVLGHYLEDFLTEKS*LK.N | 4 |
| U | YKL054C | 1 | 1 | 4.6% | 738 | 83973 | 5.0 | DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_33.24204.24204.4 | 3.0223 | 0.1017 | 90.1% | 4003.3364 | 4003.1143 | 310 | 3.236 | 18.7% | 1 | K.EQQHSYVPQQHLPNPEDDITYKSSNNSNSFT*STK.H | 4 |
| U | YIL101C | 1 | 1 | 4.6% | 647 | 72687 | 9.3 | XBP1 SGDID:S000001363, Chr IX from 177247-175304, reverse complement, Verified ORF, "Transcriptional repressor that binds to promoter sequences of the cyclin genes, CYS3, and SMF2; expression is induced by stress or starvation during mitosis, and late in meiosis; member of the Swi4p/Mbp1p family; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_25.19417.19417.3 | 3.2041 | 0.1998 | 98.4% | 3607.1042 | 3608.6707 | 250 | 4.042 | 19.8% | 1 | K.QQNQRPAHNTNT*NMDT*SFSPRANNSLNNFK.F | 3 |
| U | Reverse_YGL023C | 1 | 1 | 4.6% | 635 | 70617 | 7.8 | PIB2 SGDID:S000002991, Chr VII from 452109-450202, reverse complement, Verified ORF, "Protein binding phosphatidylinositol 3-phosphate, involved in telomere-proximal repression of gene expression; similar to Fab1 and Vps27" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_19.11760.11760.4 | 3.2233 | 0.1584 | 96.4% | 3282.5366 | 3283.487 | 68 | 4.059 | 22.6% | 1 | R.SVDVVSNTPDLEPNSRQDDTFPLT*KGIEK.S | 4 |
| U | YKR019C | 1 | 1 | 4.6% | 615 | 68880 | 9.8 | IRS4 SGDID:S000001727, Chr XI from 477706-475859, reverse complement, Verified ORF, "Protein involved in regulation of phosphatidylinositol 4,5-bisphosphate concentrations; Irs4p and Tax4p bind and activate the phosphatase Inp51p; mutation confers an increase in rDNA silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_13.10204.10204.4 | 3.3109 | 0.0976 | 92.1% | 3212.0166 | 3211.3892 | 44 | 3.321 | 22.8% | 1 | K.TTLRKTSVST*NAENDHASSLHEGNLRYK.Y | 4 |
| U | Reverse_YJR032W | 1 | 1 | 4.6% | 393 | 45134 | 5.4 | CPR7 SGDID:S000003793, Chr X from 490995-492176, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds to Hsp82p and contributes to chaperone activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_15.15546.15546.2 | 1.9428 | 0.1351 | 95.1% | 1808.1322 | 1805.8591 | 22 | 4.327 | 35.3% | 1 | K.DAYISCGGKGVSSSSSDK.Q | 2 |
| U | Reverse_YIL160C | 1 | 1 | 4.6% | 417 | 44730 | 7.6 | POT1 SGDID:S000001422, Chr IX from 41444-40191, reverse complement, Verified ORF, "3-ketoacyl-CoA thiolase with broad chain length specificity, cleaves 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA during beta-oxidation of fatty acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_43.25977.25977.2 | 1.9227 | 0.1405 | 95.5% | 2261.2522 | 2262.3982 | 47 | 3.546 | 30.6% | 1 | R.DKIFAPRISS*LSEAT*VNPR.P | 2 |
| U | YDR318W | 1 | 1 | 4.6% | 368 | 42971 | 5.0 | MCM21 SGDID:S000002726, Chr IV from 1103753-1103804,1103888-1104942, Verified ORF, "Protein involved in minichromosome maintenance; component of the COMA complex that bridges kinetochore subunits that are in contact with centromeric DNA and the subunits bound to microtubules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_34.28730.28730.2 | 1.6593 | 0.1326 | 91.3% | 1896.2922 | 1896.1967 | 295 | 3.552 | 34.4% | 1 | R.AQADIPATPIPYEPKKR.A | 2 |
| U | YGR097W | 2 | 2 | 4.5% | 1146 | 126864 | 9.3 | ASK10 SGDID:S000003329, Chr VII from 678699-682139, Verified ORF, "Component of the RNA polymerase II holoenzyme, phosphorylated in response to oxidative stress; has a role in destruction of Ssn8p, which relieves repression of stress-response genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_6.05775.05775.2 | 2.7968 | 0.1666 | 99.5% | 2202.0923 | 2202.2097 | 1 | 5.004 | 42.5% | 1 | K.SSAYSS*SVSIADTYANANNAK.A | 2 |
| * | Jamie_phos_02_itms_9.07856.07856.3 | 3.2349 | 0.1114 | 93.5% | 3289.8843 | 3290.4448 | 11 | 3.683 | 23.3% | 1 | R.NSVNIGSHTPCLTDST*FTLQDGTTTSVNLK.G | 3 |
| U | Reverse_YNL197C | 1 | 1 | 4.5% | 661 | 71253 | 8.4 | WHI3 SGDID:S000005141, Chr XIV from 269594-267609, reverse complement, Verified ORF, "RNA binding protein that binds to and sequesters the G1 cyclin CLN3 mRNA; regulates cell fate and dose-dependently inhibits passage through Start by regulating the critical cell size requirement necessary for cell cycle progression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_27.23192.23192.4 | 3.1013 | 0.1695 | 96.5% | 3358.3765 | 3357.6711 | 111 | 3.772 | 20.1% | 1 | R.SNPGRVGLPNKSFSLRIGGKS*SVT*SRPLQR.G | 4 |
| U | YDR023W | 1 | 1 | 4.5% | 462 | 53310 | 6.1 | SES1 SGDID:S000002430, Chr IV from 489504-490892, Verified ORF, "Cytosolic seryl-tRNA synthetase, class II aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser), displays tRNA-dependent amino acid recognition which enhances discrimination of the serine substrate, interacts with peroxin Pex21p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_25.15710.15710.3 | 2.4822 | 0.2028 | 95.9% | 2459.7544 | 2459.6228 | 1 | 4.235 | 28.8% | 1 | K.TAQLSEFDEELYKVIDGEDEK.Y | 3 |
| U | Reverse_YLL008W | 1 | 1 | 4.4% | 752 | 84843 | 5.7 | DRS1 SGDID:S000003931, Chr XII from 131728-133986, Verified ORF, "Nucleolar DEAD-box protein required for ribosome assembly and function, including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_29.19561.19561.4 | 3.2416 | 0.1095 | 93.2% | 3866.3364 | 3869.5994 | 108 | 3.629 | 19.3% | 1 | R.VFEQT*LKTAAKKPPDIMIRVPKKLSLSVLS*KIK.S | 4 |
| U | Reverse_YOR027W | 1 | 1 | 4.4% | 589 | 66265 | 5.6 | STI1 SGDID:S000005553, Chr XV from 381052-382821, Verified ORF, "Hsp90 cochaperone, interacts with the Ssa group of the cytosolic Hsp70 chaperones; activates the ATPase activity of Ssa1p; homolog of mammalian Hop protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_33.23688.23688.3 | 2.631 | 0.2742 | 99.4% | 2834.2444 | 2837.9683 | 73 | 4.464 | 22.0% | 1 | K.SEEKQPAKSSNEKSTTSDSQPEADKK.Q | 3 |
| U | Reverse_YDL183C | 1 | 1 | 4.4% | 320 | 37047 | 9.6 | YDL183C SGDID:S000002342, Chr IV from 131834-130872, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_22.19658.19658.2 | 1.5022 | 0.1592 | 92.7% | 1787.1921 | 1788.9957 | 283 | 3.795 | 38.5% | 1 | K.VTYDKLTLRIEQT*K.D | 2 |
| U | Reverse_YJL185C | 1 | 1 | 4.4% | 293 | 33740 | 5.1 | YJL185C SGDID:S000003721, Chr X from 82974-82093, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_66.39854.39854.2 | 1.7342 | 0.1638 | 95.7% | 1416.0922 | 1416.4875 | 346 | 3.56 | 45.8% | 1 | R.LAPAPQES*PPSNK.N | 2 |
| U | YKR098C | 1 | 1 | 4.3% | 717 | 82703 | 8.4 | UBP11 SGDID:S000001806, Chr XI from 634817-632664, reverse complement, Verified ORF, "Ubiquitin-specific protease that cleaves ubiquitin from ubiquitinated proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_35.23451.23451.4 | 2.8908 | 0.138 | 93.6% | 3809.0166 | 3806.755 | 73 | 3.432 | 20.0% | 1 | K.LEDCINLFT*GDEELSGDNAWDCPNCRIT*DSK.S | 4 |
| U | Reverse_YJL105W | 1 | 1 | 4.3% | 560 | 63856 | 8.7 | SET4 SGDID:S000003641, Chr X from 224972-226654, Verified ORF, "Protein of unknown function, contains a SET domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04565.04565.4 | 3.5727 | 0.2044 | 99.6% | 2991.1765 | 2994.2468 | 283 | 4.251 | 25.4% | 1 | K.SANIIEWIPNRLDWQWEVS*IEEGK.R | 4 |
| U | Reverse_YCR053W | 1 | 1 | 4.3% | 514 | 57474 | 5.6 | THR4 SGDID:S000000649, Chr III from 216692-218236, Verified ORF, "Threonine synthase, conserved protein that catalyzes formation of threonine from 0-phosphohomoserine; expression is regulated by the GCN4-mediated general amino acid control pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14002.14002.3 | 2.8189 | 0.1312 | 92.7% | 2707.2844 | 2709.2424 | 10 | 3.788 | 28.6% | 1 | R.EIFKLKKKLTS*LKKLEEPLVDK.E | 3 |
| U | YDR190C | 1 | 1 | 4.3% | 463 | 50453 | 5.9 | RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_12.11194.11194.2 | 2.901 | 0.3145 | 100.0% | 2318.652 | 2318.4956 | 16 | 5.519 | 34.2% | 1 | R.SDAYATEFDLETEEYVPLPK.G | 2 |
| U | YGL148W | 2 | 3 | 4.3% | 376 | 40838 | 7.8 | ARO2 SGDID:S000003116, Chr VII from 226404-227534, Verified ORF, "Bifunctional chorismate synthase and flavin reductase, catalyzes the conversion of 5-enolpyruvylshikimate 3-phosphate (EPSP) to form chorismate, which is a precursor to aromatic amino acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04327.04327.3 | 3.3483 | 0.2195 | 100.0% | 1836.7743 | 1838.9689 | 5 | 4.479 | 41.7% | 1 | R.DEKDRVEIQSGTEFGK.T | 3 |
| * | Jamie_phos_02_itms_4.04562.04562.2 | 3.801 | 0.4092 | 100.0% | 1838.3922 | 1838.9689 | 1 | 8.268 | 70.0% | 2 | R.DEKDRVEIQSGTEFGK.T | 2 |
| U | YAL041W | 1 | 1 | 4.2% | 854 | 96939 | 8.5 | CDC24 SGDID:S000000039, Chr I from 62841-65405, Verified ORF, "Guanine nucleotide exchange factor (GEF or GDP-release factor) for Cdc42p; required for polarity establishment and maintenance, and mutants have morphological defects in bud formation and shmooing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_49.29976.29976.4 | 2.8782 | 0.1527 | 94.7% | 4034.1365 | 4038.4263 | 140 | 3.635 | 17.6% | 1 | K.SSSMMSPTTTMNTPNHHNSRQTHDSMASFSSSHMKR.V | 4 |
| U | YJR002W | 1 | 3 | 4.2% | 593 | 66953 | 4.7 | MPP10 SGDID:S000003762, Chr X from 438779-440560, Verified ORF, "Component of the SSU processome, which is required for pre-18S rRNA processing, interacts with and controls the stability of Imp3p and Imp4p, essential for viability; similar to human Mpp10p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_11.09106.09106.3 | 4.8396 | 0.4422 | 100.0% | 2906.6943 | 2906.04 | 1 | 7.266 | 31.2% | 3 | K.SLAEIYEDDYTRAEDESALSEELQK.A | 3 |
| U | Reverse_YKL127W | 1 | 1 | 4.2% | 570 | 63112 | 7.2 | PGM1 SGDID:S000001610, Chr XI from 203185-204897, Verified ORF, "Phosphoglucomutase, minor isoform; catalyzes the conversion from glucose-1-phosphate to glucose-6-phosphate, which is a key step in hexose metabolism" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_34.27134.27134.3 | 2.5974 | 0.2567 | 98.6% | 2637.7744 | 2634.9492 | 19 | 4.375 | 27.2% | 1 | K.EEYTRIIHSAAPT*SLLGGQGIVLK.R | 3 |
| U | YNL004W | 1 | 1 | 4.2% | 429 | 49142 | 6.6 | HRB1 SGDID:S000004949, Chr XIV from 623334-624623, Verified ORF, "Poly(A+) RNA-binding protein, involved in the export of mRNAs from the nucleus to the cytoplasm; similar to Gbp2p and Npl3p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_33.22250.22250.2 | 1.7846 | 0.1114 | 90.2% | 2094.9722 | 2093.998 | 328 | 3.511 | 26.5% | 1 | R.HNT*RDDSRRGGFGSS*GAR.G | 2 |
| U | YDR019C | 1 | 1 | 4.2% | 400 | 44469 | 8.8 | GCV1 SGDID:S000002426, Chr IV from 485361-484159, reverse complement, Verified ORF, "T subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_7.06354.06354.2 | 2.1524 | 0.2083 | 99.5% | 1787.7522 | 1787.8773 | 44 | 4.075 | 37.5% | 1 | R.GGYTGEDGFEISIANEK.A | 2 |
| U | YBR080C | 1 | 1 | 4.1% | 758 | 84056 | 8.0 | SEC18 SGDID:S000000284, Chr II from 400884-398608, reverse complement, Verified ORF, "ATPase required for the release of Sec17p during the 'priming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of the mammalian NSF" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_41.24917.24917.4 | 3.446 | 0.106 | 94.3% | 3223.3364 | 3220.564 | 24 | 3.747 | 22.8% | 1 | K.NFSGAEIEGLVKS*ASSFAINKTVNIGKGATK.L | 4 |
| U | Reverse_YHR113W | 1 | 1 | 4.1% | 490 | 54174 | 7.0 | YHR113W SGDID:S000001155, Chr VIII from 336340-337812, Uncharacterized ORF, "Putative metalloprotease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_13.14270.14270.2 | 1.8366 | 0.193 | 97.9% | 2520.4321 | 2517.63 | 242 | 4.01 | 23.7% | 1 | K.DFWSHWIAGGYT*EVGVQLY*K.E | 42 |
| U | YBR143C | 1 | 2 | 4.1% | 437 | 49006 | 5.0 | SUP45 SGDID:S000000347, Chr II from 532176-530863, reverse complement, Verified ORF, "Polypeptide release factor involved in translation termination; mutant form acts as a recessive omnipotent suppressor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_7.08115.08115.2 | 2.0304 | 0.1798 | 98.1% | 2024.7922 | 2025.2292 | 2 | 5.113 | 38.2% | 2 | K.NGLVLYCGDIITEDGKEK.K | 2 |
| U | Reverse_YLR303W | 1 | 1 | 4.1% | 444 | 48672 | 6.4 | MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_29.21459.21459.2 | 1.3178 | 0.1809 | 93.0% | 1849.6721 | 1849.0104 | 62 | 3.528 | 35.3% | 1 | K.GSDVIIGGIT*TGHGGIWK.T | 2 |
| U | YAL061W | 1 | 1 | 4.1% | 417 | 46099 | 6.1 | YAL061W SGDID:S000000057, Chr I from 33449-34702, Uncharacterized ORF, "putative polyol dehydrogenase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_28.19108.19108.2 | 1.7091 | 0.1425 | 93.2% | 1870.7322 | 1873.126 | 15 | 3.765 | 40.6% | 1 | K.NLKVGDKVVVEPTGTCR.D | 2 |
| U | Reverse_YPL112C | 1 | 1 | 4.1% | 394 | 44911 | 9.0 | PEX25 SGDID:S000006033, Chr XVI from 338619-337435, reverse complement, Verified ORF, "Peripheral peroxisomal membrane peroxin required for the regulation of peroxisome size and maintenance, recruits GTPase Rho1p to peroxisomes, induced by oleate, interacts with homologous protein Pex27p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_22.15613.15613.2 | 1.7938 | 0.1372 | 93.3% | 2041.9321 | 2044.1827 | 19 | 3.523 | 40.0% | 1 | K.T*Y*YTLVSPDLVTLNRK.S | 2 |
