| * | STY | 80.0 |
| # | X | 0.0 |
| @ | X | 0.0 |
| Static | C | 57.0 |
| true | Use criteria |
| 0.0 | Minimum peptide confidence |
| 0.1 | Peptide false positive rate |
| 0.0 | Minimum protein confidence |
| 1.0 | Protein false positive rate |
| 1 | Minimum charge state |
| 16 | Maximum charge state |
| 0.0 | Minimum ion proportion |
| 1000 | Maximum Sp rank |
| -1.0 | Minimum Sp score |
| Include | Modified peptide inclusion |
| Any | Tryptic status requirement |
| false | Multiple, ambiguous IDs allowed |
| Ignore | Peptide validation handling |
| XCorr | Purge duplicate peptides by protein |
| false | Include only loci with unique peptide |
| true | Remove subset proteins |
| Ignore | Locus validation handling |
| con | Exclude protein names matching |
| 0 | Minimum modified peptides per locus |
| 1000 | Minimum redundancy for low coverage loci |
| 1 | Minimum peptides per locus |
| Validation Status | Locus | Sequence Count | Spectrum Count | Sequence Coverage | Length | MolWt | pI | Descriptive Name |
| Locus | # of identical peptides | # of differing peptides |
| U | YGR192C | 14 | 92 | 53.9% | 332 | 35747 | 7.0 | TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YEL026W | 3 | 7 | 49.2% | 126 | 13569 | 7.9 | SNU13 SGDID:S000000752, Chr V from 101943-102323, Verified ORF, "RNA binding protein, part of U3 snoRNP involved in rRNA processing, part of U4/U6-U5 tri-snRNP involved in mRNA splicing, similar to human 15.5K protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19787.19787.2 | 4.106 | 0.3758 | 100.0% | 2568.392 | 2567.948 | 1 | 6.234 | 41.3% | 4 | K.AFPLADAALTQQILDVVQQAANLR.Q | 2 |
| * | Jamie_FT_01_itms_36.21599.21599.2 | 2.6762 | 0.2087 | 100.0% | 3242.5522 | 3241.7397 | 9 | 4.494 | 22.2% | 1 | R.GISEFIIMAADCEPIEILLHLPLLCEDK.N | 2 |
| * | Jamie_FT_01_itms_35.20987.20987.3 | 5.0753 | 0.3501 | 100.0% | 4403.7544 | 4401.093 | 1 | 6.197 | 24.3% | 2 | R.GISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSR.V | 3 |
| U | YJR009C | 12 | 57 | 45.5% | 332 | 35847 | 7.0 | TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " |
| U | YLR044C | 18 | 93 | 44.4% | 563 | 61495 | 6.2 | PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" |
| U | YOR369C | 4 | 16 | 43.4% | 143 | 15472 | 4.7 | RPS12 SGDID:S000005896, Chr XV from 1028621-1028190, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to rat ribosomal protein S12" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_31.18427.18427.2 | 3.6882 | 0.2805 | 100.0% | 2474.152 | 2472.7954 | 1 | 5.279 | 42.9% | 1 | Q.EETVVEQTAEVTIEDALKVVLR.T | 2 |
| * | Jamie_FT_01_itms_37.21981.21981.4 | 5.8243 | 0.3013 | 100.0% | 4227.6567 | 4229.004 | 1 | 5.342 | 23.1% | 3 | K.ALTRGEALLVVLVSSVTEANIIKLVEGLANDPENKVPLIK.V | 4 |
| * | Jamie_FT_02_itms_19.14555.14555.3 | 6.5451 | 0.4668 | 100.0% | 1956.0243 | 1956.3306 | 1 | 8.717 | 52.8% | 6 | R.GEALLVVLVSSVTEANIIK.L | 3 |
| * | Jamie_FT_02_itms_19.14520.14520.2 | 4.9582 | 0.2775 | 100.0% | 1958.1721 | 1956.3306 | 1 | 6.456 | 61.1% | 6 | R.GEALLVVLVSSVTEANIIK.L | 2 |
| U | YBR010W | 4 | 12 | 37.5% | 136 | 15356 | 11.4 | HHT1 SGDID:S000000214, Chr II from 256329-256739, Verified ORF, "One of two identical histone H3 proteins (see also HHT2); core histone required for chromatin assembly, involved in heterochromatin-mediated telomeric and HM silencing; regulated by acetylation, methylation, and mitotic phosphorylation" |
| U | YNL031C | 4 | 12 | 37.5% | 136 | 15356 | 11.4 | HHT2 SGDID:S000004976, Chr XIV from 576051-575641, reverse complement, Verified ORF, "One of two identical histone H3 proteins (see also HHT1); core histone required for chromatin assembly, involved in heterochromatin-mediated telomeric and HM silencing; regulated by acetylation, methylation, and mitotic phosphorylation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_33.19731.19731.2 | 2.288 | 0.0686 | 96.2% | 2048.112 | 2046.2052 | 6 | 2.909 | 38.9% | 1 | R.KQLAS*KAARKSAPST*GGVK.K | 2 | |
| Jamie_FT_01_itms_36.21305.21305.3 | 8.2153 | 0.5385 | 100.0% | 3423.8342 | 3424.832 | 1 | 9.02 | 34.7% | 5 | R.FQSSAIGALQESVEAYLVSLFEDTNLAAIHAK.R | 3 | |
| Jamie_FT_01_itms_36.21191.21191.4 | 5.7839 | 0.432 | 100.0% | 3425.0166 | 3424.832 | 1 | 7.744 | 28.5% | 2 | R.FQSSAIGALQESVEAYLVSLFEDTNLAAIHAK.R | 4 | |
| Jamie_FT_01_itms_36.21300.21300.2 | 4.9064 | 0.4016 | 100.0% | 3426.2922 | 3424.832 | 1 | 7.46 | 35.5% | 4 | R.FQSSAIGALQESVEAYLVSLFEDTNLAAIHAK.R | 2 |
| U | Reverse_YHR141C | 1 | 1 | 36.8% | 106 | 12212 | 10.6 | RPL42B SGDID:S000001183, Chr VIII from 382754-382751,382309-381993, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl42Ap and has similarity to rat L44; required for propagation of the killer toxin-encoding M1 double-stranded RNA satellite of the L-A double-stranded RNA virus" |
| U | Reverse_YNL162W | 1 | 1 | 36.8% | 106 | 12212 | 10.6 | RPL42A SGDID:S000005106, Chr XIV from 331324-331327,331840-332156, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl42Bp and has similarity to rat L44 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_44.26209.26209.4 | 2.8146 | 0.1722 | 96.2% | 4883.0566 | 4877.3726 | 13 | 4.175 | 18.0% | 1 | R.DY*RRKGQAFLSAKGAKYQT*VKHQTHKRCTKGKCYTKRTK.P | 4 |
| U | YHR174W | 14 | 40 | 35.0% | 437 | 46914 | 6.0 | ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" |
| U | YBR109C | 2 | 22 | 34.0% | 147 | 16135 | 4.3 | CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17825.17825.3 | 5.6228 | 0.4311 | 100.0% | 4109.2744 | 4109.526 | 1 | 8.155 | 27.8% | 14 | R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q | 3 |
| * | Jamie_FT_01_itms_16.09054.09054.2 | 3.9393 | 0.3013 | 100.0% | 1511.3922 | 1510.5975 | 1 | 6.44 | 66.7% | 8 | K.SNDSEQELLEAFK.V | 2 |
| U | YAL038W | 13 | 55 | 33.8% | 500 | 54545 | 7.7 | CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" |
| U | YPL131W | 8 | 21 | 33.0% | 297 | 33715 | 6.8 | RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19452.19452.4 | 4.0634 | 0.0751 | 96.3% | 5887.2163 | 5891.6274 | 3 | 3.583 | 14.3% | 1 | R.LVTQHKAKY*NT*PKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSHELPR.Y | 4 |
| * | Jamie_FT_01_itms_33.19395.19395.4 | 3.9369 | 0.1026 | 97.2% | 5894.3364 | 5891.6274 | 1 | 3.539 | 14.3% | 1 | R.LVT*QHKAKY*NTPKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSHELPR.Y | 4 |
| * | Jamie_FT_01_itms_30.17772.17772.3 | 6.4109 | 0.5025 | 100.0% | 3438.6243 | 3434.8804 | 1 | 8.819 | 32.5% | 2 | R.FTNKDIICQIISSTITGDVVLAAAYSHELPR.Y | 3 |
| * | Jamie_FT_02_itms_21.15683.15683.3 | 4.2721 | 0.3079 | 100.0% | 2943.6543 | 2944.3208 | 1 | 6.381 | 27.9% | 6 | K.DIICQIISSTITGDVVLAAAYSHELPR.Y | 3 |
| * | Jamie_FT_01_itms_33.19452.19452.2 | 4.5799 | 0.5085 | 100.0% | 2944.112 | 2944.3208 | 1 | 9.305 | 40.4% | 1 | K.DIICQIISSTITGDVVLAAAYSHELPR.Y | 4 |
| * | Jamie_FT_01_itms_23.13682.13682.3 | 3.7857 | 0.1883 | 99.6% | 2335.2544 | 2334.6829 | 86 | 4.731 | 26.2% | 3 | R.YGITHGLTNWAAAYATGLLIAR.R | 3 |
| * | Jamie_FT_01_itms_15.08783.08783.2 | 2.6624 | 0.0795 | 99.4% | 1062.2322 | 1061.2694 | 2 | 4.331 | 93.8% | 6 | K.VFLDIGLQR.T | 2 |
| * | Jamie_FT_01_itms_23.13579.13579.2 | 3.1291 | 0.0875 | 99.6% | 2095.3523 | 2094.285 | 1 | 4.309 | 50.0% | 1 | R.FPGWDFETEEIDPELLR.S | 2 |
| U | Reverse_YGL032C | 1 | 1 | 32.2% | 87 | 9464 | 7.1 | AGA2 SGDID:S000003000, Chr VII from 436838-436575, reverse complement, Verified ORF, "Adhesion subunit of a-agglutinin of a-cells, C-terminal sequence acts as a ligand for alpha-agglutinin (Sag1p) during agglutination, modified with O-linked oligomannosyl chains, linked to anchorage subunit Aga1p via two disulfide bonds" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13554.13554.3 | 2.7754 | 0.1287 | 93.1% | 3194.6943 | 3192.3025 | 75 | 3.501 | 20.4% | 1 | -.FVYQTNIPSGKSTTSPHSGCNS*VFTVS*K.Y | 3 |
| U | YBL002W | 3 | 4 | 32.1% | 131 | 14237 | 10.1 | HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" |
| U | YDR224C | 3 | 4 | 32.1% | 131 | 14252 | 10.1 | HTB1 SGDID:S000002632, Chr IV from 914706-914311, reverse complement, Verified ORF, "One of two nearly identical (see HTB2) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_02_itms_5.05848.05848.2 | 2.2142 | 0.1746 | 99.6% | 1508.6522 | 1508.758 | 1 | 4.074 | 61.5% | 1 | R.IATEASKLAAYNKK.S | 2 | |
| Jamie_FT_01_itms_12.07094.07094.2 | 1.867 | 0.0456 | 92.6% | 955.1922 | 954.19794 | 244 | 2.951 | 56.2% | 1 | R.LILPGELAK.H | 2 | |
| Jamie_FT_02_itms_5.05784.05784.2 | 2.2296 | 0.2296 | 100.0% | 1980.5322 | 1981.1295 | 1 | 4.611 | 41.7% | 2 | K.HAVSEGTRAVTKYSSSTQA.- | 2 |
| U | YBL003C | 3 | 10 | 28.8% | 132 | 13989 | 10.7 | HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| U | YDR225W | 3 | 10 | 28.8% | 132 | 13989 | 10.7 | HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_11.06479.06479.2 | 2.272 | 0.1141 | 99.5% | 918.8522 | 918.0837 | 48 | 4.12 | 75.0% | 1 | K.AGLTFPVGR.V | 2 | |
| Jamie_FT_01_itms_49.29285.29285.3 | 5.3658 | 0.426 | 100.0% | 2948.1843 | 2947.4014 | 1 | 8.105 | 31.2% | 2 | R.IGSGAPVYLTAVLEYLAAEILELAGNAAR.D | 3 | |
| Jamie_FT_01_itms_49.29184.29184.2 | 6.2581 | 0.4178 | 100.0% | 2949.112 | 2947.4014 | 1 | 7.893 | 46.4% | 7 | R.IGSGAPVYLTAVLEYLAAEILELAGNAAR.D | 2 |
| U | YHR010W | 1 | 1 | 27.2% | 136 | 15531 | 10.4 | RPL27A SGDID:S000001052, Chr VIII from 126515-126545,127107-127486, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Bp and has similarity to rat L27 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15542.15542.3 | 3.1804 | 0.0876 | 90.7% | 4120.4346 | 4123.7104 | 363 | 3.175 | 16.0% | 1 | R.GRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERY*PLK.V | 3 |
| U | YMR116C | 5 | 10 | 26.0% | 319 | 34805 | 6.2 | ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "WD repeat protein (G-beta like protein) involved in translation regulation; required for repression of Gcn4p activity in the absence of amino-acid starvation; core component of the ribosome; ortholog of mammalian RACK1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06663.06663.2 | 2.8063 | 0.2408 | 100.0% | 1438.9321 | 1439.5675 | 1 | 5.194 | 72.7% | 1 | R.LWDVATGETYQR.F | 2 |
| * | Jamie_FT_01_itms_9.04896.04896.2 | 2.05 | 0.147 | 99.5% | 922.97217 | 922.08746 | 11 | 4.508 | 75.0% | 1 | K.ASMIISGSR.D | 2 |