| U | Reverse_YJR080C | 1 | 1 | 4.1% | 394 | 44428 | 9.8 | YJR080C SGDID:S000003841, Chr X from 581530-580346, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_34.24550.24550.2 | 1.952 | 0.1834 | 97.6% | 1760.0322 | 1757.898 | 63 | 3.824 | 36.7% | 1 | K.SSNS*VLSRASPFIPSK.I | 2 |
| U | YOR063W | 1 | 1 | 4.1% | 387 | 43758 | 10.3 | RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_14.10495.10495.2 | 2.0067 | 0.144 | 95.7% | 1669.7322 | 1667.8595 | 152 | 4.649 | 36.7% | 1 | K.AHLAEIQLNGGSISEK.V | 2 |
| U | YNL186W | 1 | 1 | 4.0% | 792 | 88517 | 5.5 | UBP10 SGDID:S000005130, Chr XIV from 289500-291878, Verified ORF, "Ubiquitin-specific protease that deubiquitinates ubiquitin-protein moieties; may regulate silencing by acting on Sir4p; involved in posttranscriptionally regulating Gap1p and possibly other transporters; primarily located in the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_21.12927.12927.4 | 2.9429 | 0.1864 | 97.4% | 3460.4165 | 3462.8542 | 58 | 3.663 | 21.0% | 1 | K.KT*NTVPKSMAEALLLYTSKNDKDAADATGAKK.S | 4 |
| U | YHR007C | 1 | 2 | 4.0% | 530 | 60720 | 8.7 | ERG11 SGDID:S000001049, Chr VIII from 121678-120086, reverse complement, Verified ORF, "Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_6.10842.10842.2 | 1.9548 | 0.3514 | 100.0% | 2168.2122 | 2169.263 | 14 | 5.27 | 32.5% | 2 | K.DSASSYSVGEEVDYGFGAISK.G | 2 |
| U | Reverse_YLR120C | 1 | 1 | 4.0% | 569 | 60010 | 4.9 | YPS1 SGDID:S000004110, Chr XII from 388221-386512, reverse complement, Verified ORF, "Aspartic protease, attached to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_15.12903.12903.3 | 2.7475 | 0.1266 | 90.8% | 2616.5044 | 2617.0635 | 171 | 3.607 | 26.1% | 1 | -.IFAFLLSILTLPLS*PVIHDGVNR.K | 3 |
| U | YKL035W | 1 | 3 | 4.0% | 499 | 55988 | 7.4 | UGP1 SGDID:S000001518, Chr XI from 369534-371033, Verified ORF, "UDP-glucose pyrophosphorylase (UGPase), catalyses the reversible formation of UDP-Glc from glucose 1-phosphate and UTP, involved in a wide variety of metabolic pathways, expression modulated by Pho85p through Pho4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_5.04922.04922.2 | 3.206 | 0.3779 | 100.0% | 2282.372 | 2283.3477 | 1 | 6.536 | 47.4% | 3 | K.THS*TYAFESNTNSVAASQMR.N | 2 |
| U | YIL122W | 1 | 1 | 4.0% | 351 | 39498 | 8.9 | POG1 SGDID:S000001384, Chr IX from 130607-131662, Verified ORF, "Putative transcriptional activator that promotes recovery from pheromone induced arrest; inhibits both alpha-factor induced G1 arrest and repression of CLN1 and CLN2 via SCB/MCB promoter elements; potential Cdc28p substrate; SBF regulated" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_48.29490.29490.2 | 1.9851 | 0.1177 | 92.8% | 1645.4321 | 1644.7476 | 1 | 3.455 | 53.8% | 1 | K.INAS*ELASPRGHRR.Y | 2 |
| U | YMR287C | 1 | 1 | 3.9% | 969 | 110822 | 9.0 | MSU1 SGDID:S000004900, Chr XIII from 845344-842435, reverse complement, Verified ORF, "RNase, component of the mitochondrial degradosome along with the ATP-dependent RNA helicase Suv3p; the degradosome associates with the ribosome and mediates turnover of aberrant or unprocessed RNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_30.19978.19978.4 | 3.415 | 0.0788 | 90.8% | 4467.5366 | 4469.6475 | 1 | 2.739 | 18.5% | 1 | K.QQAKVELDHT*RELDNDQATETVVDRS*VGPEKDIESINK.D | 4 |
| U | YBR289W | 1 | 1 | 3.9% | 905 | 102556 | 8.3 | SNF5 SGDID:S000000493, Chr II from 779663-782380, Verified ORF, "One of 11 subunits of the SWI/SNF chromatin remodeling complex involved in transcriptional regulation; functions interdependently in transcriptional activation with Snf2p and Snf6p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_7.10574.10574.4 | 3.1767 | 0.2297 | 99.5% | 4005.4565 | 4005.319 | 178 | 3.76 | 18.6% | 1 | R.TFRTPVPS*T*LMPGGVDVGPSVESYELRNTTTYKSR.P | 4 |
| U | YHR020W | 1 | 1 | 3.9% | 688 | 77386 | 6.4 | YHR020W SGDID:S000001062, Chr VIII from 143989-146055, Uncharacterized ORF, "Protein required for cell viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_39.25836.25836.3 | 4.0006 | 0.3493 | 100.0% | 3052.9744 | 3053.476 | 1 | 6.534 | 26.0% | 1 | K.DAEEEVLQILDFYAGVYEELLAVPVVK.G | 3 |
| U | Reverse_YKL103C | 1 | 1 | 3.9% | 514 | 57093 | 5.8 | LAP4 SGDID:S000001586, Chr XI from 247326-245782, reverse complement, Verified ORF, "Vacuolar aminopeptidase, often used as a marker protein in studies of autophagy and cytosol to vacuole targeting (CVT) pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_36.28515.28515.2 | 2.0185 | 0.1089 | 92.1% | 2049.612 | 2050.4092 | 208 | 3.595 | 28.9% | 1 | K.LKVTLADVHSGIVGVGKEAR.W | 2 |
| U | Reverse_YPL048W | 1 | 1 | 3.9% | 415 | 47088 | 8.4 | CAM1 SGDID:S000005969, Chr XVI from 464398-465645, Verified ORF, "Translational cofactor elongation factor-1 gamma, participates in the regulation of GTP-binding protein EF-1 alpha, may play a redundant role in the regulation of protein synthesis or another GTP-dependent process" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_6.06937.06937.2 | 1.446 | 0.147 | 90.5% | 1866.4321 | 1867.8322 | 97 | 3.647 | 33.3% | 1 | K.S*S*TETETAAPKAEEKK.K | 2 |
| U | Reverse_YDR494W | 1 | 1 | 3.9% | 361 | 41216 | 10.0 | RSM28 SGDID:S000002902, Chr IV from 1436920-1438005, Verified ORF, "Mitochondrial ribosomal protein of the small subunit; genetic interactions suggest a possible role in promoting translation initiation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17157.17157.2 | 1.803 | 0.1417 | 95.0% | 1722.0122 | 1723.8096 | 236 | 3.615 | 38.5% | 1 | K.KEES*GMVVS*QLSLR.V | 2 |
| U | YBR031W | 1 | 1 | 3.9% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| U | YDR012W | 1 | 1 | 3.9% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_8.05092.05092.2 | 3.6227 | 0.4765 | 100.0% | 1507.8922 | 1507.6403 | 1 | 7.811 | 69.2% | 1 | K.LDQVWGSETVASSK.V | 2 |
| U | YGL049C | 1 | 3 | 3.8% | 914 | 103899 | 7.6 | TIF4632 SGDID:S000003017, Chr VII from 409607-406863, reverse complement, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4631p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_6.07389.07389.3 | 3.8771 | 0.352 | 100.0% | 3791.4543 | 3790.8489 | 1 | 5.573 | 23.5% | 3 | K.SVTFNEPENESSSQDVDELVKDDDTTEISDTTGGK.T | 3 |
| U | YPR112C | 1 | 1 | 3.8% | 887 | 101120 | 6.6 | MRD1 SGDID:S000006316, Chr XVI from 751917-749254, reverse complement, Verified ORF, "Essential conserved protein that associates with 35S precursor rRNA and is required for its initial processing at the A(0)-A(2) cleavage sites, shows partial nucleolar localization, contains five consensus RNA-binding domains" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_34.20595.20595.4 | 3.2188 | 0.0929 | 90.8% | 3869.0566 | 3873.2493 | 138 | 3.089 | 19.7% | 1 | K.RKAAAS*RQTFSWNS*LYMNQDAVLGSVAAKLGLEK.S | 4 |
| U | Reverse_YIL143C | 1 | 1 | 3.8% | 843 | 95341 | 6.1 | SSL2 SGDID:S000001405, Chr IX from 83041-80510, reverse complement, Verified ORF, "Component of the holoenzyme form of RNA polymerase transcription factor TFIIH, has DNA-dependent ATPase/helicase activity and is required, with Rad3p, for unwinding promoter DNA; involved in DNA repair; homolog of human ERCC3" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_21.19422.19422.4 | 2.823 | 0.134 | 92.0% | 3297.1365 | 3291.8555 | 10 | 3.398 | 21.0% | 1 | K.ITCAATIGVLTKGAGCPLVIIGSRARGNGFMK.S | 4 |
| U | YLL032C | 1 | 1 | 3.8% | 825 | 94597 | 7.2 | YLL032C SGDID:S000003955, Chr XII from 76746-74269, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_26.22406.22406.4 | 2.6947 | 0.1535 | 93.3% | 3471.4165 | 3467.5823 | 248 | 3.727 | 19.4% | 1 | K.KFVLGS*AS*SKSNTSNSNTNGNFRSMNNAKSR.T | 4 |
| U | Reverse_YDR264C | 1 | 1 | 3.8% | 764 | 85840 | 5.7 | AKR1 SGDID:S000002672, Chr IV from 998317-996023, reverse complement, Verified ORF, "Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_19.11843.11843.4 | 2.4667 | 0.2025 | 95.6% | 3227.3765 | 3226.3079 | 22 | 3.664 | 23.2% | 1 | R.TLLPDEEAEDNHNVQENGSEEENGSRIAK.L | 4 |
| U | Reverse_YFL047W | 1 | 1 | 3.8% | 714 | 82209 | 5.8 | RGD2 SGDID:S000001847, Chr VI from 40421-42565, Verified ORF, "GTPase-activating protein (RhoGAP) for Cdc42p and Rho5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_32.23221.23221.4 | 3.0498 | 0.1646 | 96.1% | 3359.4565 | 3356.4688 | 412 | 4.184 | 22.4% | 1 | R.CRTELDVGFNQFS*GPNY*YNNYVIAQPK.F | 4 |
| U | YDR158W | 1 | 1 | 3.8% | 365 | 39544 | 6.7 | HOM2 SGDID:S000002565, Chr IV from 770352-771449, Verified ORF, "Aspartic beta semi-aldehyde dehydrogenase, catalyzes the second step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_4.04577.04577.2 | 3.0958 | 0.3113 | 100.0% | 1544.1122 | 1544.6709 | 1 | 6.277 | 65.4% | 1 | R.VAVSDGHTECISLR.F | 2 |
| U | YDR166C | 1 | 1 | 3.7% | 971 | 112121 | 5.8 | SEC5 SGDID:S000002573, Chr IV from 789216-786301, reverse complement, Verified ORF, "Essential 107kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeting of secretory vesicles to active sites of exocytosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_24.22711.22711.4 | 3.4426 | 0.1218 | 95.6% | 4023.1765 | 4028.2 | 187 | 3.124 | 17.6% | 1 | K.GEEFITSVSQNLISFFT*SSQSSLPS*SLKDSTGDITR.S | 4 |
| U | YGR124W | 1 | 1 | 3.7% | 572 | 64593 | 5.9 | ASN2 SGDID:S000003356, Chr VII from 739949-741667, Verified ORF, "Asparagine synthetase, isozyme of Asn1p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14553.14553.3 | 2.8736 | 0.1347 | 93.8% | 2535.5942 | 2535.8125 | 2 | 3.719 | 32.5% | 1 | K.AFDTTDEPDVKPYLPEEILWR.Q | 3 |
| U | YHR048W | 1 | 1 | 3.7% | 514 | 57838 | 8.8 | YHR048W SGDID:S000001090, Chr VIII from 204600-206144, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.21154.21154.2 | 2.0483 | 0.157 | 96.9% | 2187.4722 | 2187.2842 | 4 | 3.752 | 33.3% | 1 | K.QSHEVTFNEDIADPEDIAR.H | 2 |
| U | Reverse_YFL016C | 1 | 1 | 3.7% | 511 | 55561 | 9.2 | MDJ1 SGDID:S000001878, Chr VI from 106230-104695, reverse complement, Verified ORF, "Protein involved in folding of mitochondrially synthesized proteins in the mitochondrial matrix; localizes to the mitochondrial inner membrane; member of the DnaJ family of molecular chaperones" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_33.20362.20362.2 | 2.35 | 0.0952 | 92.8% | 2113.2122 | 2115.3079 | 8 | 2.971 | 36.1% | 1 | R.VVDGDQLGHPLDVTIT*KAR.N | 2 |
| U | YOR117W | 1 | 1 | 3.7% | 434 | 48256 | 5.1 | RPT5 SGDID:S000005643, Chr XV from 545029-546333, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_27.16364.16364.2 | 2.6993 | 0.2517 | 100.0% | 1871.6322 | 1872.0386 | 84 | 4.902 | 36.7% | 1 | K.DSYLILDTLPSEFDSR.V | 2 |
| U | Reverse_YOR070C | 1 | 1 | 3.6% | 637 | 73289 | 7.2 | GYP1 SGDID:S000005596, Chr XV from 457821-455908, reverse complement, Verified ORF, "Cis-golgi GTPase-activating protein (GAP) for the Rab family members Ypt1p (in vivo) and for Ypt1p, Sec4p, Ypt7p, and Ypt51p (in vitro); involved in vesicle docking and fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_11.10823.10823.3 | 2.5731 | 0.136 | 90.2% | 2465.4243 | 2465.655 | 11 | 3.866 | 28.4% | 1 | R.VASTGMNSISNISSSTSKRSLT*R.T | 3 |
| U | Reverse_YCL051W | 1 | 1 | 3.6% | 583 | 64792 | 8.1 | LRE1 SGDID:S000000556, Chr III from 35865-37616, Verified ORF, "Protein involved in control of cell wall structure and stress response; inhibits Cbk1p protein kinase activity; overproduction confers resistance to cell-wall degrading enzymes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_53.32298.32298.3 | 2.6886 | 0.1607 | 95.0% | 2612.8442 | 2614.671 | 243 | 4.115 | 25.0% | 1 | R.NLQS*NGCKKPYGDKAY*RPNDK.L | 3 |
| U | Reverse_YDR310C | 1 | 1 | 3.5% | 1062 | 118201 | 6.2 | SUM1 SGDID:S000002718, Chr IV from 1084310-1081122, reverse complement, Verified ORF, "Transcriptional repressor required for repression of middle sporulation-specific genes during mitosis; regulated by the pachytene checkpoint; a dominant mutation acts as a suppressor of silencing defects of SIR2 mutations" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_60.36648.36648.4 | 3.3703 | 0.1164 | 94.8% | 4185.0967 | 4185.6006 | 322 | 3.129 | 18.1% | 1 | R.STRVPAPQSVPNSPSSPIQHFKSS*PLLS*NIPIENKIR.N | 4 |
| U | YLL003W | 2 | 3 | 3.5% | 946 | 112978 | 9.8 | SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_31.18788.18788.2 | 3.0205 | 0.3288 | 100.0% | 2037.5122 | 2037.1443 | 1 | 5.573 | 53.3% | 2 | R.YDLNDIS*VEVIEDLYR.Q | 2 |
| * | Jamie_phos_02_itms_7.06411.06411.2 | 1.6567 | 0.1264 | 90.5% | 1992.3922 | 1993.1779 | 15 | 3.46 | 37.5% | 1 | K.NIENEDKLGALYELENK.F | 2 |
| U | Reverse_YMR288W | 1 | 1 | 3.5% | 971 | 110028 | 7.3 | HSH155 SGDID:S000004901, Chr XIII from 845570-848485, Verified ORF, "U2-snRNP associated splicing factor that forms extensive associations with the branch site-3' splice site-3' exon region upon prespliceosome formation; similarity to the mammalian U2 snRNP-associated splicing factor SAP155" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_16.18300.18300.4 | 2.7819 | 0.1255 | 90.8% | 3867.6965 | 3868.2737 | 88 | 3.919 | 19.2% | 1 | K.WS*KRSHCAANIFPLLQNVGLAKAVVAAARS*TVNR.V | 4 |