| * | Jamie_FT_01_itms_13.07675.07675.2 | 3.9411 | 0.1886 | 100.0% | 1267.6921 | 1266.4827 | 1 | 6.809 | 81.8% | 4 | R.YWLAAATATGIK.V | 2 |
| * | Jamie_FT_01_itms_24.13928.13928.3 | 2.7739 | 0.1448 | 95.7% | 2563.8542 | 2560.8657 | 14 | 3.748 | 29.8% | 1 | K.VFSLDPQYLVDDLRPEFAGYSK.A | 3 |
| * | Jamie_FT_02_itms_10.08951.08951.3 | 5.092 | 0.3733 | 100.0% | 2965.0745 | 2962.248 | 1 | 6.58 | 27.8% | 3 | K.AAEPHAVSLAWSADGQTLFAGYTDNVIR.V | 3 |
| U | YJR123W | 5 | 10 | 25.3% | 225 | 25039 | 8.6 | RPS5 SGDID:S000003884, Chr X from 651816-652493, Verified ORF, "Protein component of the small (40S) ribosomal subunit, the least basic of the non-acidic ribosomal proteins; phosphorylated in vivo; essential for viability; has similarity to E. coli S7 and rat S5 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_14.08149.08149.2 | 2.3942 | 0.1574 | 99.8% | 1265.1322 | 1265.4087 | 1 | 4.362 | 75.0% | 1 | K.DASLVDYVQVR.Q | 2 |
| * | Jamie_FT_01_itms_34.19919.19919.2 | 6.0726 | 0.5228 | 100.0% | 3058.392 | 3058.462 | 1 | 11.172 | 44.4% | 4 | K.HTLDIINVLTDQNPIQVVVDAITNTGPR.E | 2 |
| * | Jamie_FT_01_itms_34.19952.19952.3 | 5.3403 | 0.3548 | 100.0% | 3062.0645 | 3058.462 | 1 | 6.995 | 28.7% | 2 | K.HTLDIINVLTDQNPIQVVVDAITNTGPR.E | 3 |
| * | Jamie_FT_01_itms_31.18401.18401.3 | 4.8314 | 0.3094 | 100.0% | 3661.7644 | 3661.0635 | 1 | 5.934 | 27.3% | 2 | K.HTLDIINVLTDQNPIQVVVDAITNTGPREDTTR.V | 3 |
| * | Jamie_FT_01_itms_17.10104.10104.2 | 2.6815 | 0.2022 | 100.0% | 1342.0322 | 1340.609 | 1 | 5.223 | 58.3% | 1 | R.VNQAIALLTIGAR.E | 2 |
| U | YIL149C | 40 | 103 | 24.9% | 1679 | 195140 | 6.0 | MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" |
| U | YOL039W | 1 | 1 | 23.6% | 106 | 10746 | 4.0 | RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_14.11390.11390.3 | 4.1441 | 0.4009 | 100.0% | 2617.0144 | 2616.9658 | 1 | 6.983 | 31.2% | 1 | K.AILESVGIEIEDEKVSSVLSALEGK.S | 3 |
| U | YDR385W | 11 | 16 | 23.5% | 842 | 93289 | 6.3 | EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| U | YOR133W | 11 | 16 | 23.5% | 842 | 93289 | 6.3 | EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" |
| U | YNL178W | 5 | 12 | 22.1% | 240 | 26503 | 9.4 | RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_14.11143.11143.3 | 3.4551 | 0.1813 | 99.7% | 2119.2844 | 2120.4124 | 2 | 4.645 | 35.3% | 1 | R.KLVADGVFYAELNEFFTR.E | 3 |
| * | Jamie_FT_02_itms_16.12794.12794.2 | 4.6004 | 0.4195 | 100.0% | 1991.8322 | 1992.2383 | 1 | 7.507 | 56.2% | 5 | K.LVADGVFYAELNEFFTR.E | 2 |
| * | Jamie_FT_01_itms_10.05562.05562.2 | 4.1329 | 0.3576 | 100.0% | 1439.5521 | 1438.5339 | 1 | 8.164 | 83.3% | 1 | R.ELAEEGYSGVEVR.V | 2 |
| * | Jamie_FT_01_itms_14.07890.07890.2 | 2.7313 | 0.1664 | 100.0% | 1170.7322 | 1171.4227 | 24 | 4.788 | 72.2% | 3 | R.INELTLLVQK.R | 2 |
| * | Jamie_FT_01_itms_13.07347.07347.2 | 2.5744 | 0.2473 | 100.0% | 1353.5122 | 1353.5608 | 1 | 4.339 | 72.7% | 2 | K.YAPGTIVLYAER.V | 2 |
| U | Reverse_YNL024C | 1 | 1 | 22.0% | 246 | 27738 | 6.2 | YNL024C SGDID:S000004969, Chr XIV from 587848-587108, reverse complement, Uncharacterized ORF, "Putative S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.13475.13475.4 | 3.2585 | 0.0927 | 93.5% | 6027.177 | 6022.707 | 14 | 3.195 | 12.9% | 1 | K.DIDTVYVKT*GDHFTNKELLGVCLGVLGTGSGLELVKKFQKTGNVT*KSLLHDVSK.E | 4 |
| U | YGL123W | 3 | 6 | 22.0% | 254 | 27450 | 10.4 | RPS2 SGDID:S000003091, Chr VII from 277623-278387, Verified ORF, "Protein component of the small (40S) subunit, essential for control of translational accuracy; has similarity to E. coli S5 and rat S2 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13760.13760.2 | 4.0826 | 0.293 | 100.0% | 1741.1522 | 1741.0807 | 1 | 6.901 | 64.3% | 4 | K.ITTIEEIFLHSLPVK.E | 2 |
| * | Jamie_FT_01_itms_33.19740.19740.4 | 4.0559 | 0.2635 | 100.0% | 4491.8564 | 4492.3145 | 2 | 4.183 | 18.4% | 1 | K.ITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNIKPVQK.Q | 4 |
| * | Jamie_FT_01_itms_16.09122.09122.2 | 2.1772 | 0.1981 | 99.8% | 1836.8522 | 1836.052 | 41 | 3.663 | 37.5% | 1 | K.LLQLAGVEDVYTQSNGK.T | 2 |
| U | YOL086C | 5 | 13 | 21.0% | 348 | 36849 | 6.7 | ADH1 SGDID:S000005446, Chr XV from 160593-159547, reverse complement, Verified ORF, "Alcohol dehydrogenase, fermentative isozyme active as homo- or heterotetramers; required for the reduction of acetaldehyde to ethanol, the last step in the glycolytic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_11.06241.06241.2 | 2.7268 | 0.0932 | 99.8% | 1015.5722 | 1014.21014 | 2 | 3.384 | 87.5% | 1 | K.ANELLINVK.Y | 2 |
| * | Jamie_FT_02_itms_10.09071.09071.3 | 3.3995 | 0.1905 | 99.3% | 2702.0044 | 2702.1033 | 3 | 4.472 | 23.1% | 1 | K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A | 3 |
| * | Jamie_FT_01_itms_13.07520.07520.2 | 1.7294 | 0.1531 | 97.3% | 1620.5521 | 1619.815 | 108 | 4.128 | 42.9% | 1 | R.VLGIDGGEGKEELFR.S | 2 |
| Jamie_FT_01_itms_14.08096.08096.2 | 2.1289 | 0.0838 | 97.9% | 969.09216 | 969.08496 | 37 | 3.842 | 78.6% | 4 | R.EALDFFAR.G | 2 | |
| * | Jamie_FT_01_itms_16.09020.09020.2 | 3.2217 | 0.2695 | 100.0% | 1448.4321 | 1448.6996 | 1 | 6.339 | 66.7% | 6 | K.VVGLSTLPEIYEK.M | 2 |
| U | Reverse_YGR016W | 1 | 1 | 20.5% | 190 | 22226 | 8.8 | YGR016W SGDID:S000003248, Chr VII from 522265-522837, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_19.14162.14162.4 | 3.0232 | 0.1024 | 91.4% | 4710.2964 | 4711.8755 | 299 | 3.655 | 15.8% | 1 | K.QILEEQEETDLPLIS*VDEQDSEGDHTY*DSSLSLIKRNFR.R | 4 |
| U | YKL060C | 5 | 14 | 20.3% | 359 | 39621 | 5.8 | FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10231.10231.2 | 1.9332 | 0.0755 | 93.6% | 1863.6322 | 1864.1082 | 39 | 3.899 | 37.5% | 3 | K.TGVIVGEDVHNLFTYAK.E | 2 |
| * | Jamie_FT_01_itms_22.12812.12812.3 | 2.9616 | 0.1894 | 98.2% | 2160.7444 | 2161.4631 | 1 | 4.182 | 31.0% | 1 | K.FAIPAINVTSSSTAVAALEAAR.D | 3 |
| * | Jamie_FT_01_itms_21.12491.12491.2 | 5.7183 | 0.533 | 100.0% | 2163.392 | 2161.4631 | 1 | 9.278 | 64.3% | 6 | K.FAIPAINVTSSSTAVAALEAAR.D | 2 |
| * | Jamie_FT_01_itms_14.07989.07989.2 | 2.1925 | 0.2051 | 99.8% | 1797.1122 | 1796.033 | 2 | 5.226 | 47.1% | 1 | K.SPIILQTSNGGAAYFAGK.G | 2 |
| * | Jamie_FT_01_itms_16.09177.09177.2 | 3.0246 | 0.2568 | 100.0% | 1902.3922 | 1903.065 | 4 | 5.698 | 46.7% | 3 | K.VNLDTDCQYAYLTGIR.D | 2 |
| U | YBR118W | 12 | 35 | 20.1% | 458 | 50033 | 9.0 | TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| U | YPR080W | 12 | 35 | 20.1% | 458 | 50033 | 9.0 | TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" |
| U | YGL076C | 5 | 17 | 19.7% | 244 | 27638 | 10.1 | RPL7A SGDID:S000003044, Chr VII from 365999-365989,365529-365436,364967-364338, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" |
| U | YPL198W | 5 | 17 | 19.7% | 244 | 27696 | 10.1 | RPL7B SGDID:S000006119, Chr XVI from 173151-173161,173571-173664,174072-174701, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Ap and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_18.10262.10262.2 | 2.6317 | 0.1304 | 99.4% | 1993.6921 | 1993.2665 | 1 | 4.936 | 40.6% | 4 | K.LIEPYVAYGYPSYSTIR.Q | 2 | |
| Jamie_FT_01_itms_30.17777.17777.3 | 5.0231 | 0.3568 | 100.0% | 2381.8442 | 2381.777 | 1 | 7.655 | 40.0% | 4 | K.YGILSIDDLIHEIITVGPHFK.Q | 3 | |
| Jamie_FT_01_itms_30.17513.17513.4 | 4.4975 | 0.2813 | 100.0% | 2381.8564 | 2381.777 | 1 | 5.983 | 39.2% | 4 | K.YGILSIDDLIHEIITVGPHFK.Q | 4 | |
| Jamie_FT_01_itms_30.17687.17687.2 | 5.3122 | 0.4241 | 100.0% | 2382.0322 | 2381.777 | 1 | 7.694 | 60.0% | 4 | K.YGILSIDDLIHEIITVGPHFK.Q | 2 | |
| Jamie_FT_01_itms_20.11983.11983.2 | 1.7418 | 0.1123 | 95.8% | 1264.4122 | 1265.4569 | 21 | 4.713 | 72.2% | 1 | K.QANNFLWPFK.L | 2 |
| U | YOR096W | 1 | 1 | 19.5% | 190 | 21622 | 9.8 | RPS7A SGDID:S000005622, Chr XV from 505794-505937,506339-506767, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Bp; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.17371.17371.4 | 3.6349 | 0.127 | 97.1% | 4170.3364 | 4168.7773 | 412 | 3.822 | 18.1% | 1 | K.ILSQAPTELELQVAQAFVELENSSPELKAELRPLQFK.S | 4 |
| U | YBR009C | 2 | 4 | 19.4% | 103 | 11368 | 11.4 | HHF1 SGDID:S000000213, Chr II from 255682-255371, reverse complement, Verified ORF, "One of two identical histone H4 proteins (see also HHF2); core histone required for chromatin assembly and chromosome function; contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity" |
| U | YNL030W | 2 | 4 | 19.4% | 103 | 11368 | 11.4 | HHF2 SGDID:S000004975, Chr XIV from 576728-577039, Verified ORF, "One of two identical histone H4 proteins (see also HHF1); core histone required for chromatin assembly and chromosome function; contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_14.07847.07847.2 | 1.7092 | 0.103 | 95.7% | 951.4322 | 951.1106 | 23 | 3.29 | 71.4% | 1 | K.SFLESVIR.D | 2 | |
| Jamie_FT_01_itms_15.08682.08682.2 | 2.6962 | 0.2959 | 100.0% | 1310.4722 | 1309.5455 | 1 | 5.662 | 59.1% | 3 | K.TVTSLDVVYALK.R | 2 |
| U | YNL064C | 2 | 4 | 19.3% | 409 | 44671 | 6.3 | YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17737.17737.3 | 4.0018 | 0.4199 | 100.0% | 4462.9443 | 4461.7227 | 1 | 6.52 | 18.8% | 2 | R.DIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPR.G | 3 |
| * | Jamie_FT_01_itms_42.25050.25050.3 | 6.009 | 0.4231 | 100.0% | 3717.7444 | 3720.0837 | 1 | 7.977 | 30.3% | 2 | K.RDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V | 3 |
| U | Reverse_YJR063W | 1 | 1 | 19.2% | 125 | 13661 | 7.9 | RPA12 SGDID:S000003824, Chr X from 555109-555486, Verified ORF, "RNA polymerase I subunit A12.2; contains two zinc binding domains, and the N terminal domain is responsible for anchoring to the RNA pol I complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_20.15173.15173.2 | 1.5862 | 0.1055 | 91.1% | 2742.4321 | 2744.889 | 92 | 3.28 | 23.9% | 1 | K.ARLS*S*PFADDATTTVVKLNSFQSK.P | 2 |
| U | YCR012W | 6 | 11 | 19.0% | 416 | 44738 | 7.6 | PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10229.10229.2 | 2.7907 | 0.3402 | 100.0% | 1439.2522 | 1440.683 | 4 | 6.274 | 53.8% | 4 | K.ASAPGSVILLENLR.Y | 2 |
| * | Jamie_FT_01_itms_19.11291.11291.2 | 2.3345 | 0.0174 | 92.6% | 1768.5922 | 1769.097 | 96 | 2.695 | 40.6% | 1 | K.ALENPTRPFLAILGGAK.V | 2 |
| * | Jamie_FT_01_itms_19.11261.11261.3 | 3.3123 | 0.3014 | 100.0% | 1769.2743 | 1769.097 | 2 | 5.036 | 42.2% | 1 | K.ALENPTRPFLAILGGAK.V | 3 |
| * | Jamie_FT_02_itms_23.16577.16577.3 | 3.6814 | 0.2748 | 100.0% | 2722.4043 | 2723.2434 | 84 | 5.201 | 24.0% | 2 | K.IQLIDNLLDKVDSIIIGGGMAFTFK.K | 3 |
| * | Jamie_FT_01_itms_35.20991.20991.2 | 4.8404 | 0.2975 | 100.0% | 2724.4922 | 2723.2434 | 1 | 6.79 | 43.8% | 2 | K.IQLIDNLLDKVDSIIIGGGMAFTFK.K | 2 |
| * | Jamie_FT_03_itms_12.16105.16105.2 | 3.1392 | 0.3386 | 100.0% | 2393.172 | 2392.7112 | 1 | 6.262 | 40.9% | 1 | K.GVEVVLPVDFIIADAFSADANTK.T | 2 |
| U | YOL040C | 2 | 3 | 19.0% | 142 | 16002 | 10.7 | RPS15 SGDID:S000005400, Chr XV from 253575-253147, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S19 and rat S15 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_22.13218.13218.3 | 5.3827 | 0.4805 | 100.0% | 3167.4543 | 3169.625 | 1 | 7.715 | 29.8% | 2 | K.AFNQVEIRPEMLGHYLGEFSITYTPVR.H | 3 |
| * | Jamie_FT_01_itms_22.13218.13218.2 | 2.2108 | 0.3154 | 96.4% | 2111.9722 | 2114.4236 | 7 | 4.97 | 35.3% | 1 | P.EMLGHYLGEFSITYTPVR.H | 3 |
| U | Reverse_YIR016W | 1 | 1 | 18.9% | 265 | 28882 | 5.3 | YIR016W SGDID:S000001455, Chr IX from 382625-383422, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_77.46075.46075.4 | 2.3549 | 0.2409 | 97.4% | 5345.1367 | 5339.6406 | 411 | 4.253 | 11.2% | 1 | R.SADEVLSPAHIAGAGDRSLTMYKHFAAS*DDDVDDHPGLLS*PLLGDISSGR.S | 4 |
| U | YOL012C | 1 | 2 | 18.7% | 134 | 14283 | 10.7 | HTZ1 SGDID:S000005372, Chr XV from 303983-303579, reverse complement, Verified ORF, "Histone variant H2AZ, exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_46.27297.27297.3 | 7.0915 | 0.4719 | 100.0% | 2610.1143 | 2609.035 | 1 | 9.577 | 42.7% | 2 | K.AAIYLTAVLEYLTAEVLELAGNAAK.D | 3 |
| U | YLR075W | 3 | 13 | 18.6% | 221 | 25361 | 10.0 | RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15573.15573.3 | 4.764 | 0.2535 | 100.0% | 3360.3542 | 3357.7083 | 1 | 5.388 | 25.9% | 2 | K.KATVDEFPLCVHLVSNELEQLSSEALEAAR.I | 3 |
| * | Jamie_FT_01_itms_30.17892.17892.3 | 5.9958 | 0.3862 | 100.0% | 3230.5444 | 3229.5342 | 1 | 7.512 | 28.6% | 3 | K.ATVDEFPLCVHLVSNELEQLSSEALEAAR.I | 3 |
| * | Jamie_FT_01_itms_21.12113.12113.2 | 3.464 | 0.32 | 100.0% | 1248.3522 | 1247.4801 | 1 | 5.913 | 80.0% | 8 | R.VDIGQIIFSVR.T | 2 |
| U | YPL124W | 4 | 14 | 18.2% | 253 | 29280 | 9.5 | SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_9.04850.04850.2 | 1.9528 | 0.1218 | 98.7% | 1088.6322 | 1089.0636 | 276 | 3.83 | 71.4% | 2 | K.FQDDT*LNR.V | 2 |
| * | Jamie_FT_01_itms_9.05183.05183.2 | 3.0979 | 0.247 | 100.0% | 1292.9922 | 1293.3788 | 11 | 5.784 | 70.0% | 1 | K.FASQNVIDDQR.L | 2 |
| * | Jamie_FT_01_itms_13.07741.07741.2 | 2.7998 | 0.3079 | 100.0% | 1694.3121 | 1694.8821 | 3 | 6.237 | 60.7% | 1 | R.IVYDQGTVIDNLTSR.I | 2 |
| * | Jamie_FT_01_itms_16.09217.09217.2 | 3.3875 | 0.2928 | 100.0% | 1395.9722 | 1394.5675 | 1 | 6.394 | 77.3% | 10 | R.LESFILNSISDR.G | 2 |
| U | YDR099W | 2 | 3 | 17.9% | 273 | 31061 | 4.9 | BMH2 SGDID:S000002506, Chr IV from 653602-654423, Verified ORF, "14-3-3 protein, minor isoform; binds proteins and DNA, involved in regulation of many processes including exocytosis and vesicle transport, Ras/MAPK signaling during pseudohyphal development, rapamycin-sensitive signaling, and others" |
| U | YER177W | 2 | 3 | 18.4% | 267 | 30091 | 4.9 | BMH1 SGDID:S000000979, Chr V from 545606-546409, Verified ORF, "14-3-3 protein, major isoform; binds proteins and DNA, involved in regulation of many processes including exocytosis and vesicle transport, Ras/MAPK signaling during pseudohyphal development, rapamycin-sensitive signaling, and others" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_02_itms_15.12180.12180.2 | 2.9292 | 0.2137 | 100.0% | 2319.3123 | 2319.619 | 1 | 5.421 | 44.7% | 2 | R.LGLALNFSVFYYEIQNSPDK.A | 2 | |
| Jamie_FT_01_itms_36.21347.21347.3 | 4.4778 | 0.3807 | 100.0% | 3317.8145 | 3317.6895 | 1 | 6.905 | 26.8% | 1 | K.QAFDDAIAELDTLSEESYKDSTLIMQLLR.D | 3 |
| U | YDR050C | 2 | 3 | 17.7% | 248 | 26795 | 6.0 | TPI1 SGDID:S000002457, Chr IV from 556469-555723, reverse complement, Verified ORF, "Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.18930.18930.3 | 4.5115 | 0.3387 | 100.0% | 4795.1045 | 4792.3594 | 1 | 5.571 | 19.2% | 2 | R.QLNAVLEEVKDWTNVVVAYEPVWAIGTGLAATPEDAQDIHASIR.K | 3 |
| * | Jamie_FT_01_itms_32.18967.18967.2 | 4.2769 | 0.4314 | 100.0% | 2491.6921 | 2490.7783 | 1 | 6.498 | 43.5% | 1 | E.PVWAIGTGLAATPEDAQDIHASIR.K | 2 |
| U | YKL042W | 4 | 21 | 17.4% | 363 | 42271 | 7.9 | SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_3.01305.01305.2 | 2.218 | 0.1719 | 100.0% | 926.77216 | 925.93036 | 4 | 4.694 | 71.4% | 12 | R.DYNDVGSR.I | 2 |
| * | Jamie_FT_01_itms_15.09003.09003.2 | 3.185 | 0.3926 | 100.0% | 1298.1921 | 1297.5554 | 1 | 6.862 | 70.0% | 7 | R.TLSVLTNYVMR.S | 2 |
| * | Jamie_FT_01_itms_22.12683.12683.2 | 2.185 | 0.0566 | 94.2% | 1877.4922 | 1878.2402 | 50 | 3.42 | 40.6% | 1 | R.MSPLPSPLNTILPINNR.L | 2 |
| * | Jamie_FT_01_itms_23.13368.13368.3 | 3.5853 | 0.2606 | 100.0% | 3064.3442 | 3064.4097 | 117 | 4.855 | 22.1% | 1 | K.LSLNNQLQELQSMMDGDDNIKLDNVSK.H | 3 |
| U | YIL002W-A | 1 | 1 | 17.4% | 69 | 7729 | 4.7 | YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_5.02501.02501.2 | 1.4623 | 0.1268 | 92.3% | 1190.4321 | 1191.237 | 97 | 3.386 | 50.0% | 1 | R.DTPEDVSTAGAK.D | 2 |
| U | Reverse_YER056C-A | 1 | 1 | 16.5% | 121 | 13639 | 10.8 | RPL34A SGDID:S000002135, Chr V from 270183-270147,269749-269421, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl34Bp and has similarity to rat L34 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_14.11421.11421.2 | 1.6059 | 0.2183 | 98.8% | 2369.2722 | 2367.752 | 230 | 4.252 | 26.3% | 1 | -.KKAKKESKKAAET*QEKVVKK.V | 2 |
| U | YLR340W | 3 | 5 | 16.3% | 312 | 33717 | 4.8 | RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.11336.11336.2 | 2.6066 | 0.0152 | 96.8% | 1269.1921 | 1268.4088 | 36 | 3.393 | 70.0% | 1 | R.GFLSDLPDFEK.L | 2 |
| * | Jamie_FT_01_itms_17.09817.09817.2 | 2.0629 | 0.1925 | 99.6% | 1296.4922 | 1296.5089 | 11 | 4.012 | 59.1% | 3 | K.TSFFQALGVPTK.I | 2 |
| * | Jamie_FT_01_itms_29.17351.17351.3 | 6.0956 | 0.4144 | 100.0% | 3186.3542 | 3185.5579 | 1 | 8.398 | 34.3% | 1 | K.DLLAVAIAASYHYPEIEDLVDRIENPEK.Y | 3 |
| U | YNL225C | 11 | 40 | 16.2% | 581 | 67400 | 6.0 | CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" |
| U | YBR196C | 2 | 4 | 15.7% | 554 | 61299 | 6.4 | PGI1 SGDID:S000000400, Chr II from 613895-612231, reverse complement, Verified ORF, "Glycolytic enzyme phosphoglucose isomerase, catalyzes the interconversion of glucose-6-phosphate and fructose-6-phosphate; required for cell cycle progression and completion of the gluconeogenic events of sporulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21197.21197.4 | 5.1555 | 0.1477 | 100.0% | 5532.177 | 5529.149 | 1 | 4.393 | 17.7% | 2 | K.GAEAVDNHFTQTPLEDNIPLLGGLLSVWYNNFFGAQTHLVAPFDQYLHR.F | 4 |
| * | Jamie_FT_02_itms_22.16338.16338.4 | 5.3434 | 0.0207 | 96.7% | 4229.4565 | 4227.7627 | 40 | 4.547 | 16.7% | 2 | K.ITPATLGALIAYYEHVTFTEGAIWNINSFDQWGVELGK.V | 4 |
| U | YFR028C | 5 | 12 | 15.6% | 551 | 61907 | 8.0 | CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10677.10677.2 | 2.2965 | 0.2141 | 100.0% | 1472.4521 | 1470.6653 | 1 | 4.98 | 59.1% | 2 | R.SVYLDNTIEFLR.G | 2 |
| * | Jamie_FT_01_itms_10.05447.05447.2 | 2.1386 | 0.2309 | 100.0% | 1188.6122 | 1188.3256 | 1 | 5.004 | 70.0% | 1 | K.AVVFYSSASTR.Q | 2 |
| * | Jamie_FT_02_itms_19.14366.14366.2 | 3.4958 | 0.3055 | 100.0% | 2520.5723 | 2519.7295 | 1 | 5.601 | 40.5% | 7 | R.DAGYSNADFEITIQDVVYGVWR.A | 2 |
| * | Jamie_FT_01_itms_9.05239.05239.2 | 2.5373 | 0.0833 | 99.3% | 1243.8322 | 1243.3622 | 20 | 3.772 | 65.0% | 1 | R.VAQNNIEGELR.D | 2 |
| * | Jamie_FT_03_itms_3.09904.09904.3 | 1.9377 | 0.2333 | 94.8% | 3288.6243 | 3290.757 | 58 | 4.378 | 18.1% | 1 | R.QLLPKNRRVTSGRRTTSAAGGIRKIS*GSIK.K | 3 |
| U | YJR139C | 2 | 2 | 15.6% | 359 | 38502 | 7.5 | HOM6 SGDID:S000003900, Chr X from 690439-689360, reverse complement, Verified ORF, "Homoserine dehydrogenase (L-homoserine:NADP oxidoreductase), dimeric enzyme that catalyzes the third step in the common pathway for methionine and threonine biosynthesis; enzyme has nucleotide-binding, dimerization and catalytic regions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22397.22397.3 | 3.2164 | 0.1413 | 96.7% | 4011.4443 | 4011.385 | 2 | 3.532 | 20.0% | 1 | R.EIIQTGDEVEKIEGIFSGTLSYIFNEFSTSQANDVK.F | 3 |
| * | Jamie_FT_01_itms_17.10095.10095.3 | 3.1046 | 0.0877 | 92.9% | 2273.5745 | 2275.4314 | 109 | 3.328 | 30.3% | 1 | R.IS*GVEVESPT*SFPVQSLIPK.P | 3 |
| U | Reverse_YIL041W | 1 | 1 | 15.6% | 326 | 36670 | 5.0 | GVP36 SGDID:S000001303, Chr IX from 276524-277504, Uncharacterized ORF, "Golgi vesicle protein of unknown function; localizes to both early and late Golgi vesicles" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_21.15618.15618.4 | 4.6837 | 0.0875 | 98.2% | 6141.7363 | 6143.575 | 306 | 3.985 | 13.0% | 1 | K.S*AVSRSFENVSENIYKPY*DYSGNEYIATVGLFHNYILKITDVKDELETYER.P | 4 |
| U | YGR085C | 2 | 3 | 15.5% | 174 | 19750 | 9.9 | RPL11B SGDID:S000003317, Chr VII from 648911-648387, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11" |
| U | YPR102C | 2 | 3 | 15.5% | 174 | 19720 | 9.9 | RPL11A SGDID:S000006306, Chr XVI from 731746-731222, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Bp; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_13.07723.07723.2 | 3.4527 | 0.2894 | 100.0% | 1360.4521 | 1359.5223 | 1 | 5.74 | 66.7% | 2 | K.LVLNISVGESGDR.L | 2 | |
| Jamie_FT_01_itms_9.05353.05353.2 | 4.3151 | 0.3773 | 100.0% | 1514.2522 | 1514.719 | 1 | 7.398 | 73.1% | 1 | K.VLEQLSGQTPVQSK.A | 2 |
| U | Reverse_YBL002W | 1 | 1 | 15.3% | 131 | 14237 | 10.1 | HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" |
| U | Reverse_YDR224C | 1 | 1 | 15.3% | 131 | 14252 | 10.1 | HTB1 SGDID:S000002632, Chr IV from 914706-914311, reverse complement, Verified ORF, "One of two nearly identical (see HTB2) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_33.19284.19284.2 | 2.0598 | 0.1426 | 98.6% | 2267.112 | 2269.3035 | 12 | 3.619 | 28.9% | 1 | -.AQTSSSY*KT*VARTGESVAHK.A | 2 |
| U | YDR064W | 2 | 7 | 15.2% | 151 | 17029 | 10.4 | RPS13 SGDID:S000002471, Chr IV from 579455-579475,580015-580449, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S15 and rat S13 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_9.05375.05375.2 | 2.421 | 0.1569 | 99.8% | 1138.2322 | 1138.2657 | 44 | 4.794 | 55.0% | 1 | K.GISSSAIPYSR.N | 2 |