| U | YOR141C | 1 | 1 | 3.5% | 881 | 100209 | 4.8 | ARP8 SGDID:S000005667, Chr XV from 592587-589942, reverse complement, Verified ORF, "Nuclear actin-related protein involved in chromatin remodeling, component of chromatin-remodeling enzyme complexes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_31.19260.19260.4 | 4.3933 | 0.2243 | 90.0% | 3856.4165 | 3854.0547 | 65 | 4.016 | 21.1% | 1 | K.NDPS*PIEWIFDDSKLYYGS*DALRCVDEKFVI.R | 4 |
| U | YER091C | 1 | 1 | 3.5% | 767 | 85860 | 6.5 | MET6 SGDID:S000000893, Chr V from 342163-339860, reverse complement, Verified ORF, "Cobalamin-independent methionine synthase, involved in amino acid biosynthesis; requires a minimum of two glutamates on the methyltetrahydrofolate substrate, similar to bacterial metE homologs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_47.28419.28419.3 | 3.5916 | 0.1799 | 98.7% | 3059.2144 | 3058.5366 | 2 | 3.882 | 27.9% | 1 | K.ADKDSLDLEPLSLLEQLLPLYTEILSK.L | 3 |
| U | YJL012C | 1 | 1 | 3.5% | 721 | 83155 | 6.8 | VTC4 SGDID:S000003549, Chr X from 413314-411149, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_13.11659.11659.3 | 3.3012 | 0.2749 | 100.0% | 3061.4043 | 3061.2446 | 9 | 4.699 | 26.0% | 1 | K.EFEREDSAITSIYFDNENLDLYYGR.L | 3 |
| U | YJR098C | 1 | 1 | 3.5% | 655 | 74132 | 7.4 | YJR098C SGDID:S000003859, Chr X from 615070-613103, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; detectable in highly purified mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_29.19503.19503.3 | 2.5891 | 0.1451 | 92.0% | 2412.5645 | 2415.882 | 142 | 3.592 | 26.1% | 1 | K.SALSLKATLNATTKFVLNAPVVR.N | 3 |
| U | YGR234W | 1 | 1 | 3.5% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04709.04709.2 | 2.0812 | 0.2077 | 99.5% | 1612.8322 | 1613.7308 | 3 | 4.867 | 50.0% | 1 | K.HVDELLAECANVDK.I | 2 |
| U | Reverse_YOL010W | 1 | 1 | 3.5% | 367 | 40171 | 8.8 | RCL1 SGDID:S000005370, Chr XV from 307938-309041, Verified ORF, "RNA terminal phosphate cyclase-like protein involved in rRNA processing at sites A0, A1, and A2; does not possess detectable RNA cyclase activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_21.16935.16935.2 | 1.5371 | 0.1599 | 94.0% | 1748.1522 | 1750.7788 | 4 | 3.615 | 45.8% | 1 | R.LRFNQSGQFTT*Y*K.P | 2 |
| U | Reverse_YOR227W | 1 | 1 | 3.4% | 1246 | 139457 | 8.9 | YOR227W SGDID:S000005753, Chr XV from 762825-766565, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_23.22415.22415.4 | 2.8438 | 0.166 | 95.5% | 4360.4565 | 4357.779 | 82 | 3.325 | 16.7% | 1 | K.EASVAPKSNSLENNVNQGSLPRQPSAITKTPVAATS*PLTATK.K | 4 |
| U | YKR067W | 1 | 1 | 3.4% | 743 | 83645 | 9.5 | GPT2 SGDID:S000001775, Chr XI from 567560-569791, Verified ORF, "Glycerol-3-phosphate acyltransferase located in both lipid particles and the ER; involved in the stepwise acylation of glycerol-3-phosphate and dihydroxyacetone, which are intermediate steps in lipid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_22.13373.13373.4 | 2.8397 | 0.1215 | 90.8% | 2694.8965 | 2699.9158 | 176 | 3.124 | 24.3% | 1 | R.MSVQSRSRSSSIHSIGSLAS*NALSR.V | 4 |
| U | YJL112W | 1 | 1 | 3.4% | 714 | 80032 | 5.6 | MDV1 SGDID:S000003648, Chr X from 205222-207366, Verified ORF, "Peripheral protein of the cytosolic face of the mitochondrial outer membrane, required for mitochondrial fission; interacts with Fis1p and with the dynamin-related GTPase Dnm1p; contains WD repeats" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_26.22638.22638.3 | 2.698 | 0.125 | 90.2% | 3071.0942 | 3074.2131 | 155 | 3.615 | 23.9% | 1 | K.RT*EHGRFVKNASNTFEDIYSKT*RR.G | 3 |
| U | YGL110C | 1 | 1 | 3.4% | 624 | 72043 | 7.0 | CUE3 SGDID:S000003078, Chr VII from 303414-301540, reverse complement, Uncharacterized ORF, "Protein of unknown function; has a CUE domain that binds ubiquitin, which may facilitate intramolecular monoubiquitination" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_8.05130.05130.3 | 2.8165 | 0.121 | 91.9% | 2549.0645 | 2547.5615 | 1 | 3.361 | 32.5% | 1 | K.LLYEADEDERDDTYDEADVNR.S | 3 |
| U | YOR201C | 1 | 1 | 3.4% | 412 | 46387 | 9.2 | YOR201C SGDID:S000005727, Chr XV from 721708-720470, reverse complement, Verified ORF, "Ribose methyltransferase that modifies a functionally critical, conserved nucleotide in mitochondrial 21S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_26.15815.15815.2 | 1.7988 | 0.1725 | 96.9% | 1586.2322 | 1585.7968 | 14 | 3.821 | 42.3% | 1 | R.SDFFVEIPFGGIEK.G | 2 |
| U | YMR303C | 1 | 3 | 3.4% | 348 | 36732 | 6.7 | ADH2 SGDID:S000004918, Chr XIII from 874336-873290, reverse complement, Verified ORF, "Glucose-repressible alcohol dehydrogenase II, catalyzes the conversion of ethanol to acetaldehyde; involved in the production of certain carboxylate esters; regulated by ADR1" |
| U | YOL086C | 1 | 3 | 3.4% | 348 | 36849 | 6.7 | ADH1 SGDID:S000005446, Chr XV from 160593-159547, reverse complement, Verified ORF, "Alcohol dehydrogenase, fermentative isozyme active as homo- or heterotetramers; required for the reduction of acetaldehyde to ethanol, the last step in the glycolytic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_6.05539.05539.2 | 3.4959 | 0.4344 | 100.0% | 1251.9122 | 1252.413 | 1 | 8.178 | 81.8% | 3 | K.SISIVGSYVGNR.A | 2 |
| U | YHR164C | 2 | 2 | 3.3% | 1522 | 171694 | 6.5 | DNA2 SGDID:S000001207, Chr VIII from 429180-424612, reverse complement, Verified ORF, "Essential tripartite DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, and helicase activities; required for Okazaki fragment processing; involved in DNA repair pathways; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_42.27306.27306.4 | 3.0339 | 0.2194 | 98.7% | 4213.5767 | 4217.7275 | 70 | 3.776 | 18.1% | 1 | K.RSASISVSPAKKTEEKEIIQNDS*KAILSKQT*KRKKK.Y | 4 |
| * | Jamie_phos_04_itms_14.15206.15206.2 | 2.0637 | 0.1429 | 96.1% | 1630.8522 | 1628.65 | 29 | 3.908 | 46.2% | 1 | K.SESQITIQGNT*NQK.S | 2 |
| U | Reverse_YCR092C | 1 | 1 | 3.3% | 1047 | 119753 | 7.4 | MSH3 SGDID:S000000688, Chr III from 279903-276760, reverse complement, Verified ORF, "Mismatch repair protein, forms dimers with Msh2p that mediate repair of insertion or deletion mutations and removal of nonhomologous DNA ends, contains a PCNA (Pol30p) binding motif required for genome stability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_55.33534.33534.4 | 2.9329 | 0.1159 | 91.0% | 4012.8164 | 4016.6514 | 145 | 2.671 | 19.1% | 1 | K.RLEESISFARNIIDKDLRALKAVNMGYSNYTLGKK.L | 4 |
| U | Reverse_YGL008C | 1 | 1 | 3.3% | 918 | 99619 | 5.1 | PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" |
| U | Reverse_YPL036W | 1 | 1 | 3.2% | 947 | 102172 | 5.0 | PMA2 SGDID:S000005957, Chr XVI from 482841-485684, Verified ORF, "Plasma membrane H+-ATPase, isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_03_itms_29.21657.21657.4 | 2.4984 | 0.2159 | 96.3% | 3482.4165 | 3477.748 | 140 | 4.314 | 20.7% | 1 | K.RS*AALCATLMLDDPSVGEVTYPEHLS*LKNK.T | 4 |
| U | YJL168C | 1 | 1 | 3.3% | 733 | 84540 | 8.5 | SET2 SGDID:S000003704, Chr X from 104421-102220, reverse complement, Verified ORF, "Histone methyltransferase with a role in transcriptional elongation, methylates a lysine residue of histone H3; associates with the C-terminal domain of Rpo21p; histone methylation activity is regulated by phosphorylation status of Rpo21p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_42.25594.25594.3 | 3.7141 | 0.2807 | 100.0% | 2974.1943 | 2978.44 | 88 | 5.088 | 25.0% | 1 | K.FETYKRITKKDINVAAS*KMIDLRR.V | 3 |
| U | YLR394W | 1 | 1 | 3.3% | 482 | 53863 | 10.2 | CST9 SGDID:S000004386, Chr XII from 907950-909398, Verified ORF, "Protein required for synaptonemal complex formation, may have a role in meiotic recombination; localizes to synapsis initiation sites on meiotic chromosomes; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07541.07541.2 | 1.7768 | 0.1167 | 90.6% | 1833.5521 | 1832.876 | 94 | 4.145 | 36.7% | 1 | K.LPNLDILT*NNGSVS*SK.N | 2 |
| U | Reverse_YOR272W | 1 | 1 | 3.3% | 460 | 51359 | 7.0 | YTM1 SGDID:S000005798, Chr XV from 832810-834192, Verified ORF, "Constituent of 66S pre-ribosomal particles, required for maturation of the large ribosomal subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17294.17294.2 | 2.0702 | 0.1789 | 98.0% | 1846.8922 | 1847.8931 | 15 | 4.353 | 42.9% | 1 | K.ESGLLHNVIES*LGY*R.K | 2 |
| U | Reverse_YDR097C | 1 | 1 | 3.2% | 1242 | 140080 | 5.8 | MSH6 SGDID:S000002504, Chr IV from 643832-640104, reverse complement, Verified ORF, "Protein required for mismatch repair in mitosis and meiosis, forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_53.32493.32493.4 | 3.1165 | 0.1032 | 91.5% | 4326.6167 | 4325.571 | 69 | 2.767 | 17.5% | 1 | K.FSSALTGYHT*AFFGLS*QIHTAVHHLVSEAIAFGDSSSGGR.G | 4 |
| U | Reverse_YJR119C | 1 | 1 | 3.2% | 728 | 84984 | 6.2 | YJR119C SGDID:S000003880, Chr X from 646405-644219, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_41.25220.25220.4 | 3.0623 | 0.2254 | 99.1% | 2870.0166 | 2865.8481 | 134 | 4.143 | 25.0% | 1 | K.TFY*LEDDIYPEEGDS*NNLNQISK.L | 4 |
| U | Reverse_YKL185W | 1 | 1 | 3.2% | 588 | 65685 | 9.9 | ASH1 SGDID:S000001668, Chr XI from 94504-96270, Verified ORF, "Zinc-finger inhibitor of HO transcription; mRNA is localized and translated in the distal tip of anaphase cells, resulting in accumulation of Ash1p in daughter cell nuclei and inhibition of HO expression; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18629.18629.2 | 2.0884 | 0.0895 | 90.5% | 2182.8323 | 2180.2961 | 16 | 3.27 | 30.6% | 1 | R.AT*NGFVNSAQKSIKNKS*PK.R | 2 |
| U | Reverse_YMR211W | 1 | 1 | 3.2% | 475 | 55312 | 5.3 | DML1 SGDID:S000004824, Chr XIII from 689082-690509, Verified ORF, "Essential protein involved in mtDNA inheritance, may also function in the partitioning of the mitochondrial organelle or in the segregation of chromosomes, exhibits regions similar to members of a GTPase family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_40.24444.24444.2 | 2.1385 | 0.1984 | 99.1% | 1867.5521 | 1869.8956 | 108 | 4.19 | 35.7% | 1 | R.DNSFETPIT*DSPFYR.H | 2 |
| U | YBR078W | 1 | 4 | 3.2% | 468 | 48237 | 5.1 | ECM33 SGDID:S000000282, Chr II from 393118-393175,393506-394854, Verified ORF, "GPI-anchored protein of unknown function, has a possible role in apical bud growth; GPI-anchoring on the plasma membrane crucial to function; similar to Sps2p and Pst1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_6.05361.05361.2 | 2.6735 | 0.2943 | 100.0% | 1576.3121 | 1576.7441 | 5 | 5.323 | 50.0% | 4 | K.VGQSLSIVSNDELSK.A | 2 |
| U | YBL005W-B | 3 | 8 | 3.1% | 1755 | 198968 | 8.2 | YBL005W-B SGDID:S000002147, Chr II from 221333-222637,222639-226601, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YLR227W-B | 3 | 8 | 3.1% | 1755 | 198404 | 7.9 | YLR227W-B SGDID:S000007376, Chr XII from 593440-594744,594746-598708, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YLR157C-B | 3 | 8 | 3.1% | 1755 | 198544 | 8.1 | YLR157C-B SGDID:S000007374, Chr XII from 481602-480298,480296-476334, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YJR029W | 3 | 8 | 3.1% | 1755 | 198616 | 8.3 | YJR029W SGDID:S000003790, Chr X from 478258-479558,479560-483526, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YGR161C-D | 3 | 8 | 3.1% | 1755 | 198558 | 8.5 | YGR161C-D SGDID:S000007368, Chr VII from 823020-821716,821714-817752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YGR027W-B | 3 | 8 | 3.1% | 1755 | 198656 | 8.2 | YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR365W-B | 3 | 8 | 3.1% | 1755 | 198658 | 8.0 | YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR261C-D | 3 | 8 | 3.4% | 1604 | 181660 | 7.5 | YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_02_itms_5.04889.04889.2 | 4.1977 | 0.3301 | 100.0% | 1825.2722 | 1825.0287 | 1 | 7.164 | 56.7% | 4 | K.TVDTTNYVILQGKESR.L | 2 | |
| Jamie_phos_03_itms_11.10920.10920.2 | 3.8846 | 0.3523 | 100.0% | 2090.5122 | 2090.2102 | 1 | 7.37 | 56.2% | 3 | R.LDQFNYDALTFDEDLNR.L | 2 | |
| Jamie_phos_03_itms_5.05766.05766.2 | 2.4537 | 0.3519 | 100.0% | 2128.5522 | 2129.245 | 1 | 5.336 | 35.0% | 1 | R.QTNSSLGGIGDSNAYTTINSK.K | 2 |
| U | Reverse_YDL223C | 1 | 1 | 3.0% | 1046 | 113616 | 6.4 | HBT1 SGDID:S000002382, Chr IV from 60406-57266, reverse complement, Verified ORF, "Substrate of the Hub1p ubiquitin-like protein that localizes to the shmoo tip (mating projection); mutants are defective for mating projection formation, thereby implicating Hbt1p in polarized cell morphogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_12.13913.13913.4 | 3.1609 | 0.161 | 96.2% | 3751.8564 | 3756.6094 | 305 | 4.1 | 19.4% | 1 | R.GMFS*QKGAQEEGQEDDHY*DQEGEDSGYQHHR.P | 4 |
| U | YBL113C | 1 | 1 | 3.0% | 792 | 86976 | 6.9 | YBL113C SGDID:S000002153, Chr II from 2658-280, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YPR204W | 1 | 1 | 2.3% | 1032 | 115156 | 6.7 | YPR204W SGDID:S000006408, Chr XVI from 944599-947697, Uncharacterized ORF, "subtelomerically-encoded DNA helicase" |
| U | YPL283C | 1 | 1 | 1.3% | 1859 | 211114 | 7.2 | YRF1-7 SGDID:S000006204, Chr XVI from 6007-5989,5840-280, reverse complement, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YOR396W | 1 | 1 | 2.0% | 1224 | 137645 | 6.6 | YOR396W SGDID:S000007526, Chr XV from 1087185-1090859, Uncharacterized ORF, "Hypothetical protein" |