| * | Jamie_FT_01_itms_16.09393.09393.2 | 3.1986 | 0.2318 | 100.0% | 1332.3722 | 1332.537 | 5 | 5.598 | 59.1% | 6 | K.LSSESVIEQIVK.Y | 2 |
| U | YDL130W | 1 | 1 | 15.1% | 106 | 10668 | 4.0 | RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08419.08419.2 | 1.6867 | 0.0826 | 90.3% | 1664.1921 | 1664.815 | 115 | 2.981 | 36.7% | 1 | K.AAGANVDNVWADVYAK.A | 2 |
| U | YDR453C | 1 | 1 | 14.8% | 196 | 21615 | 7.3 | TSA2 SGDID:S000002861, Chr IV from 1365652-1365062, reverse complement, Verified ORF, "Stress inducible cytoplasmic thioredoxin peroxidase; cooperates with Tsa1p in the removal of reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; deletion enhances the mutator phenotype of tsa1 mutants " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_25.18029.18029.2 | 1.4152 | 0.1836 | 95.7% | 3397.7522 | 3396.6946 | 32 | 3.337 | 19.6% | 1 | K.KFEDQGAQVLFAST*DSEYSLLAWTNLPRK.D | 2 |
| U | YGR214W | 3 | 5 | 14.7% | 252 | 28024 | 4.7 | RPS0A SGDID:S000003446, Chr VII from 920580-920669,921125-921793, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Bp; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal" |
| U | YLR048W | 3 | 5 | 14.7% | 252 | 27962 | 4.7 | RPS0B SGDID:S000004038, Chr XII from 242233-242322,242682-243350, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_18.10782.10782.2 | 1.9131 | 0.0905 | 94.2% | 1765.4722 | 1766.0476 | 13 | 4.053 | 40.6% | 1 | R.IIAAIPNPEDVVAISSR.T | 2 | |
| Jamie_FT_01_itms_10.05477.05477.2 | 1.9533 | 0.116 | 98.6% | 913.0522 | 913.10504 | 10 | 4.241 | 71.4% | 1 | R.LVIVTDPR.S | 2 | |
| Jamie_FT_01_itms_23.13695.13695.2 | 3.3348 | 0.281 | 100.0% | 1443.8922 | 1442.7471 | 1 | 7.17 | 86.4% | 3 | K.HSIGLIWYLLAR.E | 2 |
| U | YOR257W | 2 | 6 | 14.3% | 161 | 18751 | 4.6 | CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_16.09065.09065.2 | 3.8587 | 0.3976 | 100.0% | 1381.3322 | 1380.5549 | 1 | 7.453 | 80.0% | 5 | K.YDDFYIVMGEK.I | 2 |
| * | Jamie_FT_01_itms_11.06548.06548.2 | 2.1459 | 0.196 | 99.8% | 1405.6522 | 1405.5016 | 39 | 3.974 | 54.5% | 1 | K.ELGETLTDEELR.A | 2 |
| U | YDR308C | 1 | 1 | 14.3% | 140 | 16071 | 5.0 | SRB7 SGDID:S000002716, Chr IV from 1078443-1078021, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation; target of the global repressor Tup1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_12.10181.10181.2 | 2.0449 | 0.0476 | 92.3% | 2253.8123 | 2256.388 | 102 | 3.235 | 31.6% | 1 | R.HVDSLIEDFVDGIANS*KKST.- | 2 |
| U | YBL072C | 2 | 3 | 14.0% | 200 | 22490 | 10.7 | RPS8A SGDID:S000000168, Chr II from 89123-88521, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Ap and has similarity to rat S8 ribosomal protein" |
| U | YER102W | 2 | 3 | 14.0% | 200 | 22490 | 10.7 | RPS8B SGDID:S000000904, Chr V from 363096-363698, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps8Bp and has similarity to rat S8 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_14.08052.08052.2 | 3.2117 | 0.3164 | 100.0% | 1303.8922 | 1302.5162 | 1 | 5.348 | 68.2% | 2 | K.AAIVQIDATPFR.Q | 2 | |
| Jamie_FT_02_itms_13.10802.10802.2 | 2.353 | 0.0859 | 97.5% | 1949.4521 | 1949.1334 | 1 | 4.369 | 46.7% | 1 | R.CDGYILEGEELAFYLR.R | 2 |
| U | YML028W | 2 | 3 | 13.8% | 196 | 21590 | 5.1 | TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22680.22680.2 | 3.8999 | 0.4938 | 100.0% | 3019.5322 | 3019.5598 | 1 | 8.444 | 40.4% | 2 | K.YVVLAFIPLAFTFVCPTEIIAFSEAAK.K | 2 |
| * | Jamie_FT_01_itms_38.22609.22609.3 | 3.5615 | 0.1527 | 98.2% | 3020.3643 | 3019.5598 | 251 | 4.434 | 23.1% | 1 | K.YVVLAFIPLAFTFVCPTEIIAFSEAAK.K | 3 |
| U | YDL229W | 6 | 9 | 13.7% | 613 | 66602 | 5.4 | SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_13.07778.07778.2 | 2.4322 | 0.1342 | 99.5% | 1481.6721 | 1480.6604 | 1 | 3.534 | 58.3% | 1 | R.VTPSFVAFTPEER.L | 2 |
| Jamie_FT_01_itms_14.08139.08139.2 | 2.8189 | 0.127 | 100.0% | 1186.4521 | 1186.3536 | 5 | 4.353 | 68.2% | 1 | K.DAGAISGLNVLR.I | 2 | |
| Jamie_FT_01_itms_16.09203.09203.2 | 1.5937 | 0.1185 | 92.7% | 1730.4722 | 1731.0018 | 242 | 3.632 | 35.3% | 1 | R.IINEPTAAAIAYGLGAGK.S | 2 | |
| Jamie_FT_02_itms_14.11351.11351.3 | 6.9486 | 0.477 | 100.0% | 2829.7144 | 2830.2993 | 1 | 8.877 | 39.4% | 4 | R.HVLIFDLGGGTFDVSLLHIAGGVYTVK.S | 3 | |
| Jamie_FT_02_itms_14.11291.11291.4 | 3.5165 | 0.0946 | 95.4% | 2830.1365 | 2830.2993 | 16 | 2.941 | 27.6% | 1 | R.HVLIFDLGGGTFDVSLLHIAGGVYTVK.S | 4 | |
| Jamie_FT_01_itms_13.07272.07272.2 | 2.5612 | 0.0857 | 98.7% | 1461.0322 | 1460.6273 | 107 | 3.539 | 50.0% | 1 | K.SQIDEVVLVGGSTR.I | 2 |
| U | Reverse_YDR511W | 1 | 1 | 13.5% | 133 | 15783 | 9.1 | ACN9 SGDID:S000002919, Chr IV from 1470007-1470408, Verified ORF, "Protein of the mitochondrial intermembrane space, required for acetate utilization and gluconeogenesis; has orthologs in higher eukaryotes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17802.17802.2 | 2.1774 | 0.0793 | 96.1% | 2221.0322 | 2219.5515 | 57 | 3.615 | 32.4% | 1 | R.RYLVLPPLLLQSNHT*AFR.V | 2 |
| U | YOR063W | 2 | 2 | 13.4% | 387 | 43758 | 10.3 | RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_6.14097.14097.3 | 2.4815 | 0.1489 | 91.0% | 2903.9343 | 2901.2212 | 3 | 3.747 | 25.0% | 1 | R.S*KPVALTSFLGYKAGMTT*IVRDLDR.P | 3 |
| * | Jamie_FT_01_itms_36.21593.21593.2 | 3.1753 | 0.3437 | 100.0% | 2811.8323 | 2810.2603 | 5 | 5.816 | 26.9% | 1 | R.EVVEAVTVVDTPPVVVVGVVGYVETPR.G | 2 |
| U | Reverse_YOR286W | 1 | 1 | 13.4% | 149 | 16697 | 9.6 | YOR286W SGDID:S000005812, Chr XV from 850277-850726, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20553.20553.2 | 2.4646 | 0.1757 | 99.8% | 2360.8523 | 2363.593 | 55 | 4.197 | 28.9% | 1 | K.PAKTTFTRLVLT*PS*RASVTR.S | 2 |
| U | YPR139C | 1 | 1 | 13.3% | 300 | 33816 | 9.7 | VPS66 SGDID:S000006343, Chr XVI from 814054-813152, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function involved in vacuolar protein sorting." |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.13265.13265.4 | 3.1866 | 0.1887 | 98.4% | 4771.8965 | 4766.52 | 1 | 3.901 | 17.1% | 1 | K.KFELQTIQIKTNKTAIT*TLPISNMEYLSRFLNKGINVKCK.I | 4 |
| U | Reverse_YMR269W | 1 | 1 | 13.3% | 211 | 23949 | 10.1 | YMR269W SGDID:S000004882, Chr XIII from 804455-805090, Uncharacterized ORF, "Nucleolar protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.14094.14094.3 | 2.7744 | 0.1229 | 91.2% | 3083.7544 | 3086.3433 | 171 | 3.907 | 20.4% | 1 | R.RKKGKSS*SASSVVFS*AEEKKGLNTITGK.L | 3 |
| U | YDR450W | 2 | 8 | 13.0% | 146 | 17038 | 10.3 | RPS18A SGDID:S000002858, Chr IV from 1359913-1359959,1360395-1360788, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins" |
| U | YML026C | 2 | 8 | 13.0% | 146 | 17038 | 10.3 | RPS18B SGDID:S000004488, Chr XIII from 223828-223782,223380-222987, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_9.05345.05345.2 | 3.5097 | 0.193 | 100.0% | 1202.5721 | 1201.3654 | 1 | 5.788 | 80.0% | 1 | R.LLNTNVDGNIK.I | 2 | |
| Jamie_FT_01_itms_16.09365.09365.2 | 2.5462 | 0.2341 | 100.0% | 1017.0722 | 1017.2187 | 1 | 5.13 | 92.9% | 7 | K.IPAWFLNR.Q | 2 |
| U | YDL029W | 1 | 1 | 12.8% | 391 | 44074 | 5.8 | ARP2 SGDID:S000002187, Chr IV from 399337-399358,399482-400635, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_25.17777.17777.4 | 3.3566 | 0.1443 | 97.1% | 5224.0166 | 5223.9346 | 1 | 3.463 | 15.0% | 1 | K.YDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTR.R | 4 |
| U | YOR100C | 1 | 1 | 12.8% | 327 | 34754 | 9.8 | CRC1 SGDID:S000005626, Chr XV from 514278-513295, reverse complement, Verified ORF, "Mitochondrial inner membrane carnitine transporter, required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_19.14673.14673.4 | 3.7667 | 0.1064 | 96.7% | 4551.9365 | 4555.092 | 176 | 3.337 | 15.4% | 1 | K.KLVT*FNNKQGGSNELT*MGQMAAAGFISAIPTTLVTAPTERVK.V | 4 |
| U | YDR356W | 10 | 22 | 12.5% | 944 | 111782 | 7.1 | SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10338.10338.2 | 2.8658 | 0.1858 | 100.0% | 1283.6522 | 1283.528 | 4 | 4.934 | 70.0% | 2 | K.NMEFTPVGFIK.S | 2 |
| * | Jamie_FT_01_itms_18.10764.10764.2 | 2.2138 | 0.2088 | 100.0% | 1860.6721 | 1861.0148 | 4 | 4.155 | 40.0% | 1 | R.LFSEASQFDDSFPEIK.A | 2 |
| * | Jamie_FT_01_itms_16.09301.09301.2 | 2.4757 | 0.1397 | 99.8% | 1218.1721 | 1218.4106 | 5 | 3.874 | 77.8% | 2 | K.NLMNELNELK.S | 2 |
| * | Jamie_FT_01_itms_10.05837.05837.2 | 3.8922 | 0.3789 | 100.0% | 1262.2122 | 1262.3997 | 1 | 6.775 | 90.0% | 1 | K.IAELEEEISTK.N | 2 |
| * | Jamie_FT_01_itms_20.11817.11817.2 | 2.8925 | 0.3442 | 100.0% | 1533.5521 | 1533.8236 | 1 | 6.467 | 57.7% | 3 | K.LASLMAQLTQLESK.L | 2 |
| * | Jamie_FT_01_itms_16.09173.09173.2 | 1.9559 | 0.1045 | 97.6% | 1218.6322 | 1219.4233 | 57 | 4.206 | 61.1% | 1 | K.QLENDLFVIK.K | 2 |
| * | Jamie_FT_01_itms_9.05112.05112.2 | 4.229 | 0.2963 | 100.0% | 1288.1921 | 1288.4435 | 1 | 6.886 | 90.9% | 1 | K.ISNLAAENSQLK.N | 2 |
| * | Jamie_FT_01_itms_9.05057.05057.2 | 2.6816 | 0.2361 | 100.0% | 1206.1322 | 1206.2921 | 30 | 4.503 | 72.2% | 9 | K.DSEDKIEELK.I | 2 |
| * | Jamie_FT_01_itms_10.05441.05441.2 | 2.8685 | 0.1488 | 100.0% | 1162.2922 | 1162.2823 | 4 | 4.301 | 77.8% | 1 | K.LQEDEISSLK.S | 2 |
| * | Jamie_FT_01_itms_15.08972.08972.2 | 1.5464 | 0.1486 | 94.4% | 1695.5721 | 1696.8113 | 49 | 3.725 | 46.2% | 1 | K.NYLSEITSLQEENR.R | 2 |
| U | YFL039C | 2 | 3 | 12.3% | 375 | 41690 | 5.7 | ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_21.12493.12493.3 | 3.0473 | 0.1066 | 93.6% | 3109.1343 | 3107.5798 | 26 | 4.097 | 22.4% | 1 | R.TTGIVLDSGDGVTHVVPIYAGFSLPHAILR.I | 3 |
| * | Jamie_FT_02_itms_7.07452.07452.2 | 2.049 | 0.1493 | 98.9% | 1791.1122 | 1791.9554 | 9 | 4.29 | 46.7% | 2 | K.SYELPDGQVITIGNER.F | 2 |
| U | YJL191W | 1 | 1 | 12.3% | 138 | 14650 | 10.5 | RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_6.06320.06320.2 | 2.9832 | 0.2392 | 96.2% | 1890.4321 | 1890.0659 | 1 | 6.026 | 50.0% | 1 | A.NDLVQARDNSQVFGVAR.I | 2 |
| U | YJL190C | 1 | 1 | 12.3% | 130 | 14626 | 9.9 | RPS22A SGDID:S000003726, Chr X from 75301-74909, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| U | YLR367W | 1 | 1 | 12.3% | 130 | 14626 | 9.9 | RPS22B SGDID:S000004359, Chr XII from 856441-856573,857057-857316, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_22.12774.12774.2 | 2.0399 | 0.0887 | 95.7% | 1632.1522 | 1630.7954 | 10 | 3.83 | 50.0% | 1 | R.SSVLADALNAINNAEK.T | 2 |
| U | YBR031W | 3 | 7 | 12.2% | 362 | 39092 | 10.6 | RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| U | YDR012W | 3 | 7 | 12.2% | 362 | 39062 | 10.6 | RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_02_itms_14.11463.11463.2 | 3.1176 | 0.2652 | 100.0% | 1820.5922 | 1821.1271 | 1 | 5.401 | 50.0% | 4 | R.YATASAIAATAVASLVLAR.G | 2 | |
| Jamie_FT_01_itms_19.11282.11282.2 | 2.8443 | 0.2353 | 100.0% | 1314.0922 | 1313.5388 | 1 | 4.972 | 80.0% | 1 | R.FVIWTEAAFTK.L | 2 | |
| Jamie_FT_01_itms_10.05841.05841.2 | 2.8269 | 0.2467 | 100.0% | 1509.3722 | 1507.6403 | 1 | 6.287 | 65.4% | 2 | K.LDQVWGSETVASSK.V | 2 |
| U | YGL008C | 8 | 13 | 12.0% | 918 | 99619 | 5.1 | PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_10.05490.05490.2 | 2.4655 | 0.1518 | 100.0% | 1058.5521 | 1058.2664 | 1 | 4.209 | 83.3% | 1 | K.TLANTAVVIR.D | 2 |
| Jamie_FT_02_itms_24.17273.17273.3 | 3.5196 | 0.1717 | 98.7% | 3064.2244 | 3062.7217 | 256 | 4.172 | 20.8% | 2 | R.YTLGITIIGVPVGLPAVVTTTMAVGAAYLAK.K | 3 | |
| Jamie_FT_01_itms_37.21795.21795.2 | 2.9464 | 0.1458 | 100.0% | 3065.2122 | 3062.7217 | 1 | 4.004 | 28.3% | 1 | R.YTLGITIIGVPVGLPAVVTTTMAVGAAYLAK.K | 2 | |
| Jamie_FT_01_itms_20.11924.11924.2 | 1.959 | 0.2137 | 99.6% | 1805.6721 | 1806.0295 | 2 | 4.898 | 40.6% | 1 | K.LSAIESLAGVEILCSDK.T | 2 | |
| Jamie_FT_01_itms_12.06707.06707.2 | 2.7208 | 0.1417 | 100.0% | 1450.9122 | 1449.6066 | 1 | 5.008 | 58.3% | 1 | R.QLGLGTNIYNAER.L | 2 | |
| Jamie_FT_01_itms_10.05432.05432.2 | 2.4145 | 0.0201 | 97.5% | 971.3722 | 971.1447 | 26 | 3.535 | 85.7% | 1 | R.VVEILQNR.G | 2 | |
| Jamie_FT_01_itms_33.19685.19685.2 | 3.5709 | 0.3387 | 100.0% | 1987.6522 | 1986.3593 | 1 | 5.927 | 57.9% | 5 | R.SAADIVFLAPGLSAIIDALK.T | 2 | |
| Jamie_FT_01_itms_16.09249.09249.2 | 1.883 | 0.0779 | 94.2% | 1285.5521 | 1285.4756 | 23 | 3.646 | 55.0% | 1 | R.SVEDFMAAMQR.V | 2 |
| U | YLR303W | 3 | 6 | 11.7% | 444 | 48672 | 6.4 | MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22615.22615.2 | 5.1935 | 0.4428 | 100.0% | 2635.4722 | 2633.121 | 1 | 8.198 | 50.0% | 4 | R.DLGPLMNPFASFLLLQGVETLSLR.A | 2 |
| * | Jamie_FT_02_itms_32.22302.22302.2 | 2.0836 | 0.0922 | 96.3% | 3101.652 | 3102.4675 | 49 | 3.273 | 24.1% | 1 | R.VSVGIEFIDDIIADFQQSFETVFAGQKP.- | 2 |
| * | Jamie_FT_02_itms_32.22299.22299.3 | 5.4218 | 0.2169 | 100.0% | 3105.8044 | 3102.4675 | 1 | 6.36 | 31.5% | 1 | R.VSVGIEFIDDIIADFQQSFETVFAGQKP.- | 3 |
| U | YKL152C | 2 | 3 | 11.7% | 247 | 27609 | 8.8 | GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.11388.11388.2 | 2.2947 | 0.0894 | 98.7% | 1179.9521 | 1179.3611 | 1 | 4.233 | 77.8% | 2 | K.NLFTGWVDVK.L | 2 |
| * | Jamie_FT_01_itms_22.12783.12783.2 | 2.319 | 0.127 | 99.0% | 2146.0122 | 2144.4294 | 42 | 4.128 | 38.9% | 1 | K.YVDPNVLPETESLALVIDR.L | 2 |
| U | Reverse_YHR105W | 1 | 1 | 11.7% | 214 | 24646 | 8.3 | YPT35 SGDID:S000001147, Chr VIII from 324769-325413, Uncharacterized ORF, "Endosomal protein of unknown function that contains a phox (PX) homology domain and binds to both phosphatidylinositol-3-phosphate (PtdIns(3)P) and proteins involved in ER-Golgi or vesicular transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_24.14378.14378.3 | 3.1011 | 0.1539 | 96.6% | 3198.6843 | 3194.6646 | 25 | 3.747 | 26.0% | 1 | K.ATKIRT*LLNERLRVFDSYRKYTQIK.Y | 3 |
| U | Reverse_YMR158W | 1 | 1 | 11.6% | 155 | 17471 | 9.6 | MRPS8 SGDID:S000004767, Chr XIII from 572247-572714, Verified ORF, "Mitochondrial ribosomal protein of the small subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_12.17365.17365.2 | 1.6262 | 0.1075 | 92.5% | 2211.3523 | 2209.55 | 22 | 2.906 | 35.3% | 1 | R.ITVGS*CLKKMDEMPLHIR.S | 2 |
| U | YKR104W | 1 | 1 | 11.4% | 306 | 34652 | 7.8 | YKR104W SGDID:S000001812, Chr XI from 656474-657394, Verified ORF, "ORFs YKR103W and YKR104W are merged in different strain backgrounds" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_28.25524.25524.3 | 2.0026 | 0.2609 | 96.9% | 4093.5842 | 4089.598 | 183 | 4.654 | 12.5% | 1 | R.S*MLGARNIMLIDEATAS*IDYISDAKIQKTIRETMK.N | 3 |
| U | YGL030W | 1 | 1 | 11.4% | 105 | 11415 | 9.8 | RPL30 SGDID:S000002998, Chr VII from 439096-439098,439329-439643, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L30 ribosomal protein; involved in pre-rRNA processing in the nucleolus; autoregulates splicing of its transcript" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08532.08532.2 | 2.4905 | 0.2185 | 100.0% | 1294.1322 | 1294.6237 | 2 | 5.275 | 68.2% | 1 | K.LIIIAANTPVLR.K | 2 |
| U | YNL055C | 1 | 1 | 11.0% | 283 | 30428 | 7.9 | POR1 SGDID:S000005000, Chr XIV from 518846-517995, reverse complement, Verified ORF, "Mitochondrial porin (voltage-dependent anion channel), outer membrane protein required for the maintenance of mitochondrial osmotic stability and mitochondrial membrane permeability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_20.15264.15264.3 | 3.6741 | 0.0792 | 94.5% | 3420.0544 | 3419.7722 | 194 | 3.549 | 20.8% | 1 | K.DYSLGATLNNEQITTVDFFQNVNAFLQVGAK.A | 3 |
| U | YJR077C | 1 | 2 | 10.9% | 311 | 32812 | 9.3 | MIR1 SGDID:S000003838, Chr X from 578104-577169, reverse complement, Verified ORF, "Mitochondrial phosphate carrier, imports inorganic phosphate into mitochondria; functionally redundant with Pic2p but more abundant than Pic2 under normal conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_43.25592.25592.2 | 2.6982 | 0.277 | 100.0% | 3329.152 | 3329.8564 | 1 | 6.976 | 22.7% | 2 | K.LSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSK.V | 2 |
| U | Reverse_YBL093C | 1 | 1 | 10.9% | 220 | 24857 | 6.4 | ROX3 SGDID:S000000189, Chr II from 44915-44253, reverse complement, Verified ORF, "RNA polymerase II holoenzyme component" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.14105.14105.2 | 1.858 | 0.1738 | 98.7% | 2756.9321 | 2755.911 | 94 | 4.657 | 28.3% | 1 | R.RKMDEHSDSHTPTAMSSGS*SKNKR.K | 2 |
| U | YBR164C | 1 | 2 | 10.9% | 183 | 20434 | 4.9 | ARL1 SGDID:S000000368, Chr II from 568421-567870, reverse complement, Verified ORF, "Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; G protein of the Ras superfamily, similar to ADP-ribosylation factor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.20197.20197.2 | 2.6814 | 0.0517 | 97.5% | 2259.2322 | 2258.5303 | 1 | 3.48 | 44.7% | 2 | K.GEGITEGLDWLIDVIKEEQL.- | 2 |
| U | Reverse_YDL136W | 1 | 1 | 10.8% | 120 | 13910 | 10.6 | RPL35B SGDID:S000002295, Chr IV from 217600-217602,218008-218367, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl35Ap and has similarity to rat L35 ribosomal protein" |
| U | Reverse_YDL191W | 1 | 1 | 10.8% | 120 | 13910 | 10.6 | RPL35A SGDID:S000002350, Chr IV from 117665-117667,118159-118518, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl35Bp and has similarity to rat L35 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_05_itms_22.28645.28645.2 | 2.0124 | 0.1391 | 98.4% | 1514.0721 | 1514.8491 | 49 | 3.599 | 54.2% | 1 | R.SLKQVKLEALEKK.L | 2 |
| U | YBR221C | 1 | 1 | 10.7% | 366 | 40054 | 5.3 | PDB1 SGDID:S000000425, Chr II from 666248-665148, reverse complement, Verified ORF, "E1 beta subunit of the pyruvate dehydrogenase (PDH) complex, which is an evolutionarily-conserved multi-protein complex found in mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.20354.20354.3 | 4.6132 | 0.3427 | 100.0% | 4286.9644 | 4284.784 | 1 | 6.38 | 25.0% | 1 | K.TNHLITVESTFPSFGVGAEIVAQVMESEAFDYLDAPIQR.V | 3 |
| U | YNL126W | 4 | 6 | 10.6% | 846 | 98227 | 7.5 | SPC98 SGDID:S000005070, Chr XIV from 387229-389769, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.22841.22841.3 | 6.2852 | 0.4526 | 100.0% | 2824.9744 | 2824.292 | 1 | 7.621 | 42.7% | 2 | K.IPNFESGLLHLIFEAGLLYQSLGYK.V | 3 |
| * | Jamie_FT_01_itms_39.22854.22854.2 | 3.7143 | 0.1392 | 100.0% | 2825.4922 | 2824.292 | 1 | 4.052 | 39.6% | 1 | K.IPNFESGLLHLIFEAGLLYQSLGYK.V | 2 |
| * | Jamie_FT_04_itms_16.19932.19932.3 | 4.0007 | 0.257 | 100.0% | 3256.7043 | 3253.7173 | 119 | 5.77 | 23.3% | 1 | K.ALIIEISEELQNYTAFVNNLVSSGTVVSLK.S | 3 |
| * | Jamie_FT_02_itms_23.16841.16841.3 | 4.5171 | 0.2891 | 100.0% | 3855.2344 | 3854.3455 | 1 | 5.052 | 20.6% | 2 | K.LFATNTSEISVGDYSGQPYPTSLVLLLNSVYEFVK.V | 3 |
| U | Reverse_YGL003C | 2 | 2 | 10.2% | 566 | 62822 | 8.6 | CDH1 SGDID:S000002971, Chr VII from 494178-492478, reverse complement, Verified ORF, "Cell-cycle regulated activator of the anaphase-promoting complex/cyclosome (APC/C), which directs ubiquitination of mitotic cyclins resulting in exit from mitosis; targets the APC/C to specific substrates including CDC20, ASE1 and CIN8" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_12.15590.15590.2 | 1.526 | 0.1763 | 96.4% | 2191.172 | 2192.4143 | 24 | 4.413 | 32.5% | 1 | R.DATGGGT*ALVGRKHPSWAMAK.V | 2 |
| * | Jamie_FT_03_itms_18.19642.19642.3 | 2.2643 | 0.2548 | 97.9% | 4082.3943 | 4086.3389 | 149 | 4.53 | 17.4% | 1 | R.DGYVTSPRSRRSPSSLLSASS*SSSIPRKS*VRKSESGK.L | 3 |
| U | YJL167W | 1 | 1 | 10.2% | 352 | 40483 | 5.5 | ERG20 SGDID:S000003703, Chr X from 105007-106065, Verified ORF, "Farnesyl pyrophosphate synthetase, has both dimethylallyltranstransferase and geranyltranstransferase activities; catalyzes the formation of C15 farnesyl pyrophosphate units for isoprenoid and sterol biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21169.21169.3 | 4.8471 | 0.2608 | 100.0% | 4219.8545 | 4217.7744 | 37 | 5.179 | 17.1% | 1 | K.YYIDITELFHEVTFQTELGQLMDLITAPEDKVDLSK.F | 3 |
| U | YJL026W | 2 | 3 | 10.0% | 399 | 46147 | 5.2 | RNR2 SGDID:S000003563, Chr X from 392320-393519, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10394.10394.2 | 1.7865 | 0.0776 | 92.7% | 1422.7122 | 1421.5522 | 2 | 3.698 | 54.5% | 1 | R.WIQDADALFGER.L | 2 |
| * | Jamie_FT_01_itms_38.22493.22493.2 | 3.8544 | 0.3245 | 100.0% | 3191.6921 | 3190.6992 | 1 | 8.117 | 37.0% | 2 | R.YFLDALPVALLGMNADLMNQYVEFVADR.L | 2 |
| U | YDR382W | 1 | 1 | 10.0% | 110 | 11050 | 4.1 | RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_14.07903.07903.2 | 2.3727 | 0.1785 | 100.0% | 1203.0322 | 1203.3782 | 11 | 3.762 | 65.0% | 1 | R.INELLSSLEGK.G | 2 |