| U | YNL339C | 1 | 1 | 1.3% | 1859 | 211098 | 7.2 | YRF1-6 SGDID:S000005283, Chr XIV from 6098-6080,5931-371, reverse complement, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YML133C | 1 | 1 | 1.7% | 1374 | 155553 | 8.0 | YML133C SGDID:S000004602, Chr XIII from 4684-3891,3791-461, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YLR467W | 1 | 1 | 1.3% | 1796 | 203780 | 7.6 | YRF1-5 SGDID:S000004459, Chr XII from 1072505-1077895, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YLR466W | 1 | 1 | 1.7% | 1382 | 156366 | 7.2 | YRF1-4 SGDID:S000004458, Chr XII from 1067084-1071232, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YLL067C | 1 | 1 | 2.0% | 1205 | 135236 | 8.0 | YLL067C SGDID:S000003990, Chr XII from 4301-4015,3915-585, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YLL066C | 1 | 1 | 2.0% | 1205 | 135646 | 7.9 | YLL066C SGDID:S000003989, Chr XII from 9836-9550,9450-6120, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YJL225C | 1 | 1 | 1.4% | 1758 | 197564 | 7.5 | YJL225C SGDID:S000003760, Chr X from 6130-4970,4581-466, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YIL177C | 1 | 1 | 1.4% | 1758 | 197511 | 7.4 | YIL177C SGDID:S000001439, Chr IX from 6147-4987,4598-483, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YHR219W | 1 | 1 | 3.8% | 624 | 70128 | 6.4 | YHR219W SGDID:S000001262, Chr VIII from 560173-562047, Uncharacterized ORF, "Hypothetical protein" |
| U | YHL050C | 1 | 1 | 3.4% | 697 | 79026 | 6.6 | YHL050C SGDID:S000001042, Chr VIII from 3310-2670,1897-445, reverse complement, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate" |
| U | YGR296W | 1 | 1 | 1.3% | 1859 | 211114 | 7.2 | YRF1-3 SGDID:S000003528, Chr VII from 1084870-1084888,1085037-1090597, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YER190W | 1 | 1 | 1.4% | 1681 | 190502 | 7.4 | YRF1-2 SGDID:S000000992, Chr V from 571475-576520, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| U | YEL077C | 1 | 1 | 1.9% | 1277 | 143091 | 7.2 | YEL077C SGDID:S000006409, Chr V from 4097-264, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YDR545W | 1 | 1 | 1.3% | 1796 | 203780 | 7.6 | YRF1-1 SGDID:S000002953, Chr IV from 1526304-1531694, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_01_itms_20.12394.12394.3 | 4.6241 | 0.2621 | 100.0% | 2917.5244 | 2917.1113 | 1 | 5.631 | 34.8% | 1 | R.NDEEYKEYLEDIEPYHGDPVGYLK.Y | 3 |
| U | YMR058W | 1 | 2 | 3.0% | 636 | 72360 | 4.8 | FET3 SGDID:S000004662, Chr XIII from 388821-390731, Verified ORF, "Ferro-O2-oxidoreductase required for high-affinity iron uptake and involved in mediating resistance to copper ion toxicity, belongs to class of integral membrane multicopper oxidases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_22.13898.13898.3 | 3.8618 | 0.0781 | 95.6% | 2265.2043 | 2265.3953 | 2 | 4.266 | 40.3% | 2 | R.DLHVDPEVLLNEVDENEER.Q | 3 |
| U | YOL148C | 1 | 1 | 3.0% | 604 | 67797 | 9.6 | SPT20 SGDID:S000005508, Chr XV from 47572-45758, reverse complement, Verified ORF, "Subunit of the SAGA transcriptional regulatory complex, involved in maintaining the integrity of the complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_20.18707.18707.2 | 1.7069 | 0.1915 | 97.3% | 2051.7322 | 2049.1462 | 153 | 3.702 | 32.4% | 1 | R.MT*KKKQSASSTPSSTT*MS.- | 2 |
| U | YIR006C | 1 | 1 | 2.9% | 1480 | 160266 | 5.3 | PAN1 SGDID:S000001445, Chr IX from 369905-365463, reverse complement, Verified ORF, "Part of actin cytoskeleton-regulatory complex Pan1p-Sla1p-End3p, associates with actin patches on the cell cortex; promotes protein-protein interactions essential for endocytosis; previously thought to be a subunit of poly(A) ribonuclease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_28.21065.21065.4 | 3.31 | 0.1255 | 95.1% | 4474.8965 | 4468.9707 | 148 | 3.398 | 16.7% | 1 | K.VEEAKIGHPDHARAPPVTAAPLPS*VTPVPPAVPVPQANTSNEK.S | 4 |
| U | YPL019C | 1 | 1 | 2.9% | 835 | 96553 | 7.4 | VTC3 SGDID:S000005940, Chr XVI from 517016-514509, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14399.14399.3 | 3.8581 | 0.139 | 97.8% | 2799.6243 | 2800.9495 | 52 | 4.105 | 26.1% | 1 | R.SSVDSWSERNESDFVEALDKELEK.V | 3 |
| U | YGR237C | 1 | 1 | 2.9% | 785 | 89241 | 9.1 | YGR237C SGDID:S000003469, Chr VII from 965660-963303, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_43.26438.26438.3 | 2.9662 | 0.1651 | 95.8% | 2840.7244 | 2841.0327 | 432 | 3.614 | 23.9% | 1 | K.RS*KS*FAGMTDEELAKLEEFYISK.G | 3 |
| U | YFL041W | 1 | 1 | 2.9% | 622 | 70880 | 5.2 | FET5 SGDID:S000001853, Chr VI from 49139-51007, Verified ORF, "Multicopper oxidase, integral membrane protein with similarity to Fet3p; may have a role in iron transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18224.18224.2 | 1.914 | 0.1913 | 98.3% | 1950.4722 | 1951.1844 | 259 | 4.139 | 29.4% | 1 | K.VPTLTTLLTSGKLAS*DPR.I | 2 |
| U | YNL167C | 1 | 1 | 2.9% | 647 | 70192 | 9.3 | SKO1 SGDID:S000005111, Chr XIV from 321361-319418, reverse complement, Verified ORF, "Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family that forms a complex with Tup1p and Ssn6p to both activate and repress transcription; cytosolic and nuclear protein involved in the osmotic and oxidative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_4.04540.04540.2 | 1.6879 | 0.1229 | 90.5% | 2149.5122 | 2152.3042 | 16 | 3.274 | 33.3% | 1 | R.RMSSTSSTSKASRKNSIS*R.K | 2 |
| U | Reverse_YGL095C | 1 | 1 | 2.9% | 577 | 67017 | 6.3 | VPS45 SGDID:S000003063, Chr VII from 330610-328877, reverse complement, Verified ORF, "Protein of the Sec1p/Munc-18 family, essential for vacuolar protein sorting; required for the function of Pep12p and the early endosome/late Golgi SNARE Tlg2p; essential for fusion of Golgi-derived vesicles with the prevacuolar compartment" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_27.22716.22716.2 | 1.8482 | 0.1216 | 91.8% | 2038.1122 | 2038.0961 | 148 | 3.671 | 34.4% | 1 | K.LLESQT*ACLS*ITPTTNK.D | 2 |
| U | Reverse_YGL228W | 1 | 1 | 2.9% | 577 | 66862 | 5.9 | SHE10 SGDID:S000003197, Chr VII from 67598-69331, Verified ORF, "Putative glycosylphosphatidylinositol (GPI)-anchored protein of unknown function; overexpression causes growth arrest" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_16.16072.16072.2 | 1.7771 | 0.1195 | 91.2% | 2047.6322 | 2045.2102 | 7 | 3.675 | 34.4% | 1 | R.TIYQSIETS*GSKDFFIK.K | 2 |
| U | YML123C | 1 | 1 | 2.9% | 587 | 64382 | 6.4 | PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_12.09314.09314.2 | 2.1091 | 0.111 | 92.8% | 1935.4722 | 1936.1284 | 129 | 3.951 | 34.4% | 1 | R.LALESIDDEGFGWQQVK.T | 2 |
| U | Reverse_YNR051C | 1 | 1 | 2.9% | 515 | 57674 | 9.1 | BRE5 SGDID:S000005334, Chr XIV from 718329-716782, reverse complement, Verified ORF, "Ubiquitin protease cofactor, forms deubiquitination complex with Ubp3p that coregulates anterograde and retrograde transport between the endoplasmic reticulum and Golgi compartments; null is sensitive to brefeldin A" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_21.14833.14833.2 | 1.9871 | 0.312 | 94.7% | 1782.8522 | 1780.7106 | 1 | 5.23 | 42.9% | 1 | I.PKEQT*SSET*PATTDK.V | 2 |
| U | YGL097W | 1 | 1 | 2.9% | 482 | 53014 | 6.1 | SRM1 SGDID:S000003065, Chr VII from 321785-323233, Verified ORF, "Nucleotide exchange factor for Gsp1p, localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_42.31680.31680.2 | 1.4857 | 0.1449 | 91.4% | 1487.3922 | 1489.7611 | 477 | 3.72 | 38.5% | 1 | K.DVHGKARAVPLPTK.L | 2 |
| U | YGR109W-B | 2 | 2 | 2.8% | 1547 | 178419 | 8.8 | YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_phos_04_itms_29.24002.24002.4 | 3.52 | 0.1625 | 97.7% | 4096.2563 | 4093.3733 | 437 | 3.892 | 18.1% | 1 | R.S*ET*VNNVRTYSAGNRGNPRNIKLSFAPTILEATDPK.S | 4 | |
| * | Jamie_phos_01_itms_71.43108.43108.2 | 1.1026 | 0.2425 | 97.0% | 870.9522 | 869.8638 | 46 | 3.729 | 41.7% | 1 | K.PISST*ER.I | 2 |
| U | Reverse_YMR128W | 1 | 1 | 2.8% | 1267 | 144954 | 6.3 | ECM16 SGDID:S000004735, Chr XIII from 523695-527498, Verified ORF, "Essential DEAH-box ATP-dependent RNA helicase specific to the U3 snoRNP, predominantly nucleolar in distribution, required for 18S rRNA synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_33.28315.28315.4 | 2.741 | 0.1264 | 90.6% | 4028.7766 | 4028.4307 | 319 | 3.539 | 18.1% | 1 | K.KPTKSEKNIVKINSFGFS*LGS*GGFKAPRHDIFGSSK.K | 4 |
| U | Reverse_YMR261C | 1 | 1 | 2.8% | 1054 | 118835 | 6.4 | TPS3 SGDID:S000004874, Chr XIII from 793368-790204, reverse complement, Verified ORF, "Regulatory subunit of trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14531.14531.3 | 3.2431 | 0.095 | 91.7% | 3046.4343 | 3047.3928 | 11 | 3.696 | 23.2% | 1 | K.AVDVVAPDVDPVSKSVPTIVASKSSS*RVR.P | 3 |
| U | YHR027C | 1 | 1 | 2.8% | 993 | 109492 | 4.6 | RPN1 SGDID:S000001069, Chr VIII from 164704-161723, reverse complement, Verified ORF, "Non-ATPase base subunit of the 19S regulatory particle of the 26S proteasome; may participate in the recognition of several ligands of the proteasome; contains a leucine-rich repeat (LRR) domain, a site for protein?protein interactions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_13.08380.08380.3 | 2.7121 | 0.17 | 95.1% | 3078.8943 | 3080.1992 | 28 | 4.721 | 24.1% | 1 | R.HLALEIGEVYNDQVEKDAEDETSSDGSK.S | 3 |
| U | YGR240C | 2 | 5 | 2.8% | 987 | 107970 | 6.4 | PFK1 SGDID:S000003472, Chr VII from 973739-970776, reverse complement, Verified ORF, "Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07390.07390.2 | 3.9835 | 0.1916 | 100.0% | 1697.3322 | 1696.8083 | 1 | 5.246 | 67.9% | 3 | K.DAFLEATSEDEIISR.A | 2 |
| * | Jamie_phos_02_itms_5.04684.04684.2 | 3.2087 | 0.216 | 100.0% | 1356.2322 | 1356.5651 | 3 | 4.529 | 70.8% | 2 | K.LRAEVAALAAENK.- | 2 |
| U | YJL157C | 1 | 1 | 2.8% | 830 | 94572 | 5.4 | FAR1 SGDID:S000003693, Chr X from 126245-123753, reverse complement, Verified ORF, "Cyclin-dependent kinase inhibitor that mediates cell cycle arrest in response to pheromone; also forms a complex with Cdc24p, Ste4p, and Ste18p that may specify the direction of polarized growth during mating; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_19.18045.18045.3 | 2.5294 | 0.1415 | 90.7% | 2950.1943 | 2947.2031 | 350 | 3.442 | 22.7% | 1 | K.T*RLIMDEHPHS*SLIEIEYFDLVK.Q | 3 |
| U | Reverse_YCR065W | 1 | 1 | 2.8% | 564 | 63647 | 7.3 | HCM1 SGDID:S000000661, Chr III from 229305-230999, Verified ORF, "Forkhead transcription factor involved in cell cycle specific transcription of SPC110, encoding a spindle pole body (SPB) calmodulin binding protein; dosage-dependent suppressor of calmodulin mutants with specific defects in SPB assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_9.09492.09492.2 | 1.8624 | 0.1163 | 91.3% | 2070.7922 | 2070.0898 | 8 | 4.15 | 36.7% | 1 | R.LPSLDEFNSNFS*TFY*K.R | 2 |
| U | YLR197W | 1 | 1 | 2.8% | 504 | 56864 | 8.9 | SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_9.09567.09567.2 | 2.2611 | 0.1873 | 99.1% | 1666.2122 | 1666.8866 | 5 | 4.338 | 53.8% | 1 | K.NELAIQEAMELYNK.D | 2 |
| U | Reverse_YLR449W | 1 | 1 | 2.8% | 392 | 43903 | 4.7 | FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_19.11820.11820.2 | 1.834 | 0.1353 | 95.3% | 1305.3121 | 1305.5173 | 260 | 3.461 | 55.0% | 1 | K.EAKKDKKTTQK.K | 2 |
| U | YKR095W | 2 | 2 | 2.7% | 1875 | 218454 | 5.2 | MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18414.18414.3 | 4.3188 | 0.2263 | 100.0% | 3202.4343 | 3202.4475 | 15 | 5.071 | 21.3% | 1 | K.LEESTTSYESTINGLNEEITTLKEEIEK.Q | 3 |
| * | Jamie_phos_01_itms_14.08804.08804.4 | 3.5631 | 0.2753 | 92.9% | 2633.0166 | 2638.9531 | 14 | 4.606 | 28.6% | 1 | S.MEQS*GEIDVVLRKQLEAKVQEK.Q | 4 |
| U | YPR026W | 1 | 1 | 2.7% | 1211 | 136920 | 5.4 | ATH1 SGDID:S000006230, Chr XVI from 615376-619011, Verified ORF, "Acid trehalase required for utilization of extracellular trehalose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_61.36910.36910.4 | 3.437 | 0.0849 | 91.9% | 3954.7766 | 3957.3582 | 106 | 3.857 | 18.8% | 1 | K.DVSS*NIYNVILT*EDQPKIIVHKYVGIMSTEFNK.N | 4 |
| U | YGR070W | 1 | 1 | 2.7% | 1155 | 131392 | 9.1 | ROM1 SGDID:S000003302, Chr VII from 627810-631277, Verified ORF, "GDP/GTP exchange protein (GEP) for Rho1p; mutations are synthetically lethal with mutations in rom2, which also encodes a GEP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_29.17712.17712.4 | 3.7107 | 0.0693 | 92.1% | 3342.2966 | 3338.9685 | 460 | 3.05 | 18.9% | 1 | R.SKSS*PVSLTEISMIKGTPLVYPALLSLIAIK.F | 4 |
| U | YPR042C | 1 | 1 | 2.7% | 1075 | 119508 | 8.8 | PUF2 SGDID:S000006246, Chr XVI from 653659-650432, reverse complement, Verified ORF, "Member of the PUF protein family, which is defined by the presence of Pumilio homology domains that confer RNA binding activity; preferentially binds mRNAs encoding membrane-associated proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_31.20568.20568.4 | 3.5292 | 0.0748 | 91.7% | 3403.0166 | 3406.6067 | 101 | 3.2 | 21.4% | 1 | K.GVS*DTNYFGPLPEHNS*KVPKRKDTFDAPK.L | 4 |