| U | Reverse_YKL077W | 1 | 1 | 9.9% | 392 | 46036 | 8.9 | YKL077W SGDID:S000001560, Chr XI from 291097-292275, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the vacuole" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_28.16501.16501.4 | 3.8524 | 0.0501 | 93.3% | 4745.1367 | 4750.321 | 236 | 3.093 | 15.8% | 1 | K.VEESTT*MKEKPRVVQRAGHVHQYLSALS*FFILISDHFRM.- | 4 |
| U | YHL015W | 1 | 4 | 9.9% | 121 | 13907 | 9.5 | RPS20 SGDID:S000001007, Chr VIII from 75409-75774, Verified ORF, "Protein component of the small (40S) ribosomal subunit; overproduction suppresses mutations affecting RNA polymerase III-dependent transcription; has similarity to E. coli S10 and rat S20 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_16.09066.09066.2 | 2.3977 | 0.0298 | 95.6% | 1388.0521 | 1388.647 | 1 | 4.436 | 54.5% | 4 | R.YIDLEAPVQIVK.R | 2 |
| U | Reverse_YPL192C | 1 | 1 | 9.8% | 133 | 14428 | 10.3 | PRM3 SGDID:S000006113, Chr XVI from 183055-182654, reverse complement, Verified ORF, "Pheromone-regulated protein required for karyogamy; localizes to the inner membrane of the nuclear envelope" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_9.08436.08436.2 | 1.5602 | 0.1472 | 95.3% | 1623.5721 | 1623.634 | 3 | 4.162 | 45.8% | 1 | K.TRS*KTSSTT*TKHK.R | 2 |
| U | YDR055W | 1 | 1 | 9.5% | 444 | 45777 | 9.2 | PST1 SGDID:S000002462, Chr IV from 563524-564858, Verified ORF, "Cell wall protein that contains a putative GPI-attachment site; secreted by regenerating protoplasts; up-regulated by activation of the cell integrity pathway, as mediated by Rlm1p; upregulated by cell wall damage via disruption of FKS1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_27.16207.16207.4 | 4.2474 | 0.3025 | 100.0% | 4399.9766 | 4400.943 | 50 | 5.197 | 16.7% | 1 | V.GNFTSLNLDSLKSVKGGADVESKSSNFSCNALKALQKKGGIK.G | 4 |
| U | Reverse_YGR122W | 1 | 1 | 9.5% | 402 | 45305 | 8.2 | YGR122W SGDID:S000003354, Chr VII from 733940-735148, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_22.15993.15993.4 | 3.9764 | 0.1191 | 97.6% | 4365.3765 | 4360.7515 | 276 | 3.252 | 16.2% | 1 | K.LWTDICTISDAKSSSSNLSNICNNRLIILDNPIS*TTIK.S | 4 |
| U | YGL209W | 1 | 1 | 9.4% | 382 | 42048 | 9.7 | MIG2 SGDID:S000003177, Chr VII from 95862-97010, Verified ORF, "Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_12.10388.10388.4 | 3.2637 | 0.0805 | 90.7% | 4187.2563 | 4186.377 | 70 | 3.069 | 18.6% | 1 | R.VNT*PRSVPNSPNDGYLHQQHIPQQY*QHQTASPSVAK.Q | 4 |
| U | Reverse_YHR060W | 1 | 1 | 9.4% | 181 | 21078 | 5.5 | VMA22 SGDID:S000001102, Chr VIII from 220727-221272, Verified ORF, "Integral membrane protein that is required for vacuolar H+-ATPase (V-ATPase) function, although not an actual component of the V-ATPase complex; functions in the assembly of the V-ATPase; localized to the yeast endoplasmic reticulum (ER)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_6.14352.14352.2 | 1.3809 | 0.1824 | 95.1% | 2103.5322 | 2103.3896 | 301 | 3.381 | 31.2% | 1 | K.LKHSQTKQKEPKT*GKKR.Q | 2 |
| U | YOR234C | 1 | 1 | 9.3% | 107 | 12168 | 11.1 | RPL33B SGDID:S000005760, Chr XV from 779405-779387,778859-778555, reverse complement, Verified ORF, "Ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Ap and has similarity to rat L35a; rpl33b null mutant exhibits normal growth while rpl33a rpl33b double null mutant is inviable" |
| U | YPL143W | 1 | 1 | 9.3% | 107 | 12154 | 11.1 | RPL33A SGDID:S000006064, Chr XVI from 282121-282139,282665-282969, Verified ORF, "N-terminally acetylated ribosomal protein L37 of the large (60S) ribosomal subunit, nearly identical to Rpl33Bp and has similarity to rat L35a; rpl33a null mutant exhibits slow growth while rpl33a rpl33b double null mutant is inviable" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_9.05343.05343.2 | 2.0216 | 0.0978 | 97.6% | 1098.1322 | 1098.2877 | 41 | 3.304 | 66.7% | 1 | R.VNNPNVSLIK.I | 2 |
| U | YGR027C | 1 | 1 | 9.3% | 108 | 12039 | 10.3 | RPS25A SGDID:S000003259, Chr VII from 534462-534136, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Bp and has similarity to rat S25 ribosomal protein" |
| U | YLR333C | 1 | 1 | 9.3% | 108 | 12009 | 10.3 | RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_13.07677.07677.2 | 2.4591 | 0.0984 | 99.5% | 1137.4321 | 1137.3213 | 8 | 4.258 | 83.3% | 1 | R.YVSVSVLVDR.L | 2 |
| U | Reverse_YLR390W-A | 2 | 2 | 9.2% | 238 | 23268 | 5.9 | CCW14 SGDID:S000006429, Chr XII from 903724-904440, Verified ORF, "Covalently linked cell wall glycoprotein, present in the inner layer of the cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_35.23940.23940.2 | 1.7952 | 0.1127 | 94.4% | 2060.132 | 2060.9915 | 11 | 3.736 | 31.0% | 1 | K.TSSSASSSSAKTSSSASSSS*AK.T | 2 |
| * | Jamie_FT_04_itms_21.23047.23047.4 | 3.5858 | 0.0813 | 95.4% | 2135.9766 | 2140.9915 | 126 | 3.589 | 30.2% | 1 | K.TSSSASSSSAKT*SSS*ASSSSAK.T | 4 |
| U | YOR217W | 2 | 2 | 9.1% | 861 | 94903 | 9.2 | RFC1 SGDID:S000005743, Chr XV from 749301-751886, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20754.20754.2 | 1.9459 | 0.0757 | 93.8% | 3032.9521 | 3034.5818 | 1 | 2.954 | 27.8% | 1 | K.TPKKMPVSNVIDVSETPEGEKKLPLPAK.R | 2 |
| * | Jamie_FT_02_itms_19.14186.14186.4 | 3.0321 | 0.1221 | 94.6% | 5525.7363 | 5520.0483 | 207 | 3.088 | 13.3% | 1 | K.ENAKFDFKSANSNADPDEIVSEIGS*FPEGKPNCLLGLTIVFTGVLPTLER.G | 4 |
| U | YER043C | 1 | 1 | 9.1% | 449 | 49126 | 6.2 | SAH1 SGDID:S000000845, Chr V from 237118-235769, reverse complement, Verified ORF, "S-adenosyl-L-homocysteine hydrolase, catabolizes S-adenosyl-L-homocysteine which is formed after donation of the activated methyl group of S-adenosyl-L-methionine (AdoMet) to an acceptor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.20047.20047.3 | 3.8539 | 0.2646 | 100.0% | 4466.574 | 4467.0317 | 52 | 4.915 | 16.2% | 1 | R.VLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCR.D | 3 |
| U | YFR031C-A | 2 | 4 | 9.1% | 254 | 27408 | 11.1 | RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" |
| U | YIL018W | 2 | 4 | 9.1% | 254 | 27408 | 11.1 | RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_10.05760.05760.2 | 2.6502 | 0.3367 | 100.0% | 955.7922 | 956.1331 | 1 | 6.135 | 80.0% | 3 | R.GVIGVIAGGGR.V | 2 | |
| Jamie_FT_02_itms_5.05777.05777.2 | 2.049 | 0.1313 | 98.7% | 1303.7522 | 1304.4459 | 124 | 3.861 | 50.0% | 1 | R.TGLLRGSQKTQD.- | 2 |
| U | YDL150W | 1 | 1 | 9.0% | 422 | 46667 | 8.6 | RPC53 SGDID:S000002309, Chr IV from 183344-184612, Verified ORF, "RNA polymerase III subunit C53" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_8.13592.13592.4 | 3.0218 | 0.1583 | 96.7% | 3974.5366 | 3969.4685 | 1 | 3.422 | 20.3% | 1 | -.MSSNKGNGRLPSLKDSSSNGGGS*AKPSLKFKPKAVARK.S | 4 |
| U | YEL051W | 1 | 3 | 9.0% | 256 | 29194 | 5.9 | VMA8 SGDID:S000000777, Chr V from 58378-59148, Verified ORF, "Subunit D of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; plays a role in the coupling of proton transport and ATP hydrolysis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_41.24206.24206.3 | 4.9438 | 0.4401 | 100.0% | 2516.7844 | 2516.978 | 1 | 6.474 | 33.0% | 3 | R.AVETLVELASLQTAFIILDEVIK.V | 3 |
| U | YOR373W | 4 | 13 | 8.9% | 851 | 94104 | 7.0 | NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_25.18047.18047.4 | 3.6205 | 0.1063 | 96.3% | 5069.5767 | 5067.7515 | 1 | 3.87 | 17.0% | 1 | K.KLNLSNNEINGIIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVR.N | 4 |
| * | Jamie_FT_02_itms_28.19699.19699.3 | 4.4396 | 0.2467 | 100.0% | 4942.1343 | 4939.577 | 1 | 6.432 | 18.2% | 3 | K.LNLSNNEINGIIDFEQLILTNNSVVGGWLTVEVLDLSNNNIIGVR.N | 3 |
| * | Jamie_FT_01_itms_21.12581.12581.2 | 2.757 | 0.2766 | 100.0% | 1784.6322 | 1784.063 | 1 | 5.312 | 43.8% | 3 | K.VLNLNGNPLVSIVESSK.M | 2 |
| * | Jamie_FT_01_itms_15.08673.08673.2 | 3.6254 | 0.3872 | 100.0% | 1452.2722 | 1452.6506 | 1 | 6.079 | 66.7% | 6 | K.STNLYSLTIANVR.D | 2 |
| U | YGR282C | 1 | 1 | 8.9% | 313 | 34119 | 4.5 | BGL2 SGDID:S000003514, Chr VII from 1058730-1057789, reverse complement, Verified ORF, "Endo-beta-1,3-glucanase, major protein of the cell wall, involved in cell wall maintenance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_13.11106.11106.3 | 3.6619 | 0.2224 | 100.0% | 3142.0444 | 3142.4053 | 1 | 4.9 | 32.4% | 1 | R.AWGVNVIVFEAFDEDWKPNTSGTSDVEK.H | 3 |
| U | YGL202W | 1 | 1 | 8.8% | 500 | 56178 | 6.0 | ARO8 SGDID:S000003170, Chr VII from 116063-117565, Verified ORF, "Aromatic aminotransferase, expression is regulated by general control of amino acid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_39.26143.26143.4 | 1.7729 | 0.2285 | 90.8% | 5156.1367 | 5160.903 | 172 | 3.483 | 12.8% | 1 | K.ILKPYLS*LHEMTIQAPAGFTQVLVNAT*LSRWGQKGYLDWLLGLR.H | 4 |
| U | YDL137W | 1 | 1 | 8.8% | 181 | 20658 | 7.4 | ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_51.30374.30374.2 | 2.249 | 0.0456 | 93.9% | 1871.2322 | 1871.118 | 170 | 3.628 | 33.3% | 1 | -.MGLY*ASKLFSNLFGNK.E | 2 |
| U | YDR447C | 1 | 1 | 8.8% | 136 | 15803 | 10.5 | RPS17B SGDID:S000002855, Chr IV from 1355543-1355541,1355226-1354819, reverse complement, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Ap and has similarity to rat S17 ribosomal protein" |
| U | YML024W | 1 | 1 | 8.8% | 136 | 15788 | 10.5 | RPS17A SGDID:S000004486, Chr XIII from 225889-225891,226290-226697, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Bp and has similarity to rat S17 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_13.07649.07649.2 | 2.6113 | 0.2854 | 100.0% | 1297.1921 | 1297.5405 | 8 | 5.385 | 54.5% | 1 | K.LPLSVINVSAQR.D | 2 |
| U | YCL028W | 1 | 1 | 8.6% | 405 | 42580 | 6.6 | RNQ1 SGDID:S000000533, Chr III from 70150-71367, Verified ORF, "[PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20779.20779.2 | 4.1109 | 0.4342 | 100.0% | 3344.612 | 3342.7812 | 1 | 7.204 | 32.4% | 1 | R.GFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFK.S | 2 |