| U | YER151C | 1 | 2 | 2.7% | 912 | 101917 | 7.8 | UBP3 SGDID:S000000953, Chr V from 472419-469681, reverse complement, Verified ORF, "Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_8.08723.08723.3 | 3.2778 | 0.2777 | 100.0% | 2734.7043 | 2735.829 | 49 | 5.271 | 26.0% | 2 | R.IDDVNITELEDDDVLKGGEEASDSR.T | 3 |
| U | YOR113W | 1 | 1 | 2.7% | 914 | 101170 | 7.4 | AZF1 SGDID:S000005639, Chr XV from 534075-536819, Verified ORF, "Zinc-finger transcription factor, involved in induction of CLN3 transcription in response to glucose; genetic and physical interactions indicate a possible role in mitochondrial transcription or genome maintenance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_37.30737.30737.3 | 2.8493 | 0.1541 | 94.7% | 3091.0444 | 3091.3801 | 30 | 3.902 | 25.0% | 1 | K.HIDESGMQPNIIKKRKKDDST*VY*VK.N | 3 |
| U | YBR133C | 1 | 1 | 2.7% | 827 | 95153 | 6.4 | HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_8.13504.13504.2 | 3.3659 | 0.3072 | 100.0% | 2581.412 | 2581.6624 | 1 | 5.703 | 45.2% | 1 | K.DTVQDEDDFTVEFSQSSLNEFK.I | 2 |
| U | YPL106C | 1 | 1 | 2.7% | 693 | 77367 | 5.2 | SSE1 SGDID:S000006027, Chr XVI from 352272-350191, reverse complement, Verified ORF, "ATPase that is a component of the heat shock protein Hsp90 chaperone complex; binds unfolded proteins; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_29.25908.25908.2 | 1.8633 | 0.1421 | 95.5% | 2075.0322 | 2073.3972 | 35 | 3.677 | 33.3% | 1 | K.TVKKDDLTIVAHTFGLDAK.K | 2 |
| U | YAL011W | 1 | 1 | 2.7% | 625 | 72515 | 9.2 | SWC3 SGDID:S000000009, Chr I from 132202-134079, Verified ORF, "Protein of unknown function, component of the Swr1p complex that incorporates Htz1p into chromatin; required for formation of nuclear-associated array of smooth endoplasmic reticulum known as karmellae" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_33.20436.20436.2 | 1.6043 | 0.1334 | 90.8% | 2056.8323 | 2059.1052 | 278 | 3.181 | 28.1% | 1 | K.EEEDVKEKGVKS*EDTQK.K | 2 |
| U | YHR035W | 1 | 1 | 2.7% | 630 | 72307 | 8.6 | YHR035W SGDID:S000001077, Chr VIII from 178212-180104, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_15.15642.15642.2 | 1.9077 | 0.1323 | 94.3% | 2082.4922 | 2085.1948 | 51 | 3.906 | 37.5% | 1 | K.IASRIIDSFAY*SSKHT*K.E | 2 |
| U | YBR127C | 2 | 5 | 2.7% | 517 | 57749 | 5.1 | VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_8.04925.04925.3 | 3.177 | 0.103 | 95.6% | 1745.9944 | 1746.8737 | 8 | 4.153 | 42.3% | 1 | R.FFKQDFEENGSLER.T | 3 |
| * | Jamie_phos_02_itms_5.05048.05048.2 | 2.9929 | 0.3086 | 100.0% | 1746.9321 | 1746.8737 | 2 | 5.618 | 57.7% | 4 | R.FFKQDFEENGSLER.T | 2 |
| U | Reverse_YOL021C | 1 | 1 | 2.6% | 1001 | 113707 | 6.7 | DIS3 SGDID:S000005381, Chr XV from 285426-282421, reverse complement, Verified ORF, "Nucleolar exosome component, involved in rRNA processing and RNA degradation, binds Gsp1p/Ran and enhances the GEF activity of Srm1p, implicated in mitotic control, homologous to the E. coli RNase R of the RNase II family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_37.26442.26442.3 | 2.4555 | 0.1899 | 94.7% | 3042.1743 | 3046.2935 | 50 | 3.933 | 23.0% | 1 | K.KAHLADDIDVCGPPDIS*CILKDRLDK.R | 3 |
| U | Reverse_YJR061W | 1 | 1 | 2.6% | 935 | 108427 | 6.6 | YJR061W SGDID:S000003822, Chr X from 550425-553232, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_16.16244.16244.3 | 2.5374 | 0.1613 | 92.8% | 2857.0144 | 2860.0442 | 68 | 3.539 | 23.9% | 1 | K.YENNLTAIPRNPVFASVGS*FMT*NR.L | 3 |
| U | YOL138C | 1 | 1 | 2.5% | 1341 | 149269 | 7.0 | YOL138C SGDID:S000005498, Chr XV from 65349-61324, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_41.27074.27074.4 | 3.3366 | 0.1991 | 98.7% | 4065.9365 | 4061.5815 | 151 | 4.575 | 18.7% | 1 | K.IQT*LVDLISIATHNASVYLSIDDLT*NFKIWILIR.D | 4 |
| U | Reverse_YCR033W | 1 | 1 | 2.5% | 1226 | 138397 | 9.1 | SNT1 SGDID:S000000629, Chr III from 186484-190164, Verified ORF, "Subunit of the Set3C deacetylase complex; putative DNA-binding protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17018.17018.4 | 3.2366 | 0.1011 | 91.9% | 3499.3765 | 3503.8105 | 218 | 3.337 | 21.1% | 1 | K.DLKNADHFKKTHLS*PSSQSHTSKLITTSNAK.W | 4 |
| U | YNL220W | 1 | 1 | 2.5% | 433 | 48279 | 8.1 | ADE12 SGDID:S000005164, Chr XIV from 234414-235715, Verified ORF, "Adenylosuccinate synthase, catalyzes the first committed step in the 'de novo' biosynthesis of adenosine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_12.07398.07398.2 | 1.9026 | 0.2013 | 98.8% | 1384.6721 | 1384.4412 | 219 | 4.751 | 50.0% | 1 | R.YGDFEYDFEAK.L | 2 |
| U | Reverse_YLR256W | 1 | 1 | 2.4% | 1502 | 166107 | 7.4 | HAP1 SGDID:S000004246, Chr XII from 646417-650925, Verified ORF, "Zinc finger transcription factor involved in the complex regulation of gene expression in response to levels of heme and oxygen; the S288C sequence differs from other strain backgrounds due to a Ty1 insertion in the carboxy terminus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_30.22396.22396.4 | 3.5209 | 0.1009 | 94.2% | 4320.2163 | 4320.8926 | 152 | 3.398 | 17.6% | 1 | K.KSLQKT*LKQFLLMRS*MLIEALSDGSDLNVDKMFDDK.K | 4 |
| U | YDR464W | 1 | 1 | 2.4% | 1435 | 161596 | 8.9 | SPP41 SGDID:S000002872, Chr IV from 1388862-1393169, Verified ORF, "Protein involved in negative regulation of expression of spliceosome components PRP4 and PRP3" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_22.19977.19977.4 | 3.312 | 0.0952 | 92.0% | 3803.5366 | 3807.2107 | 282 | 3.327 | 19.2% | 1 | R.PPQEKKKTKSKTSKAAST*ANKSPAS*ESTSKKKKK.K | 4 |
| U | Reverse_YHL023C | 1 | 1 | 2.4% | 1146 | 129973 | 6.4 | RMD11 SGDID:S000001015, Chr VIII from 62561-59121, reverse complement, Verified ORF, "Protein required for sporulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_19.20275.20275.3 | 2.6544 | 0.1794 | 95.2% | 3023.9944 | 3026.4177 | 171 | 4.066 | 22.2% | 1 | K.KLTNESLSSIKSAISKKRSINTTTSSSR.K | 3 |
| U | Reverse_YER129W | 1 | 1 | 2.4% | 1142 | 126872 | 8.7 | SAK1 SGDID:S000000931, Chr V from 417277-420705, Verified ORF, "Upstream kinase for the SNF1 complex; partially redundant function with Elm1p and Tos3p; members of this family of kinases have functional orthology with LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_31.25391.25391.3 | 2.3393 | 0.1695 | 91.3% | 3069.6843 | 3068.4783 | 165 | 3.956 | 22.1% | 1 | K.SQKMRQYLSKIPSNKSGSKDSSNINIR.P | 3 |
| U | YAL035W | 1 | 1 | 2.4% | 1002 | 112268 | 5.8 | FUN12 SGDID:S000000033, Chr I from 76428-79436, Verified ORF, "GTPase, required for general translation initiation by promoting Met-tRNAiMet binding to ribosomes and ribosomal subunit joining; homolog of bacterial IF2" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_60.36434.36434.3 | 2.3978 | 0.1639 | 91.9% | 2763.9543 | 2761.92 | 44 | 3.719 | 23.9% | 1 | K.ELNKQNVEKAAAEKAAAEKS*QKS*K.G | 3 |
| U | YMR205C | 1 | 1 | 2.4% | 959 | 104618 | 6.7 | PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_19.18252.18252.3 | 2.9734 | 0.1746 | 96.5% | 2670.9543 | 2670.9812 | 90 | 4.276 | 26.1% | 1 | K.YEFDGLIIVGGFEAFESLHQLER.A | 3 |
| U | YML034W | 1 | 1 | 2.4% | 834 | 95498 | 5.6 | SRC1 SGDID:S000004497, Chr XIII from 209525-211444,211571-212155, Verified ORF, "Protein with a putative role in sister chromatid segregation, potentially phosphorylated by Cdc28p; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17298.17298.2 | 1.9795 | 0.1301 | 95.2% | 2209.112 | 2207.235 | 261 | 3.662 | 31.6% | 1 | R.HNPKELGTANGTGHST*PLS*K.L | 2 |
| U | YGL205W | 1 | 1 | 2.4% | 748 | 84042 | 8.5 | POX1 SGDID:S000003173, Chr VII from 108162-110408, Verified ORF, "Fatty-acyl coenzyme A oxidase, involved in the fatty acid beta-oxidation pathway; localized to the peroxisomal matrix" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_31.19136.19136.2 | 2.008 | 0.1417 | 95.8% | 2202.8323 | 2203.3708 | 1 | 3.38 | 38.2% | 1 | R.T*T*INPDSVVLNPQKFIQK.E | 2 |
| U | Reverse_YPR007C | 1 | 1 | 2.4% | 680 | 77202 | 5.2 | REC8 SGDID:S000006211, Chr XVI from 571375-569333, reverse complement, Verified ORF, "Meiosis-specific component of sister chromatid cohesion complex; maintains cohesion between sister chromatids during meiosis I; maintains cohesion between centromeres of sister chromatids until meiosis II; homolog of S. pombe Rec8p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_43.28041.28041.2 | 1.7104 | 0.1297 | 91.5% | 2100.4922 | 2098.1074 | 12 | 3.728 | 36.7% | 1 | R.NS*NS*LENIYDQRRISK.A | 2 |
| U | Reverse_YFR048W | 1 | 1 | 2.4% | 662 | 75914 | 7.3 | RMD8 SGDID:S000001944, Chr VI from 246133-248121, Verified ORF, "Cytosolic protein required for sporulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_30.26862.26862.2 | 1.5352 | 0.1659 | 94.5% | 1977.9321 | 1980.1198 | 1 | 3.617 | 40.0% | 1 | R.PLRDFS*NS*KMSGVKPR.Q | 2 |
| U | YBR121C | 1 | 1 | 2.4% | 667 | 75411 | 6.0 | GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_5.06164.06164.2 | 2.0963 | 0.1502 | 96.8% | 1730.3722 | 1730.9097 | 4 | 4.876 | 43.3% | 1 | K.VDGVDGEVELDDKLVK.I | 2 |
| U | YDL233W | 1 | 1 | 2.4% | 458 | 51320 | 8.5 | YDL233W SGDID:S000002392, Chr IV from 36798-38174, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_6.08619.08619.3 | 1.7412 | 0.2218 | 92.8% | 1311.5944 | 1311.3232 | 77 | 4.29 | 25.0% | 1 | R.S*ASQAS*LSMLR.V | 3 |
| U | YOR336W | 1 | 1 | 2.3% | 1365 | 156477 | 5.2 | KRE5 SGDID:S000005863, Chr XV from 949768-953865, Verified ORF, "Protein required for beta-1,6 glucan biosynthesis; mutations result in aberrant morphology and severe growth defects" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_39.24080.24080.4 | 3.9518 | 0.2733 | 100.0% | 3601.9365 | 3601.696 | 285 | 4.063 | 19.4% | 1 | N.DECVS*EWKKKINKFASSPGDEDVPGES*VSSK.Y | 4 |
| U | YKL215C | 1 | 1 | 2.3% | 1286 | 140427 | 6.8 | YKL215C SGDID:S000001698, Chr XI from 30688-26828, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.21882.21882.3 | 3.2424 | 0.3101 | 92.3% | 3126.8943 | 3123.1145 | 124 | 4.889 | 20.7% | 1 | K.GFGYYETICGGSGAGADSWRGS*GWNGSDAV.H | 3 |
| U | YBR033W | 1 | 1 | 2.3% | 919 | 103397 | 8.6 | YBR033W SGDID:S000000237, Chr II from 301944-304703, Uncharacterized ORF, "Non-essential protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_49.29523.29523.2 | 2.2352 | 0.1889 | 98.8% | 2239.4722 | 2242.3176 | 106 | 3.795 | 30.0% | 1 | R.SSLAILGSDSS*ISTEFGGNYR.L | 2 |
| U | YOR270C | 1 | 1 | 2.3% | 840 | 95529 | 5.5 | VPH1 SGDID:S000005796, Chr XV from 830571-828049, reverse complement, Verified ORF, "Subunit of vacuolar-ATPase V0 domain, one of two isoforms (Vph1p and Stv1p); Vph1p is located in V-ATPase complexes of the vacuole while Stv1p is located in V-ATPase complexes of the Golgi and endosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_7.06173.06173.2 | 3.689 | 0.3868 | 100.0% | 2069.5923 | 2069.146 | 1 | 7.752 | 52.8% | 1 | K.IAESLDANLYDVDSSNEGR.S | 2 |
| U | YFL004W | 1 | 1 | 2.3% | 828 | 95441 | 6.8 | VTC2 SGDID:S000001890, Chr VI from 131805-134291, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in protein localization and non-autophagic vacuolar fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_24.14696.14696.3 | 3.6915 | 0.3327 | 100.0% | 2342.6643 | 2342.4749 | 1 | 5.222 | 36.1% | 1 | R.WDDSDESKFVEELDKELEK.V | 3 |
| U | YOR168W | 1 | 1 | 2.3% | 809 | 93133 | 8.4 | GLN4 SGDID:S000005694, Chr XV from 649303-651732, Verified ORF, "Glutamine tRNA synthetase, monomeric class I tRNA synthetase that catalyzes the specific glutaminylation of tRNA(Glu); N-terminal domain proposed to be involved in enzyme-tRNA interactions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_6.05740.05740.3 | 3.0469 | 0.3465 | 100.0% | 2172.0544 | 2172.4863 | 1 | 5.352 | 36.1% | 1 | R.VGYFTLDKESTTSKVILNR.I | 3 |
| U | YMR301C | 1 | 1 | 2.3% | 690 | 77522 | 9.6 | ATM1 SGDID:S000004916, Chr XIII from 869626-867554, reverse complement, Verified ORF, "Mitochondrial inner membrane transporter, exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; member of the ATP-binding cassette (ABC) transporter family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_8.11471.11471.2 | 1.7179 | 0.2194 | 98.6% | 1816.2122 | 1816.2412 | 160 | 4.222 | 36.7% | 1 | K.VRIRVLIALGLLIS*AK.I | 2 |
| U | YMR162C | 1 | 1 | 2.2% | 1656 | 188318 | 6.8 | DNF3 SGDID:S000004772, Chr XIII from 583920-578950, reverse complement, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the trans-Golgi, likely involved in protein transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_38.22965.22965.4 | 3.8506 | 0.0962 | 95.6% | 4130.3765 | 4128.364 | 170 | 3.316 | 17.1% | 1 | K.EENNKPVGVLVKDGNNDAQEVYT*LPS*SVVSSTAYLTK.S | 4 |
| U | Reverse_YML006C | 1 | 1 | 2.2% | 774 | 87139 | 5.0 | GIS4 SGDID:S000004465, Chr XIII from 258416-256092, reverse complement, Verified ORF, "CAAX box containing protein of unknown function, proposed to be involved in the RAS/cAMP signaling pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_41.25188.25188.2 | 1.9793 | 0.2318 | 99.8% | 2016.3322 | 2015.0177 | 199 | 4.252 | 31.2% | 1 | K.RDKNTAHTPNDIGS*LS*K.L | 2 |
| U | Reverse_YLR177W | 1 | 1 | 2.2% | 628 | 71265 | 8.7 | YLR177W SGDID:S000004167, Chr XII from 511056-512942, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_8.11425.11425.2 | 1.8999 | 0.1845 | 97.4% | 1461.3722 | 1459.4697 | 16 | 3.474 | 46.2% | 1 | R.SSS*ASVNDGRLTGK.I | 2 |
| U | YNL083W | 1 | 1 | 2.2% | 545 | 61271 | 9.1 | SAL1 SGDID:S000005027, Chr XIV from 471379-473016, Verified ORF, "Probable transporter, member of the Ca2+-binding subfamily of the mitochondrial carrier family, with two EF-hand motifs; Pet9p and Sal1p have an overlapping function critical for viability; polymorphic in different S. cerevisiae strains" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_18.13135.13135.2 | 1.3236 | 0.1917 | 95.5% | 1533.2122 | 1532.6753 | 57 | 3.983 | 40.9% | 1 | K.IMT*KLEGCRDTK.D | 2 |
| U | Reverse_YLR454W | 2 | 2 | 2.1% | 2628 | 303478 | 8.0 | YLR454W SGDID:S000004446, Chr XII from 1043995-1051881, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_22.15315.15315.2 | 1.7464 | 0.1419 | 93.7% | 2014.0322 | 2011.2488 | 5 | 3.269 | 43.3% | 1 | K.ICS*KKKSESLALFYQK.T | 2 |
| * | Jamie_phos_03_itms_13.12021.12021.4 | 3.146 | 0.1732 | 97.6% | 4697.5366 | 4692.9683 | 3 | 3.788 | 17.1% | 1 | K.SIFGGGNDEPTEIFTREEERPLEKHLDNT*SS*KKSDIRLGK.I | 4 |
| U | YFL033C | 1 | 1 | 2.1% | 1770 | 196530 | 6.5 | RIM15 SGDID:S000001861, Chr VI from 74425-69113, reverse complement, Verified ORF, "Glucose-repressible protein kinase involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; originally identified as a regulator of IME2" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_40.24592.24592.4 | 3.7094 | 0.0767 | 93.0% | 4177.0967 | 4181.606 | 28 | 3.166 | 18.1% | 1 | K.LPTPRRKLDSNGLFSDAYLNADIIPNPSIESTIS*IDR.D | 4 |
| U | Reverse_YGL206C | 1 | 1 | 2.1% | 1653 | 187233 | 5.2 | CHC1 SGDID:S000003174, Chr VII from 107508-102547, reverse complement, Verified ORF, "Clathrin heavy chain, subunit of the major coat protein involved in intracellular protein transport and endocytosis; two heavy chains form the clathrin triskelion structural component; the light chain (CLC1) is thought to regulate function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_14.12359.12359.4 | 3.1632 | 0.1098 | 92.6% | 3910.8564 | 3906.1687 | 379 | 3.438 | 19.1% | 1 | R.TVENGKALDVIAVSNTGDKTERVTVFHDSEFTTS*R.F | 4 |
| U | YJR109C | 1 | 1 | 2.1% | 1118 | 123915 | 5.3 | CPA2 SGDID:S000003870, Chr X from 632856-629500, reverse complement, Verified ORF, "Large subunit of carbamoyl phosphate synthetase, which catalyzes a step in the synthesis of citrulline, an arginine precursor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_37.22761.22761.2 | 2.8481 | 0.3273 | 100.0% | 2664.7722 | 2664.8489 | 1 | 5.818 | 34.8% | 1 | K.DINIPIAESFACETVDEALEAAER.V | 2 |
| U | YGR258C | 1 | 1 | 2.1% | 1031 | 117838 | 5.2 | RAD2 SGDID:S000003490, Chr VII from 1010772-1007677, reverse complement, Verified ORF, "Single-stranded DNA endonuclease, cleaves single-stranded DNA during nucleotide excision repair to excise damaged DNA; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPG protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_31.21118.21118.3 | 2.6318 | 0.1278 | 90.1% | 2654.9343 | 2657.0999 | 314 | 3.221 | 25.0% | 1 | R.LESLEDKRMAVDASIWIYQFLK.A | 3 |
| U | YCR067C | 1 | 1 | 2.1% | 1065 | 114079 | 4.7 | SED4 SGDID:S000000663, Chr III from 236317-233120, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_26.18094.18094.3 | 2.7681 | 0.1195 | 90.8% | 2309.1243 | 2312.5383 | 19 | 3.771 | 28.6% | 1 | K.FHSISEPVSSAIVETATSSFSK.T | 3 |
| U | YDR359C | 1 | 1 | 2.1% | 982 | 112502 | 9.0 | VID21 SGDID:S000002767, Chr IV from 1194875-1191927, reverse complement, Verified ORF, "Component of the NuA4 histone acetyltransferase complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_6.10327.10327.2 | 1.9683 | 0.1839 | 98.1% | 2464.6921 | 2465.7263 | 21 | 3.434 | 32.5% | 1 | K.RKTLLPGKENKLSDDGRIS*EK.S | 2 |
| U | Reverse_YKL050C | 1 | 1 | 2.1% | 922 | 103144 | 6.1 | YKL050C SGDID:S000001533, Chr XI from 345264-342496, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_42.27478.27478.2 | 1.9289 | 0.1783 | 97.3% | 2316.4521 | 2317.5608 | 127 | 3.772 | 30.6% | 1 | K.IY*LKKQAERAAFDPDELTK.P | 2 |
| U | YER169W | 1 | 1 | 2.1% | 796 | 90211 | 9.1 | RPH1 SGDID:S000000971, Chr V from 523364-525754, Verified ORF, "Transcriptional repressor of PHR1, which is a photolyase induced by DNA damage; binds to AG(4) (C(4)T) sequence upstream of PHR1; Rph1p phosphorylation during DNA damage is under control of the MEC1-RAD53 pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_26.19542.19542.2 | 1.6957 | 0.2078 | 98.1% | 2154.3123 | 2154.2517 | 5 | 3.998 | 37.5% | 1 | R.TEY*TIDLSDFQNTERLK.F | 2 |
| U | YNL224C | 1 | 1 | 2.1% | 767 | 86950 | 5.7 | YNL224C SGDID:S000005168, Chr XIV from 227100-224797, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_43.28316.28316.2 | 1.6618 | 0.1285 | 90.9% | 1956.2122 | 1956.1376 | 203 | 3.731 | 33.3% | 1 | R.LT*FPPLDPHGNKT*VMK.I | 2 |
| U | Reverse_YFL002C | 1 | 1 | 2.1% | 606 | 69422 | 9.0 | SPB4 SGDID:S000001894, Chr VI from 146929-145109, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase, nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_18.14880.14880.2 | 1.7528 | 0.117 | 90.9% | 1593.5122 | 1594.8107 | 258 | 3.544 | 45.8% | 1 | K.IFAVY*AKVGKDFR.D | 2 |
| U | Reverse_YDR261W-B | 1 | 1 | 2.0% | 1770 | 201961 | 8.3 | YDR261W-B SGDID:S000007397, Chr IV from 981456-982748,982750-986769, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_38.29832.29832.4 | 2.9561 | 0.1839 | 97.2% | 4289.6167 | 4294.8413 | 69 | 3.653 | 17.6% | 1 | K.FTKIPLPKT*MVDAINMKTEIY*YVYLNNGSVEDRLR.M | 4 |
| U | YNL321W | 1 | 1 | 2.0% | 908 | 102499 | 7.1 | YNL321W SGDID:S000005265, Chr XIV from 34695-37421, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_16.10203.10203.3 | 2.4574 | 0.1902 | 95.8% | 2054.9043 | 2055.9866 | 461 | 4.584 | 30.9% | 1 | K.NNHIS*ASGNS*TSGDHRLK.E | 3 |
| U | YMR160W | 1 | 1 | 2.0% | 816 | 95097 | 6.9 | YMR160W SGDID:S000004770, Chr XIII from 575065-577515, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_30.21969.21969.2 | 2.0888 | 0.1439 | 96.0% | 2171.4321 | 2173.2324 | 18 | 3.555 | 36.7% | 1 | K.QY*QNSNKIWLQEMDS*K.W | 2 |
| U | Reverse_YPL207W | 1 | 1 | 2.0% | 810 | 89805 | 8.2 | YPL207W SGDID:S000006128, Chr XVI from 159908-162340, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_12.07674.07674.3 | 2.844 | 0.1654 | 97.1% | 1834.7644 | 1838.8864 | 164 | 3.721 | 36.7% | 1 | K.SVS*LKKGVRSNSS*SNK.S | 23 |
| U | Reverse_YMR212C | 1 | 1 | 2.0% | 782 | 89191 | 7.5 | EFR3 SGDID:S000004825, Chr XIII from 693042-690694, reverse complement, Verified ORF, "Non-essential protein of unknown function; exhibits synthetic lethal genetic interactions with PHO85; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_25.17032.17032.2 | 1.664 | 0.1282 | 90.7% | 1849.3922 | 1848.1736 | 45 | 3.229 | 36.7% | 1 | K.LDSVKPATARMTKWSR.A | 2 |
| U | YBR058C | 1 | 1 | 2.0% | 781 | 88630 | 5.2 | UBP14 SGDID:S000000262, Chr II from 356015-353670, reverse complement, Verified ORF, "Ubiquitin-specific protease that specifically disassembles unanchored ubiquitin chains; involved in fructose-1,6-bisphosphatase (Fbp1p) degradation; similar to human isopeptidase T" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_22.21908.21908.2 | 1.7967 | 0.2062 | 98.4% | 1802.4922 | 1804.8596 | 38 | 4.811 | 40.0% | 1 | K.STDSDISS*TALEKIEK.I | 2 |
| U | Reverse_YDL113C | 1 | 1 | 2.0% | 640 | 72546 | 7.0 | ATG20 SGDID:S000002271, Chr IV from 258555-256633, reverse complement, Verified ORF, "Protein required for transport of aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole targeting pathway; binds phosphatidylinositol-3-phosphate, involved in localization of membranes to the preautophagosome, potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_22.15550.15550.2 | 1.64 | 0.1362 | 92.0% | 1752.1322 | 1749.7887 | 7 | 3.647 | 50.0% | 1 | R.S*Y*HKLIESLDVER.E | 2 |
| U | YJR045C | 1 | 1 | 2.0% | 654 | 70628 | 5.6 | SSC1 SGDID:S000003806, Chr X from 521516-519552, reverse complement, Verified ORF, "Mitochondrial matrix ATPase that is a subunit of the presequence translocase-associated protein import motor (PAM); involved in protein translocation into the matrix and protein folding; member of the heat shock protein 70 (HSP70) family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_7.04548.04548.3 | 4.2107 | 0.2021 | 100.0% | 1538.3944 | 1538.6543 | 28 | 4.617 | 50.0% | 1 | R.FKTETGIDLENDR.M | 3 |
| U | YNR016C | 2 | 2 | 1.9% | 2233 | 250351 | 6.3 | ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18510.18510.3 | 3.4343 | 0.2598 | 100.0% | 2822.9043 | 2821.067 | 5 | 4.372 | 27.2% | 1 | K.LLETEDFEDNTITTGWLDDLITHK.M | 3 |
| * | Jamie_phos_02_itms_10.08046.08046.2 | 2.8778 | 0.2538 | 100.0% | 2060.672 | 2061.17 | 2 | 6.08 | 38.9% | 1 | R.AVS*VSDLSYVANSQSSPLR.E | 2 |
| U | Reverse_YGR217W | 1 | 1 | 1.9% | 2039 | 234597 | 8.4 | CCH1 SGDID:S000003449, Chr VII from 924699-930818, Verified ORF, "Voltage-gated calcium channel involved in calcium influx in response to mating pheromones" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_33.20036.20036.4 | 3.495 | 0.1244 | 95.8% | 4453.4966 | 4452.7153 | 1 | 3.992 | 21.2% | 1 | K.LSLKPRSLNEHSSRGVRTRFINSILS*SDKDNGNY*EDGK.K | 4 |
| U | YLR305C | 1 | 1 | 1.9% | 1900 | 214605 | 7.5 | STT4 SGDID:S000004296, Chr XII from 743865-738163, reverse complement, Verified ORF, "Phosphatidylinositol-4-kinase that functions in the Pkc1p protein kinase pathway; required for normal vacuole morphology, cell wall integrity, and actin cytoskeleton organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_59.35832.35832.4 | 3.0749 | 0.1069 | 91.7% | 4235.7764 | 4241.674 | 42 | 3.433 | 18.6% | 1 | K.KHKIDEEMS*KIEVKPDVY*LPSNPDGVVIDIDRKSGK.P | 4 |
| U | YGR281W | 1 | 1 | 1.9% | 1477 | 166727 | 7.7 | YOR1 SGDID:S000003513, Chr VII from 1052830-1057263, Verified ORF, "Plasma membrane transporter of the ATP-binding cassette (ABC) family, mediates export of many different organic anions including oligomycin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_26.24064.24064.4 | 2.8964 | 0.1312 | 92.8% | 3438.5764 | 3433.871 | 376 | 3.523 | 21.0% | 1 | K.KNKKKRKDT*WGKPS*ASTNKAKRLDNMLK.D | 4 |
| U | YIL115C | 1 | 1 | 1.9% | 1460 | 158907 | 4.8 | NUP159 SGDID:S000001377, Chr IX from 148706-144324, reverse complement, Verified ORF, "Subunit of the nuclear pore complex that is found exclusively on the cytoplasmic side, forms a subcomplex with Nup82p and Nsp1p, required for mRNA export" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_30.26858.26858.3 | 2.7643 | 0.1532 | 93.8% | 3353.1543 | 3356.2478 | 159 | 3.828 | 22.2% | 1 | R.QS*SEVKESDDNMSLNSDRDESISES*YDK.L | 3 |
| U | Reverse_YHR080C | 1 | 1 | 1.9% | 1345 | 149679 | 8.7 | YHR080C SGDID:S000001122, Chr VIII from 266840-262803, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_18.19615.19615.3 | 2.477 | 0.1626 | 91.8% | 2853.6843 | 2852.9023 | 9 | 3.668 | 26.0% | 1 | K.EKELAQVSLSPVS*NSNS*NGDQFRGK.L | 3 |
| U | YPL226W | 1 | 2 | 1.9% | 1196 | 134331 | 5.9 | NEW1 SGDID:S000006147, Chr XVI from 121767-125357, Verified ORF, "ATP binding cassette family member; Asn/Gln-rich rich region supports [NU+] prion formation, susceptibility to [PSI+] prion induction and aggregation of a fragment of the human Machado-Joseph Disease protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_12.09490.09490.3 | 3.2728 | 0.2139 | 99.3% | 2587.8542 | 2587.716 | 1 | 5.011 | 30.7% | 2 | K.ERADEDEGIEIVNTDFSLAYGSR.M | 3 |
| U | YLR014C | 1 | 1 | 1.9% | 904 | 102724 | 7.4 | PPR1 SGDID:S000004004, Chr XII from 174981-172267, reverse complement, Verified ORF, "Zinc finger transcription factor containing a Zn(2)-Cys(6) binuclear cluster domain, positively regulates transcription of genes involved in uracil biosynthesis; activity may be modulated by interaction with Tup1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_31.20876.20876.2 | 1.5502 | 0.1341 | 90.6% | 2204.3523 | 2203.213 | 208 | 3.152 | 31.2% | 1 | K.NLIGFCESAKTCY*T*SYK.I | 2 |
| U | YIL095W | 1 | 1 | 1.9% | 810 | 91032 | 9.6 | PRK1 SGDID:S000001357, Chr IX from 183934-186366, Verified ORF, "Protein serine/threonine kinase; regulates the organization and function of the actin cytoskeleton through the phosphorylation of the Pan1p-Sla1p-End3p protein complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_40.24587.24587.2 | 2.1704 | 0.1691 | 98.1% | 1711.6921 | 1713.9291 | 255 | 3.775 | 39.3% | 1 | R.SLSSKLKKVITGES*R.G | 2 |
| U | YKL182W | 2 | 2 | 1.8% | 2051 | 228689 | 5.9 | FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_8.08687.08687.3 | 3.0296 | 0.1791 | 97.7% | 2254.3442 | 2255.4058 | 94 | 5.026 | 30.6% | 1 | K.DSLWQSEHLEAVVDQDVQR.T | 3 |
| * | Jamie_phos_01_itms_24.14735.14735.3 | 3.5777 | 0.0545 | 92.8% | 2146.4043 | 2143.3142 | 5 | 3.321 | 39.1% | 1 | R.SKEWFQLDDEDFDLLNK.T | 3 |
| U | YBR208C | 1 | 1 | 1.8% | 1835 | 201830 | 5.6 | DUR1,2 SGDID:S000000412, Chr II from 642205-636698, reverse complement, Verified ORF, "Urea amidolyase, contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_27.18528.18528.4 | 3.6214 | 0.1061 | 95.2% | 3807.6565 | 3811.024 | 409 | 3.073 | 17.2% | 1 | K.VS*TNILNSYQYEPTAIEIT*LPGAHTSIQDYPGR.V | 4 |