| U | YDR098C-B | 10 | 20 | 8.5% | 1755 | 198594 | 8.4 | YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YER138C | 10 | 20 | 8.5% | 1755 | 198561 | 8.1 | YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR365W-B | 10 | 20 | 8.5% | 1755 | 198658 | 8.0 | YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR316W-B | 10 | 20 | 8.5% | 1755 | 198526 | 8.2 | YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR261C-D | 10 | 20 | 9.4% | 1604 | 181660 | 7.5 | YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YDR210C-D | 10 | 20 | 8.5% | 1755 | 198838 | 8.4 | YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | YAR002W | 2 | 2 | 8.5% | 539 | 59039 | 9.3 | NUP60 SGDID:S000000063, Chr I from 152259-153878, Verified ORF, "Subunit of the nuclear pore complex (NPC), functions to anchor Nup2p to the NPC in a dynamic process that is controlled by the nucleoplasmic concentration of Gsp1p-GTP; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_19.14318.14318.2 | 1.6316 | 0.1329 | 94.3% | 2850.7522 | 2849.0842 | 101 | 2.693 | 23.1% | 1 | K.KIPDTYT*ANTSAQSIASAKSVRSGVSK.S | 2 |
| * | Jamie_FT_02_itms_16.12823.12823.2 | 1.734 | 0.089 | 92.2% | 2085.1921 | 2085.2375 | 293 | 3.672 | 27.8% | 1 | K.NNAASELANPYSSYVSQIR.K | 2 |
| U | YGR234W | 3 | 8 | 8.5% | 399 | 44646 | 6.3 | YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.23573.23573.4 | 5.842 | 0.4104 | 100.0% | 3661.7766 | 3662.1743 | 1 | 6.963 | 25.3% | 1 | K.AIKEVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 4 |
| * | Jamie_FT_01_itms_44.25847.25847.2 | 3.9373 | 0.4515 | 100.0% | 3348.9722 | 3349.762 | 1 | 8.499 | 35.0% | 3 | K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 2 |
| * | Jamie_FT_02_itms_28.20118.20118.3 | 5.7389 | 0.3597 | 100.0% | 3349.9744 | 3349.762 | 1 | 5.699 | 30.8% | 4 | K.EVLGDAATPEIINAWGEAYQAIADIFITVEK.K | 3 |
| U | YLR105C | 1 | 1 | 8.5% | 377 | 44109 | 8.4 | SEN2 SGDID:S000004095, Chr XII from 348181-347048, reverse complement, Verified ORF, "Subunit of the tRNA splicing endonuclease, which is composed of Sen2p, Sen15p, Sen34p, and Sen54p; Sen2p contains the active site for tRNA 5' splice site cleavage and has similarity to Sen34p and to Archaeal tRNA splicing endonuclease" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14510.14510.4 | 3.3783 | 0.0819 | 93.6% | 3700.7766 | 3702.906 | 177 | 3.249 | 18.8% | 1 | K.ARTEARLGLNDTPLHNRGGT*KS*NTETEMTLEK.V | 4 |
| U | YBL030C | 1 | 1 | 8.5% | 318 | 34426 | 9.8 | PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19537.19537.2 | 4.0099 | 0.4942 | 100.0% | 2794.1921 | 2792.1663 | 1 | 8.063 | 38.5% | 1 | K.WFAGNLASGGAAGALSLLFVYSLDYAR.T | 2 |
| U | YKR072C | 1 | 1 | 8.4% | 562 | 62478 | 4.7 | SIS2 SGDID:S000001780, Chr XI from 577765-576077, reverse complement, Verified ORF, "Negative regulatory subunit of the protein phosphatase 1 Ppz1p; involved in ion homeostasis and cell cycle progression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.19929.19929.4 | 3.7811 | 0.1154 | 97.1% | 5064.6567 | 5066.4414 | 368 | 2.857 | 13.4% | 1 | K.SPNSNPAPVSNSIPGNHAVIPNHTNTS*RTTQLSGSPLVNEMKDYDPK.K | 4 |
| U | Reverse_YNL151C | 1 | 1 | 8.4% | 251 | 27724 | 4.4 | RPC31 SGDID:S000005095, Chr XIV from 348523-347768, reverse complement, Verified ORF, "RNA polymerase III subunit C31; contains HMG-like C-terminal domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_38.25664.25664.2 | 1.7834 | 0.0707 | 90.4% | 2199.9922 | 2199.316 | 94 | 3.045 | 27.5% | 1 | K.GVDGYGLGFPLNSMY*NSGGGR.S | 2 |
| U | YDL083C | 1 | 5 | 8.4% | 143 | 15847 | 10.3 | RPS16B SGDID:S000002241, Chr IV from 307789-307766,307333-306926, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Ap and has similarity to E. coli S9 and rat S16 ribosomal proteins" |
| U | YMR143W | 1 | 5 | 8.4% | 143 | 15847 | 10.3 | RPS16A SGDID:S000004751, Chr XIII from 551927-551950,552495-552902, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Bp and has similarity to E. coli S9 and rat S16 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_21.12294.12294.2 | 3.8706 | 0.3197 | 100.0% | 1361.3322 | 1359.6488 | 1 | 5.72 | 72.7% | 5 | K.VYEPLLLVGLDK.F | 2 |
| U | YLR249W | 6 | 14 | 8.2% | 1044 | 115945 | 6.0 | YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.21757.21757.3 | 5.595 | 0.3678 | 100.0% | 4852.7046 | 4850.675 | 1 | 6.168 | 23.3% | 4 | R.FIPSLIQCIADPTEVPETVHLLGATTFVAEVTPATLSIMVPLLSR.G | 3 |
| * | Jamie_FT_02_itms_23.16992.16992.4 | 4.3625 | 0.103 | 98.2% | 4854.9766 | 4850.675 | 1 | 3.854 | 17.4% | 2 | R.FIPSLIQCIADPTEVPETVHLLGATTFVAEVTPATLSIMVPLLSR.G | 4 |
| * | Jamie_FT_01_itms_18.10800.10800.2 | 2.5668 | 0.312 | 100.0% | 1526.2322 | 1526.8162 | 1 | 5.298 | 61.5% | 4 | K.LVEDPQVIAPFLGK.L | 2 |
| * | Jamie_FT_03_itms_10.14501.14501.3 | 2.2285 | 0.2227 | 97.1% | 1860.6244 | 1861.1455 | 292 | 4.655 | 25.0% | 1 | K.IVVEYIAAIGADLIDER.I | 3 |
| * | Jamie_FT_02_itms_16.12731.12731.2 | 4.2672 | 0.3272 | 100.0% | 1861.1921 | 1861.1455 | 1 | 7.381 | 68.8% | 2 | K.IVVEYIAAIGADLIDER.I | 2 |
| * | Jamie_FT_01_itms_13.07797.07797.2 | 2.2942 | 0.0531 | 97.5% | 1190.5322 | 1189.3538 | 5 | 3.631 | 66.7% | 1 | K.NLTEEVWAVK.D | 2 |
| U | Reverse_YOR215C | 1 | 1 | 8.1% | 185 | 21229 | 9.6 | YOR215C SGDID:S000005741, Chr XV from 747282-746725, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08951.08951.2 | 1.5105 | 0.1588 | 94.9% | 1756.9122 | 1757.9093 | 183 | 3.297 | 32.1% | 1 | K.SYMDYLSYEDASKGK.L | 2 |
| U | YHL001W | 1 | 3 | 8.0% | 138 | 15153 | 10.9 | RPL14B SGDID:S000000993, Chr VIII from 104272-104400,104799-105086, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Ap and has similarity to rat L14 ribosomal protein" |
| U | YKL006W | 1 | 3 | 8.0% | 138 | 15167 | 10.9 | RPL14A SGDID:S000001489, Chr XI from 431549-431677,432076-432363, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl14Bp and has similarity to rat L14 ribosomal protein; rpl14a csh5 double null mutant exhibits synthetic slow growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_16.09416.09416.2 | 3.2752 | 0.3544 | 100.0% | 1214.0521 | 1213.46 | 2 | 6.456 | 75.0% | 3 | K.LAAIVEIIDQK.K | 2 |
| U | YFL002C | 1 | 1 | 7.9% | 606 | 69422 | 9.0 | SPB4 SGDID:S000001894, Chr VI from 146929-145109, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase, nucleolar protein required for synthesis of 60S ribosomal subunits at a late step in the pathway; sediments with 66S pre-ribosomes in sucrose gradients" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_31.18601.18601.4 | 3.8031 | 0.0717 | 94.7% | 5887.3765 | 5886.7 | 42 | 2.589 | 14.5% | 1 | K.QEGIFPGNWLVDPPVNMDEYKY*KDKKREKERQETLKNISLINDKKKLK.S | 4 |
| U | Reverse_YJR015W | 1 | 1 | 7.6% | 510 | 58117 | 7.1 | YJR015W SGDID:S000003776, Chr X from 462635-464167, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_30.20754.20754.4 | 2.8774 | 0.1426 | 95.2% | 4283.177 | 4283.168 | 140 | 3.827 | 16.7% | 1 | K.AAVLAKQKLKRSAYKGVFPLLATNLAILAVLIGY*NRGMK.R | 4 |
| U | YPR191W | 1 | 1 | 7.6% | 368 | 40478 | 8.0 | QCR2 SGDID:S000006395, Chr XVI from 919377-920483, Verified ORF, "Subunit 2 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; transcription is regulated by Hap1p, Hap2p/Hap3p, and heme" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_41.24600.24600.2 | 3.5092 | 0.3696 | 100.0% | 2902.7922 | 2901.2837 | 1 | 6.866 | 37.0% | 1 | K.ASLAQYEVLANYLTSALSELSGLISSAK.L | 2 |
| U | YGR118W | 1 | 6 | 7.6% | 145 | 16038 | 10.7 | RPS23A SGDID:S000003350, Chr VII from 726978-727042,727363-727735, Verified ORF, "Ribosomal protein 28 (rp28) of the small (40S) ribosomal subunit, required for translational accuracy; nearly identical to Rps23Bp and similar to E. coli S12 and rat S23 ribosomal proteins; deletion of both RPS23A and RPS23B is lethal" |
| U | YPR132W | 1 | 6 | 7.6% | 145 | 16038 | 10.7 | RPS23B SGDID:S000006336, Chr XVI from 794961-795025,795391-795763, Verified ORF, "Ribosomal protein 28 (rp28) of the small (40S) ribosomal subunit, required for translational accuracy; nearly identical to Rps23Ap and similar to E. coli S12 and rat S23 ribosomal proteins; deletion of both RPS23A and RPS23B is lethal" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_22.12636.12636.2 | 3.7923 | 0.2882 | 100.0% | 1173.5322 | 1173.441 | 1 | 6.826 | 90.0% | 6 | K.VSGVSLLALWK.E | 2 |
| U | YER131W | 1 | 1 | 7.6% | 119 | 13447 | 10.9 | RPS26B SGDID:S000000933, Chr V from 423948-424307, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Ap and has similarity to rat S26 ribosomal protein" |
| U | YGL189C | 1 | 1 | 7.6% | 119 | 13505 | 10.8 | RPS26A SGDID:S000003157, Chr VII from 148594-148235, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Bp and has similarity to rat S26 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_9.05153.05153.2 | 2.0631 | 0.1552 | 99.5% | 943.3522 | 943.091 | 55 | 4.043 | 68.8% | 1 | R.NIVEAAAVR.D | 2 |
| U | Reverse_YDR524C | 1 | 1 | 7.5% | 482 | 54494 | 9.5 | AGE1 SGDID:S000002932, Chr IV from 1488980-1487532, reverse complement, Verified ORF, "ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector, involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.16915.16915.4 | 3.4262 | 0.0705 | 90.8% | 4164.9365 | 4165.662 | 55 | 3.389 | 19.5% | 1 | K.LLINTLKLANNCWSPY*QAKSATRAVTGKS*FLPVVNK.N | 4 |
| U | YMR203W | 1 | 3 | 7.5% | 387 | 42038 | 5.5 | TOM40 SGDID:S000004816, Chr XIII from 668491-669654, Verified ORF, "Component of the TOM (translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially directed proteins; constitutes the core element of the protein conducting pore" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20766.20766.2 | 4.3612 | 0.3958 | 100.0% | 3056.7322 | 3056.4858 | 1 | 7.98 | 35.7% | 3 | K.GEFTGVAVASFLQSVTPQLALGLETLYSR.T | 2 |
| U | YPR183W | 1 | 1 | 7.5% | 267 | 30362 | 7.9 | DPM1 SGDID:S000006387, Chr XVI from 900751-901554, Verified ORF, "Dolichol phosphate mannose (Dol-P-Man) synthase of the ER membrane, catalyzes the formation of Dol-P-Man from Dol-P and GDP-Man; required for glycosyl phosphatidylinositol membrane anchoring, O mannosylation, and protein glycosylation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_34.23141.23141.2 | 2.221 | 0.0536 | 94.3% | 2382.1921 | 2379.5696 | 17 | 3.667 | 36.8% | 1 | K.GQY*LVCMDADLQHPPETVPK.L | 2 |
| U | YHR064C | 1 | 1 | 7.4% | 538 | 58238 | 5.1 | SSZ1 SGDID:S000001106, Chr VIII from 227143-225527, reverse complement, Verified ORF, "Hsp70 protein that interacts with Zuo1p (a DnaJ homolog) to form a ribosome-associated complex that is bound to the ribosome via the Zuo1p subunit; also involved in pleiotropic drug resistance via sequential activation of PDR1 and PDR5" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_31.18384.18384.3 | 4.3458 | 0.2651 | 100.0% | 4358.3345 | 4354.9956 | 1 | 5.735 | 21.2% | 1 | K.IGLQIVQFINEPSAALLAHAEQFPFEKDVNVVVADFGGIR.S | 3 |