| U | Reverse_YOL100W | 1 | 1 | 1.8% | 1081 | 121660 | 9.6 | PKH2 SGDID:S000005460, Chr XV from 129236-132481, Verified ORF, "Serine/threonine protein kinase involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; redundant with Pkh1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_42.25587.25587.2 | 2.3261 | 0.1767 | 98.6% | 2082.152 | 2082.538 | 121 | 3.962 | 30.6% | 1 | K.IGKKIINKQAKSSEKAIPK.Q | 2 |
| U | YPL183C | 1 | 2 | 1.8% | 1013 | 114461 | 6.2 | YPL183C SGDID:S000006104, Chr XVI from 202535-199494, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_10.09900.09900.2 | 2.9917 | 0.3181 | 100.0% | 2091.2722 | 2092.2207 | 5 | 5.612 | 41.2% | 2 | K.DSADIIETEEFHLDELSK.T | 2 |
| U | YGL201C | 1 | 1 | 1.8% | 1017 | 112978 | 5.2 | MCM6 SGDID:S000003169, Chr VII from 120911-117858, reverse complement, Verified ORF, "Protein involved in DNA replication; component of the Mcm2-7 hexameric complex that binds chromatin as a part of the pre-replicative complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_16.18308.18308.3 | 2.2012 | 0.1668 | 90.8% | 2339.6343 | 2335.7146 | 8 | 3.884 | 33.8% | 1 | R.RYIKYARTFKPILT*KEAR.S | 3 |
| U | YOR335C | 1 | 1 | 1.8% | 958 | 107277 | 5.5 | ALA1 SGDID:S000005862, Chr XV from 949104-946228, reverse complement, Verified ORF, "Cytoplasmic alanyl-tRNA synthetase, required for protein synthesis; point mutation (cdc64-1 allele) causes cell cycle arrest at G1; lethality of null mutation is functionally complemented by human homolog" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_15.13242.13242.2 | 2.1244 | 0.1075 | 92.6% | 1730.3722 | 1732.8906 | 8 | 4.171 | 40.6% | 1 | R.TLTFALADGGVPNNEGR.G | 2 |
| U | YDR096W | 1 | 1 | 1.8% | 894 | 99481 | 7.5 | GIS1 SGDID:S000002503, Chr IV from 637134-639818, Verified ORF, "Transcriptional factor, involved in the expression of genes during nutrient limitation; also involved in the negative regulation of DPP1 and PHR1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_38.31690.31690.4 | 2.7403 | 0.1933 | 97.7% | 1957.2166 | 1952.0629 | 50 | 3.928 | 33.3% | 1 | R.HKKS*VHSGEKPHSCPR.C | 4 |
| U | YHR182W | 1 | 1 | 1.8% | 785 | 90109 | 6.4 | YHR182W SGDID:S000001225, Chr VIII from 468219-470576, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_29.26098.26098.2 | 1.5363 | 0.1771 | 95.6% | 1773.5521 | 1776.0607 | 153 | 3.793 | 42.3% | 1 | K.DYT*TGIKLFIKHMK.R | 2 |
| U | YMR219W | 2 | 2 | 1.7% | 1658 | 187137 | 4.5 | ESC1 SGDID:S000004832, Chr XIII from 707132-712108, Verified ORF, "Protein localized to the nuclear periphery, involved in telomeric silencing; interacts with PAD4-domain of Sir4p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_4.06048.06048.2 | 2.5016 | 0.0845 | 92.7% | 1763.9922 | 1764.884 | 3 | 4.257 | 53.3% | 1 | K.TDRGDLSSSVEIEVEK.V | 2 |
| * | Jamie_phos_01_itms_22.13821.13821.2 | 1.8293 | 0.1504 | 95.8% | 1483.9122 | 1482.4178 | 90 | 3.587 | 45.8% | 1 | K.ITEGS*SAAS*NTKR.R | 2 |
| U | Reverse_YPR189W | 1 | 1 | 1.7% | 1432 | 163725 | 5.4 | SKI3 SGDID:S000006393, Chr XVI from 912660-916958, Verified ORF, "Protein involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs; forms complex with Ski2p and Ski8p; required for repressing propagation of dsRNA viruses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_21.12730.12730.4 | 3.2706 | 0.1261 | 95.1% | 2976.8564 | 2972.5151 | 324 | 2.794 | 25.4% | 1 | K.SLKSSLWSYLIMALPDKPFKKFY*K.I | 4 |
| U | Reverse_YHR079C | 1 | 1 | 1.7% | 1115 | 126976 | 6.6 | IRE1 SGDID:S000001121, Chr VIII from 261593-258246, reverse complement, Verified ORF, "Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_41.28476.28476.3 | 2.719 | 0.2502 | 99.3% | 2629.3442 | 2626.7766 | 81 | 3.909 | 27.8% | 1 | K.S*SHYKRYRELNDMFT*KDFK.V | 3 |
| U | Reverse_YBR235W | 1 | 1 | 1.7% | 1120 | 123999 | 8.5 | YBR235W SGDID:S000000439, Chr II from 686896-690258, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_41.33245.33245.3 | 2.4805 | 0.209 | 96.8% | 2018.0343 | 2017.0739 | 106 | 4.128 | 30.6% | 1 | R.RAS*LLSSSENSSSIASSPR.H | 3 |
| U | YGL016W | 1 | 3 | 1.7% | 1081 | 123531 | 5.0 | KAP122 SGDID:S000002984, Chr VII from 461671-464916, Verified ORF, "Karyopherin beta, responsible for import of the Toa1p-Toa2p complex into the nucleus; binds to nucleoporins Nup1p and Nup2p; may play a role in regulation of pleiotropic drug resistance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_6.08451.08451.2 | 2.3952 | 0.2621 | 100.0% | 2130.652 | 2131.2139 | 1 | 5.871 | 52.9% | 3 | R.IIEEEGESTSVNEFEDFR.N | 2 |
| U | Reverse_YNL014W | 1 | 1 | 1.7% | 1044 | 115868 | 6.2 | HEF3 SGDID:S000004959, Chr XIV from 606320-609454, Verified ORF, "Translational elongation factor EF-3; paralog of YEF3 and member of the ABC superfamily; stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA by the ribosome; normally expressed in zinc deficient cells" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_13.11789.11789.2 | 1.8287 | 0.1773 | 97.1% | 2001.8522 | 2003.3964 | 26 | 3.918 | 32.4% | 1 | K.KRLEASSLKSKKKGSNIK.N | 2 |
| U | Reverse_YOR098C | 1 | 1 | 1.7% | 1076 | 113581 | 9.6 | NUP1 SGDID:S000005624, Chr XV from 511178-507948, reverse complement, Verified ORF, "Nuclear pore complex (NPC) subunit, involved in protein import/export and in export of RNAs, possible karyopherin release factor that accelerates release of karyopherin-cargo complexes after transport across NPC; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_25.23579.23579.2 | 1.7606 | 0.1771 | 96.8% | 1964.1522 | 1966.9734 | 60 | 3.928 | 35.3% | 1 | K.IPSPTSSTCLYSGGEDS*K.S | 2 |
| U | YIL038C | 1 | 1 | 1.7% | 836 | 94403 | 5.6 | NOT3 SGDID:S000001300, Chr IX from 282651-280141, reverse complement, Verified ORF, "Subunit of the CCR4-NOT complex, which is a global transcriptional regulator with roles in transcription initiation and elongation and in mRNA degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_6.04236.04236.4 | 2.9648 | 0.1352 | 96.2% | 1819.7765 | 1825.2112 | 375 | 3.451 | 35.9% | 1 | K.REVKKLQRLREQIK.S | 4 |
| U | YOR014W | 1 | 1 | 1.7% | 757 | 85335 | 6.3 | RTS1 SGDID:S000005540, Chr XV from 357673-359946, Verified ORF, "B-type regulatory subunit of protein phosphatase 2A (PP2A); homolog of the mammalian B' subunit of PP2A" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_17.10574.10574.2 | 1.8889 | 0.1711 | 97.3% | 1350.7322 | 1352.355 | 8 | 3.987 | 58.3% | 1 | K.TTGSSS*SSSSKKK.D | 2 |
| U | Reverse_YDL138W | 1 | 1 | 1.7% | 763 | 83159 | 6.0 | RGT2 SGDID:S000002297, Chr IV from 213352-215643, Verified ORF, "Plasma membrane glucose receptor, highly similar to Snf3p; both Rgt2p and Snf3p serve as transmembrane glucose sensors generating an intracellular signal that induces expression of glucose transporter (HXT) genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_55.33269.33269.2 | 1.5911 | 0.1565 | 94.3% | 1594.0521 | 1593.8475 | 8 | 4.011 | 50.0% | 1 | K.MEIQQSIPFALCR.K | 2 |
| U | Reverse_YDL031W | 1 | 1 | 1.6% | 995 | 113158 | 9.3 | DBP10 SGDID:S000002189, Chr IV from 394214-397201, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box protein family, constituent of 66S pre-ribosomal particles; essential protein involved in ribosome biogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_16.18100.18100.2 | 1.6294 | 0.1323 | 91.1% | 1868.7722 | 1867.2515 | 11 | 3.795 | 46.7% | 1 | K.KSPRANKARKKEAIIR.D | 2 |
| U | Reverse_YGR140W | 1 | 1 | 1.6% | 956 | 111917 | 6.2 | CBF2 SGDID:S000003372, Chr VII from 767434-770304, Verified ORF, "Essential kinetochore protein, component of the CBF3 multisubunit complex that binds to the CDEIII region of the centromere; Cbf2p also binds to the CDEII region possibly forming a different multimeric complex, ubiquitinated in vivo" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_27.16557.16557.2 | 1.8939 | 0.1023 | 90.0% | 1849.9722 | 1848.97 | 146 | 3.64 | 35.7% | 1 | R.LFKALRSFS*GENQDR.L | 2 |
| U | Reverse_YGL233W | 1 | 1 | 1.6% | 910 | 105064 | 4.9 | SEC15 SGDID:S000003202, Chr VII from 59122-61854, Verified ORF, "Essential 113kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which mediates polarized targeting of vesicles to active sites of exocytosis; Sec15p associates with Sec4p and vesicles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_25.23590.23590.2 | 1.6987 | 0.1244 | 90.6% | 1968.2322 | 1971.1742 | 5 | 3.728 | 42.9% | 1 | R.YFISLFAT*IKS*YTKK.A | 2 |
| U | Reverse_YER184C | 1 | 1 | 1.6% | 794 | 91077 | 7.8 | YER184C SGDID:S000000986, Chr V from 558675-556291, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_30.20414.20414.2 | 1.6663 | 0.1326 | 91.6% | 1386.2722 | 1388.5205 | 1 | 3.708 | 54.2% | 1 | K.QLS*APASPPLQAK.L | 2 |
| U | Reverse_YJR092W | 1 | 1 | 1.5% | 1448 | 165023 | 5.0 | BUD4 SGDID:S000003852, Chr X from 598649-602995, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_12.07704.07704.4 | 3.2089 | 0.1153 | 94.4% | 2378.6165 | 2382.8113 | 274 | 3.625 | 25.8% | 1 | K.GFFSKGVPVKDVIEVLEHRPK.E | 4 |
| U | YGR270W | 1 | 1 | 1.5% | 1379 | 157406 | 5.2 | YTA7 SGDID:S000003502, Chr VII from 1027376-1031515, Verified ORF, "Protein of unknown function, member of CDC48/PAS1/SEC18 family of ATPases, potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_11.07205.07205.3 | 3.0021 | 0.1465 | 95.6% | 2600.0044 | 2600.4648 | 1 | 4.093 | 31.2% | 1 | R.SRTRHSRT*SNEENDDENDNSR.N | 3 |
| U | YDR074W | 1 | 1 | 1.5% | 896 | 102976 | 8.1 | TPS2 SGDID:S000002481, Chr IV from 593889-596579, Verified ORF, "Phosphatase subunit of the trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_33.21783.21783.2 | 1.49 | 0.1354 | 90.2% | 1555.9722 | 1558.6635 | 49 | 3.786 | 45.8% | 1 | -.MTTTAQDNS*PKKR.Q | 2 |
| U | Reverse_YNR011C | 1 | 1 | 1.5% | 876 | 99813 | 8.4 | PRP2 SGDID:S000005294, Chr XIV from 646952-644322, reverse complement, Verified ORF, "RNA-dependent ATPase in the DEAH-box family, required for activation of the spliceosome before the first transesterification step in RNA splicing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07573.07573.2 | 1.7288 | 0.1432 | 94.1% | 1573.2122 | 1572.774 | 4 | 3.893 | 58.3% | 1 | K.TRSGLKS*MIEELK.T | 2 |
| U | YCL054W | 1 | 1 | 1.5% | 841 | 96485 | 8.0 | SPB1 SGDID:S000000559, Chr III from 31449-33974, Verified ORF, "AdoMet-dependent methyltransferase involved in rRNA processing and 60S ribosomal subunit maturation; methylates G2922 in the putative tRNA docking site of the large subunit rRNA and in the absence of snR52, U2921; suppressor of PAB1 mutants" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_13.08276.08276.2 | 1.7867 | 0.1958 | 98.1% | 1424.6322 | 1427.6005 | 145 | 3.984 | 45.8% | 1 | K.LKGQEGDHKLSSK.A | 2 |
| U | Reverse_YCL014W | 1 | 1 | 1.4% | 1636 | 184718 | 6.2 | BUD3 SGDID:S000000520, Chr III from 96280-101190, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_18.11084.11084.4 | 3.3975 | 0.1014 | 93.9% | 2762.2166 | 2767.0898 | 206 | 2.962 | 25.0% | 1 | K.PSSKKES*TMPKKVPS*KPHRQSIK.K | 4 |
| U | Reverse_YOR116C | 1 | 1 | 1.4% | 1460 | 162301 | 8.2 | RPO31 SGDID:S000005642, Chr XV from 544145-539763, reverse complement, Verified ORF, "RNA polymerase III subunit C160, part of core enzyme; similar to bacterial beta-prime subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_7.08025.08025.2 | 1.3751 | 0.2633 | 98.8% | 2323.9922 | 2324.6575 | 30 | 3.912 | 26.3% | 1 | R.T*IGLVEGKYTMVDGLLQIHR.P | 2 |
| U | YHR155W | 1 | 1 | 1.4% | 1228 | 143583 | 8.1 | YSP1 SGDID:S000001198, Chr VIII from 407106-410792, Uncharacterized ORF, "Mitochondrial protein with a potential role in promoting mitochondrial fragmentation during programmed cell death in response to high levels of alpha-factor mating pheromone or the drug amiodarone" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_24.23147.23147.2 | 2.0737 | 0.2984 | 90.0% | 1950.9122 | 1952.8999 | 55 | 5.053 | 40.6% | 1 | K.S*ISNGNNSEEKGLS*GWL.Y | 2 |
| U | YPL137C | 1 | 1 | 1.4% | 1276 | 140891 | 7.4 | YPL137C SGDID:S000006058, Chr XVI from 296646-292816, reverse complement, Uncharacterized ORF, "Glc7-interacting protein whose overexpression relocalizes Glc7p from the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_14.17249.17249.2 | 1.8189 | 0.2132 | 98.9% | 1727.2322 | 1729.8418 | 118 | 4.48 | 32.4% | 1 | R.LAS*SAINATASSSVGKGK.H | 2 |
| U | Reverse_YDR128W | 1 | 1 | 1.4% | 1148 | 130946 | 5.9 | YDR128W SGDID:S000002535, Chr IV from 709544-712990, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_49.31944.31944.2 | 1.9091 | 0.2338 | 99.5% | 1908.2322 | 1910.9976 | 93 | 4.395 | 36.7% | 1 | K.VQSAASRWSSTS*YFPR.H | 2 |
| U | YKL092C | 1 | 1 | 1.4% | 1104 | 126663 | 8.8 | BUD2 SGDID:S000001575, Chr XI from 269103-265789, reverse complement, Verified ORF, "GTPase activating factor for Rsr1p/Bud1p required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_44.32981.32981.2 | 1.9457 | 0.1622 | 96.8% | 1946.0322 | 1948.9988 | 197 | 3.903 | 33.3% | 1 | K.IDGT*VS*RINQKNLDSK.H | 2 |
| U | YDL185W | 1 | 1 | 1.4% | 1071 | 118637 | 6.2 | TFP1 SGDID:S000002344, Chr IV from 126788-130003, Verified ORF, "Vacuolar ATPase V1 domain subunit A containing the catalytic nucleotide binding sites; protein precursor undergoes self-catalyzed splicing to yield the extein Tfp1p and the intein Vde (PI-SceI), which is a site-specific endonuclease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_13.10222.10222.2 | 1.9622 | 0.1454 | 95.8% | 1675.3322 | 1676.9596 | 327 | 3.495 | 39.3% | 1 | K.TVNLYSKVVRGNGIR.N | 2 |
| U | Reverse_YDL171C | 1 | 1 | 1.3% | 2145 | 238100 | 6.6 | GLT1 SGDID:S000002330, Chr IV from 155641-149204, reverse complement, Verified ORF, "NAD(+)-dependent glutamate synthase (GOGAT), synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_52.31598.31598.3 | 3.0472 | 0.1739 | 96.7% | 3305.0645 | 3302.536 | 2 | 4.014 | 24.0% | 1 | R.RAIET*WPEVQELPIS*VSNEFDLELLGR.L | 3 |
| U | Reverse_YOR153W | 1 | 1 | 1.3% | 1511 | 170438 | 7.8 | PDR5 SGDID:S000005679, Chr XV from 619840-624375, Verified ORF, "Short-lived membrane ABC (ATP-binding cassette) transporter, actively exports various drugs, expression regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_18.11380.11380.2 | 1.7237 | 0.1623 | 95.6% | 2025.0122 | 2027.3898 | 11 | 3.969 | 38.9% | 1 | K.DRPIGNVLIDGTIVGMTVR.E | 2 |
| U | YMR129W | 1 | 3 | 1.3% | 1337 | 151652 | 6.7 | POM152 SGDID:S000004736, Chr XIII from 527803-531816, Verified ORF, "Nuclear pore membrane glycoprotein; may be involved in duplication of nuclear pores and nuclear pore complexes during S-phase;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07951.07951.2 | 3.615 | 0.3743 | 100.0% | 2166.7322 | 2167.247 | 1 | 6.663 | 47.1% | 3 | R.TDQYTIDNIDSENFSFEK.L | 2 |
| U | YER129W | 1 | 1 | 1.3% | 1142 | 126872 | 8.7 | SAK1 SGDID:S000000931, Chr V from 417277-420705, Verified ORF, "Upstream kinase for the SNF1 complex; partially redundant function with Elm1p and Tos3p; members of this family of kinases have functional orthology with LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_14.16902.16902.2 | 1.928 | 0.1665 | 96.9% | 1748.3121 | 1746.788 | 53 | 3.901 | 42.9% | 1 | R.S*PVFSGVT*NQPSPIR.P | 2 |
| U | Reverse_YOL087C | 1 | 1 | 1.3% | 1116 | 125382 | 6.7 | YOL087C SGDID:S000005447, Chr XV from 158636-155286, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_28.17399.17399.2 | 2.0643 | 0.1467 | 96.4% | 1734.3322 | 1731.7734 | 9 | 3.769 | 50.0% | 1 | R.S*LLSGSSQTRFY*PK.K | 2 |
| U | YHR165C | 1 | 1 | 1.2% | 2413 | 279502 | 7.3 | PRP8 SGDID:S000001208, Chr VIII from 436950-429709, reverse complement, Verified ORF, "Component of the U4/U6-U5 snRNP complex, involved in the second catalytic step of splicing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_18.11480.11480.4 | 3.3128 | 0.0963 | 92.0% | 3420.9365 | 3420.035 | 59 | 3.351 | 22.2% | 1 | R.KRAKKMTKKAKRSNLYT*PKAEMPPEHLR.K | 4 |
| U | YNL271C | 1 | 1 | 1.2% | 1953 | 219701 | 6.5 | BNI1 SGDID:S000005215, Chr XIV from 135384-129523, reverse complement, Verified ORF, "Formin, nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables, functionally redundant with BNR1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_14.08895.08895.3 | 2.7214 | 0.1538 | 93.9% | 2648.2444 | 2650.9778 | 359 | 3.417 | 25.0% | 1 | K.LTIMEFESLMHTYGEDSGDKFAK.I | 3 |
| U | YOR341W | 1 | 2 | 1.2% | 1664 | 186431 | 7.1 | RPA190 SGDID:S000005868, Chr XV from 960982-965976, Verified ORF, "RNA polymerase I subunit; largest subunit of RNA polymerase I" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_4.04975.04975.2 | 3.2713 | 0.4083 | 100.0% | 2140.4922 | 2141.1692 | 2 | 6.474 | 42.1% | 2 | K.KLDGSNEASANDEESFDVGR.N | 2 |
| U | YLR384C | 1 | 1 | 1.2% | 1349 | 152990 | 5.1 | IKI3 SGDID:S000004376, Chr XII from 892900-888851, reverse complement, Verified ORF, "Subunit of RNA polymerase II elongator histone acetyltransferase complex, involved in maintaining its structural integrity; negatively regulates exocytosis independent of transcription, homolog of human familial dysautonomia (FD) protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_32.23301.23301.2 | 1.5071 | 0.1817 | 95.6% | 1610.5922 | 1612.7861 | 1 | 3.822 | 43.3% | 1 | R.YTGKTGGTAKTGASRR.T | 2 |
| U | Reverse_YBL047C | 1 | 1 | 1.2% | 1381 | 150783 | 4.7 | EDE1 SGDID:S000000143, Chr II from 132043-127898, reverse complement, Verified ORF, "Key endocytic protein involved in a network of interactions with other endocytic proteins, binds membranes in a ubiquitin-dependent manner, may also bind ubiquitinated membrane-associated proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_32.19890.19890.2 | 1.9374 | 0.1687 | 96.9% | 1675.4122 | 1672.7465 | 30 | 3.537 | 46.7% | 1 | R.TLSSVGTSNASLPTT*R.N | 2 |
| U | YOL078W | 1 | 1 | 1.2% | 1176 | 131378 | 6.7 | AVO1 SGDID:S000005438, Chr XV from 181681-185211, Verified ORF, "Component of a membrane-bound complex containing the Tor2p kinase and other proteins, which may have a role in regulation of cell growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_26.16209.16209.2 | 1.6471 | 0.1233 | 90.6% | 1503.2922 | 1500.5222 | 218 | 3.343 | 42.3% | 1 | R.ESSNGNIGSAS*RLK.S | 2 |
| U | Reverse_YER176W | 1 | 1 | 1.2% | 1121 | 126970 | 9.4 | ECM32 SGDID:S000000978, Chr V from 541685-545050, Verified ORF, "DNA dependent ATPase/DNA helicase belonging to the Dna2p- and Nam7p-like family of helicases that is involved in modulating translation termination; interacts with the translation termination factors, localized to polysomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_24.16872.16872.2 | 1.9957 | 0.1194 | 93.5% | 1760.4722 | 1761.8466 | 4 | 3.784 | 46.2% | 1 | K.S*KENLT*PKSAKKNR.N | 2 |
| U | YPL231W | 1 | 1 | 1.1% | 1887 | 206945 | 5.4 | FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_16.09886.09886.3 | 3.4292 | 0.1888 | 99.0% | 2430.2644 | 2429.6482 | 1 | 4.453 | 32.5% | 1 | K.HQHGDKVDIFEIPETGEYSVK.L | 3 |
| U | YCL014W | 1 | 1 | 1.1% | 1636 | 184718 | 6.2 | BUD3 SGDID:S000000520, Chr III from 96280-101190, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_34.21108.21108.2 | 1.8295 | 0.1256 | 92.3% | 1955.4722 | 1958.0055 | 6 | 3.269 | 35.3% | 1 | R.AVNSKLS*GASDFDATHEK.K | 2 |
| U | YGL173C | 1 | 2 | 1.1% | 1528 | 175459 | 7.5 | KEM1 SGDID:S000003141, Chr VII from 180119-175533, reverse complement, Verified ORF, "5'-3' exonuclease involved in mRNA decay, evolutionarily conserved component of cytoplasmic processing (P) bodies, plays a role in microtubule-mediated processes, filamentous growth, and ribosomal RNA maturation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_5.05626.05626.2 | 2.2771 | 0.1482 | 97.3% | 2051.3123 | 2052.2427 | 25 | 3.532 | 43.8% | 2 | K.YQNAIIVEDKEELETEK.T | 2 |
| U | YBL079W | 1 | 1 | 1.1% | 1502 | 169474 | 6.1 | NUP170 SGDID:S000000175, Chr II from 75256-79764, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_35.21675.21675.2 | 2.5405 | 0.312 | 100.0% | 1873.5922 | 1873.1107 | 64 | 5.857 | 34.4% | 1 | K.NATALLEQIVDDLSIEK.L | 2 |
| U | YKL010C | 1 | 1 | 1.1% | 1483 | 167842 | 4.9 | UFD4 SGDID:S000001493, Chr XI from 425518-421067, reverse complement, Verified ORF, "Ubiquitin-protein ligase (E3) that interacts with Rpt4p and Rpt6p, two subunits of the 19S particle of the 26S proteasome; cytoplasmic E3 involved in the degradation of ubiquitin fusion proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18256.18256.2 | 1.9274 | 0.113 | 91.7% | 1936.6122 | 1937.204 | 24 | 3.37 | 40.0% | 1 | R.IS*RKTIFATGLKILS*K.Y | 2 |
| U | YMR261C | 1 | 1 | 1.1% | 1054 | 118835 | 6.4 | TPS3 SGDID:S000004874, Chr XIII from 793368-790204, reverse complement, Verified ORF, "Regulatory subunit of trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_44.32990.32990.2 | 1.834 | 0.1444 | 95.6% | 1654.3121 | 1652.8192 | 14 | 4.033 | 50.0% | 1 | K.EYKRHFLQTCNR.L | 2 |
| U | YDR311W | 1 | 1 | 1.1% | 642 | 72895 | 6.9 | TFB1 SGDID:S000002719, Chr IV from 1085060-1086988, Verified ORF, "Subunit of TFIIH and nucleotide excision repair factor 3 complexes, required for nucleotide excision repair, target for transcriptional activators" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_46.31679.31679.1 | 1.0276 | 0.1171 | 100.0% | 788.6 | 787.7587 | 202 | 4.255 | 50.0% | 1 | K.S*SADSIK.N | 1 |
| U | Reverse_YLR087C | 1 | 1 | 0.9% | 2958 | 338258 | 5.9 | CSF1 SGDID:S000004077, Chr XII from 315732-306856, reverse complement, Verified ORF, "Protein required for fermentation at low temperature" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_04_itms_24.21196.21196.3 | 2.8192 | 0.1973 | 97.3% | 3075.5044 | 3079.1797 | 261 | 4.065 | 20.2% | 1 | K.ADGASAKYLSLGKWKHY*FNDDST*GASK.K | 3 |
| U | YBL004W | 1 | 1 | 0.9% | 2493 | 287559 | 7.0 | UTP20 SGDID:S000000100, Chr II from 227639-235120, Uncharacterized ORF, "Possible snoRNA-binding protein, based on computational analysis of large-scale protein-protein interaction data" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_10.14386.14386.3 | 2.8151 | 0.1441 | 94.0% | 2615.6643 | 2619.8293 | 413 | 3.735 | 26.2% | 1 | K.VS*PS*TSSELCQMGLKFLSAFIR.H | 3 |
| U | Reverse_YJR066W | 1 | 1 | 0.9% | 2470 | 281138 | 7.2 | TOR1 SGDID:S000003827, Chr X from 559330-566742, Verified ORF, "PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_15.09519.09519.3 | 3.3277 | 0.1729 | 97.8% | 2474.0645 | 2472.884 | 2 | 3.465 | 28.4% | 1 | K.VYPAIDPGVEYAIDGISILIQPK.D | 3 |
| U | Reverse_YJL130C | 1 | 1 | 0.9% | 2214 | 245124 | 5.9 | URA2 SGDID:S000003666, Chr X from 172285-165641, reverse complement, Verified ORF, "Bifunctional carbamoylphosphate synthetase (CPSase)-aspartate transcarbamylase (ATCase), catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_33.20433.20433.3 | 2.7699 | 0.1111 | 90.3% | 2433.6843 | 2433.566 | 264 | 3.328 | 28.9% | 1 | R.S*FKYRNEASDIMDPST*GLIK.V | 3 |
| U | YMR229C | 1 | 1 | 0.9% | 1729 | 193133 | 6.2 | RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_30.18178.18178.2 | 2.7551 | 0.138 | 98.2% | 1888.9722 | 1888.035 | 9 | 3.948 | 43.3% | 1 | R.VDIAEVFDTYEEITDK.K | 2 |
| U | YDR093W | 1 | 1 | 0.9% | 1612 | 182617 | 6.2 | DNF2 SGDID:S000002500, Chr IV from 631277-636115, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_17.19033.19033.2 | 1.8197 | 0.1338 | 93.2% | 1872.6322 | 1872.9034 | 76 | 3.526 | 35.7% | 1 | R.RDQLS*PVTT*TNNLPR.R | 2 |
| U | Reverse_YPL242C | 1 | 1 | 0.9% | 1495 | 172830 | 8.9 | IQG1 SGDID:S000006163, Chr XVI from 95109-90622, reverse complement, Verified ORF, "Essential protein required for determination of budding pattern, promotes localization of axial markers Bud4p and Cdc12p and functionally interacts with Sec3p, localizes to the contractile ring during anaphase, member of the IQGAP family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_23.14271.14271.2 | 1.7101 | 0.1763 | 96.6% | 1695.7522 | 1698.7007 | 122 | 4.015 | 42.3% | 1 | R.Y*ASADLELTVRGS*R.P | 2 |
| U | Reverse_YCR032W | 1 | 1 | 0.7% | 2167 | 250870 | 6.5 | BPH1 SGDID:S000000628, Chr III from 179515-186018, Verified ORF, "Protein homologous to human Chediak-Higashi syndrome protein and murine beige gene, which are implicated in disease syndromes due to defective lysosomal trafficking" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_02_itms_9.07395.07395.2 | 1.7292 | 0.1387 | 92.5% | 1874.0521 | 1871.1528 | 3 | 4.063 | 42.9% | 1 | K.FDLSTNDKRFLILCK.K | 2 |
| U | Reverse_YIL129C | 1 | 1 | 0.6% | 2376 | 269856 | 6.3 | TAO3 SGDID:S000001391, Chr IX from 113237-106107, reverse complement, Verified ORF, "Protein involved in cell morphogenesis and proliferation, associated with protein kinase Cbk1p; mutants activate OCH1 transcription" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_03_itms_18.15208.15208.2 | 1.6572 | 0.1232 | 90.1% | 1917.7922 | 1920.0613 | 263 | 3.143 | 32.1% | 1 | R.S*IFS*VVQSMFDKKSR.F | 2 |
| U | Reverse_YBR275C | 1 | 1 | 0.6% | 1916 | 217959 | 6.6 | RIF1 SGDID:S000000479, Chr II from 757101-751351, reverse complement, Verified ORF, "Protein that binds to the Rap1p C-terminus and acts synergistically with Rif2p to help control telomere length and establish telomeric silencing; deletion results in telomere elongation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_10.06419.06419.2 | 1.862 | 0.0997 | 90.3% | 1432.7522 | 1431.6322 | 85 | 3.948 | 45.5% | 1 | K.IQQTLLHGIT*VK.D | 2 |
| U | YJL109C | 1 | 1 | 0.6% | 1769 | 200080 | 6.5 | UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_01_itms_10.06210.06210.2 | 1.7155 | 0.1113 | 90.6% | 1397.2322 | 1399.4172 | 105 | 3.536 | 50.0% | 1 | R.RSS*TS*KNAFLK.E | 2 |
| U | YKR054C | 1 | 1 | 0.4% | 4092 | 471351 | 6.3 | DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_phos_05_itms_16.18128.18128.2 | 1.7685 | 0.2072 | 98.4% | 1983.2322 | 1984.9884 | 203 | 4.151 | 34.4% | 1 | K.RS*LLYALAGDSTGES*QR.A | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 11783 | 308104 | 336362 |
| Filtered | 478 | 882 | 1713 |
| Forward matches | 326 | 727 | 1555 |
| Decoy matches | 152 | 155 | 158 |
| Forward FP rate | 46.63% | 21.32% | 10.16% |