| U | YBR161W | 1 | 1 | 7.4% | 376 | 44382 | 9.1 | CSH1 SGDID:S000000365, Chr II from 561629-562759, Verified ORF, "Probable catalytic subunit of a mannosylinositol phosphorylceramide (MIPC) synthase, forms a complex with probable regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19409.19409.2 | 2.1494 | 0.0962 | 97.3% | 3213.2322 | 3214.426 | 11 | 3.136 | 22.2% | 1 | K.DALTDEQLNPPNGFNSTFY*ESPPQLIPK.I | 2 |
| U | Reverse_YCL049C | 1 | 1 | 7.4% | 312 | 35652 | 4.8 | YCL049C SGDID:S000000554, Chr III from 40724-39786, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_19.20224.20224.2 | 1.563 | 0.1395 | 94.0% | 2728.4321 | 2726.225 | 39 | 3.987 | 29.5% | 1 | R.IMPAVMISSQS*VTQNIKKLWNKK.D | 2 |
| U | Reverse_YOR179C | 1 | 1 | 7.4% | 188 | 20866 | 5.6 | SYC1 SGDID:S000005705, Chr XV from 672411-671845, reverse complement, Verified ORF, "Subunit of the APT subcomplex of cleavage and polyadenylation factor, may have a role in 3' end formation of both polyadenylated and non-polyadenylated RNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_8.07937.07937.2 | 1.8019 | 0.0898 | 93.5% | 1539.5322 | 1541.6584 | 58 | 3.107 | 46.2% | 1 | K.SKGIT*VSGNKVNEK.K | 2 |
| U | Reverse_YEL057C | 1 | 1 | 7.3% | 233 | 27229 | 9.7 | YEL057C SGDID:S000000783, Chr V from 45721-45020, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_11.09921.09921.2 | 1.7331 | 0.0903 | 92.3% | 2096.2922 | 2099.2273 | 16 | 2.895 | 37.5% | 1 | K.SYASFQVT*KFGKRNDNR.Q | 2 |
| U | YBR127C | 2 | 3 | 7.2% | 517 | 57749 | 5.1 | VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.11148.11148.2 | 2.6997 | 0.3136 | 100.0% | 1929.2122 | 1930.1389 | 2 | 6.86 | 50.0% | 1 | R.GYPGYMYTDLSTIYER.A | 2 |
| * | Jamie_FT_02_itms_12.10259.10259.3 | 3.4261 | 0.275 | 100.0% | 2321.3943 | 2320.642 | 1 | 5.21 | 36.2% | 2 | K.AVVGEEALSIEDKLSLEFLEK.F | 3 |
| U | Reverse_YBR165W | 1 | 1 | 7.2% | 277 | 32197 | 8.6 | UBS1 SGDID:S000000369, Chr II from 568847-569680, Verified ORF, "Ubiquitin-conjugating enzyme suppressor that functions as a general positive regulator of Cdc34p activity; nuclear protein that may represent a link between nucleocytoplasmic transport and ubiquitin ligase activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.24000.24000.3 | 2.6089 | 0.2408 | 99.0% | 2527.2544 | 2525.4443 | 107 | 4.58 | 30.3% | 1 | R.KT*YHESGRNDNT*EDPCALTR.S | 3 |
| U | YOL003C | 1 | 1 | 7.1% | 378 | 44488 | 8.3 | YOL003C SGDID:S000005363, Chr XV from 322994-321858, reverse complement, Verified ORF, "Palmitoyltransferase with autoacylation activity; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.13775.13775.3 | 2.9432 | 0.1655 | 96.7% | 3241.5842 | 3240.765 | 149 | 3.782 | 21.2% | 1 | K.KSELIFLTISSPLNS*FVLLT*ITILFLR.C | 3 |
| U | YAL012W | 1 | 1 | 7.1% | 394 | 42542 | 6.5 | CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine;" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.18829.18829.3 | 4.2533 | 0.3351 | 100.0% | 2882.7244 | 2881.4004 | 40 | 5.795 | 23.1% | 1 | R.LFTLAESLGGIESLLEVPAVMTHGGIPK.E | 3 |
| U | YNL112W | 1 | 1 | 7.0% | 546 | 60999 | 8.8 | DBP2 SGDID:S000005056, Chr XIV from 413641-414913,415916-416283, Verified ORF, "Essential ATP-dependent RNA helicase of the DEAD-box protein family, involved in nonsense-mediated mRNA decay and rRNA processing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20628.20628.3 | 3.9695 | 0.3109 | 100.0% | 4176.474 | 4172.6353 | 4 | 5.002 | 18.2% | 1 | K.QLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEK.R | 3 |
| U | YIL097W | 1 | 1 | 7.0% | 516 | 59894 | 7.1 | FYV10 SGDID:S000001359, Chr IX from 180424-181974, Verified ORF, "Protein of unknown function, required for survival upon exposure to K1 killer toxin; involved in proteasome-dependent catabolite inactivation of fructose-1,6-bisphosphatase; contains CTLH domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_23.17003.17003.4 | 3.4724 | 0.0645 | 90.3% | 4344.0967 | 4343.907 | 202 | 3.013 | 17.1% | 1 | K.SQSLPMKKDRIFQHFFHKS*LPRITSKPAVNTTDYDK.S | 4 |
| U | YNL301C | 1 | 1 | 7.0% | 186 | 20563 | 11.7 | RPL18B SGDID:S000005245, Chr XIV from 64562-64451,64018-63570, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Ap and has similarity to rat L18 ribosomal protein" |
| U | YOL120C | 1 | 1 | 7.0% | 186 | 20563 | 11.7 | RPL18A SGDID:S000005480, Chr XV from 94401-94290,93842-93394, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Bp and has similarity to rat L18 ribosomal protein; intron of RPL18A pre-mRNA forms stem-loop structures that are a target for Rnt1p cleavage leading to degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_10.05520.05520.2 | 3.7648 | 0.45 | 100.0% | 1331.8922 | 1332.4967 | 1 | 8.58 | 75.0% | 1 | K.TVVVVGTVTDDAR.I | 2 |
| U | YDR481C | 1 | 1 | 6.9% | 566 | 63004 | 5.6 | PHO8 SGDID:S000002889, Chr IV from 1420240-1418540, reverse complement, Verified ORF, "Repressible alkaline phosphatase, a glycoprotein localized to the vacuole; regulated by levels of inorganic phosphate and by a system consisting of Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.22997.22997.3 | 4.1562 | 0.1974 | 100.0% | 4552.074 | 4549.9976 | 17 | 4.676 | 17.8% | 1 | K.ATWSYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIR.D | 3 |
| U | YMR253C | 1 | 1 | 6.8% | 414 | 46659 | 8.8 | YMR253C SGDID:S000004866, Chr XIII from 777189-775945, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_7.12870.12870.3 | 2.7225 | 0.1253 | 90.8% | 3346.5842 | 3346.9182 | 214 | 3.487 | 22.2% | 1 | K.KQWILFGNLGVS*GFIFQLLLTMGIQRER.A | 3 |
| U | YJL008C | 1 | 1 | 6.7% | 568 | 61662 | 5.7 | CCT8 SGDID:S000003545, Chr X from 421578-419872, reverse complement, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19818.19818.3 | 5.482 | 0.3748 | 100.0% | 4165.7046 | 4162.6426 | 1 | 6.285 | 24.3% | 1 | K.KYGSEDILSELVSEAVSHVLPVAQQAGEIPYFNVDSIR.V | 3 |
| U | YNL124W | 1 | 1 | 6.7% | 492 | 54949 | 4.8 | NAF1 SGDID:S000005068, Chr XIV from 392894-394372, Verified ORF, "Protein required for the assembly of box H/ACA snoRNPs and for pre-rRNA processing, forms a complex with Shq1p and interacts with H/ACA snoRNP components Nhp2p and Cbf5p; has similarity to Gar1p and other RNA-binding proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.23611.23611.4 | 4.3991 | 0.302 | 100.0% | 3809.5366 | 3809.2373 | 400 | 5.597 | 18.2% | 1 | D.YEIS*EKTIITPIGVLKSAFENNIIIHATMS*GEK.R | 4 |
| U | YDR372C | 1 | 1 | 6.7% | 345 | 39287 | 5.1 | VPS74 SGDID:S000002780, Chr IV from 1222139-1221102, reverse complement, Verified ORF, "Non-essential protein of unknown function involved in vacuolar protein sorting; belongs to a family of cytosolic Golgi-associated proteins suggesting that it may play a role in secretion; also detected in the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22331.22331.2 | 4.0583 | 0.4253 | 100.0% | 2659.912 | 2658.9678 | 1 | 6.969 | 43.2% | 1 | K.NDEPLSISNWIDLLSGETWNLLK.I | 2 |
| U | YER074W | 1 | 4 | 6.7% | 135 | 15329 | 10.5 | RPS24A SGDID:S000000876, Chr V from 306319-306321,306788-307192, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" |
| U | YIL069C | 1 | 4 | 6.7% | 135 | 15329 | 10.5 | RPS24B SGDID:S000001331, Chr IX from 232366-232364,231954-231550, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_16.09255.09255.2 | 2.5483 | 0.252 | 100.0% | 999.3522 | 998.12646 | 1 | 5.707 | 81.2% | 4 | K.DAVSVFGFR.T | 2 |
| U | YIL005W | 1 | 1 | 6.6% | 701 | 81219 | 7.8 | EPS1 SGDID:S000001267, Chr IX from 345689-347794, Verified ORF, "Pdi1p (protein disulfide isomerase)-related protein involved in endoplasmic reticulum retention of resident ER proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21542.21542.4 | 3.5025 | 0.0975 | 95.6% | 5614.4165 | 5618.4023 | 48 | 3.592 | 14.8% | 1 | K.APANKIVDKMREEIPHMDQKKLLLGYLDISKEKNFFRKY*GITGEY*K.I | 4 |
| U | YBL039C | 2 | 2 | 6.6% | 579 | 64710 | 6.0 | URA7 SGDID:S000000135, Chr II from 145731-143992, reverse complement, Verified ORF, "Major CTP synthase isozyme (see also URA8), catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21530.21530.3 | 2.9724 | 0.1588 | 96.2% | 2638.7944 | 2639.1077 | 130 | 4.197 | 22.0% | 1 | K.VLDPSKPFLGLVAASAGILQDVIEGK.Y | 3 |
| * | Jamie_FT_01_itms_38.22266.22266.3 | 6.2463 | 0.34 | 100.0% | 4066.3743 | 4067.6282 | 1 | 6.552 | 25.0% | 1 | K.VLDPSKPFLGLVAASAGILQDVIEGKYDLEAGENKFNF.- | 3 |
| U | YJR007W | 1 | 1 | 6.6% | 304 | 34718 | 5.0 | SUI2 SGDID:S000003767, Chr X from 450934-451848, Verified ORF, "Alpha subunit of the translation initiation factor eIF2, involved in the identification of the start codon; phosphorylation of Ser51 is required for regulation of translation by inhibiting the exchange of GDP for GTP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_24.17547.17547.2 | 1.7355 | 0.0852 | 91.5% | 2279.3123 | 2278.7935 | 168 | 3.153 | 26.3% | 1 | R.IRSIQKLIRVGKNDVAVVLR.V | 2 |
| U | Reverse_YFL044C | 1 | 1 | 6.6% | 301 | 33510 | 5.3 | YFL044C SGDID:S000001850, Chr VI from 45560-44655, reverse complement, Uncharacterized ORF, "Protein of unknown function, proposed to act as a deubiquitinating (DUB) enzyme and/or transcription factor; contains a C2H2-type DNA-binding Zn finger domain; has similarity to the ovarian tumor (OTU) superfamily of cysteine proteases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_8.13766.13766.2 | 2.0643 | 0.1061 | 97.2% | 2205.7122 | 2208.344 | 26 | 3.091 | 34.2% | 1 | K.LNSALQLAAT*LVDDSEPQNK.N | 2 |
| U | YOL080C | 1 | 1 | 6.6% | 289 | 32895 | 9.8 | REX4 SGDID:S000005440, Chr XV from 181426-180557, reverse complement, Verified ORF, "Putative RNA exonuclease possibly involved in pre-rRNA processing and ribosome assembly" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_4.10876.10876.2 | 1.6562 | 0.1471 | 96.0% | 2231.7922 | 2233.6182 | 3 | 4.577 | 38.9% | 1 | R.ISIVNYFGHVVLDEFVKPR.E | 2 |
| U | YMR102C | 1 | 1 | 6.5% | 834 | 94254 | 8.7 | YMR102C SGDID:S000004708, Chr XIII from 472351-469847, reverse complement, Uncharacterized ORF, "Protein of unknown function, transcription is activated by paralogous transcription factors Yrm1p and Yrr1p along with genes involved in multidrug resistance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.14036.14036.4 | 3.1264 | 0.1009 | 93.6% | 6362.9766 | 6359.0464 | 297 | 3.643 | 12.3% | 1 | K.RKPKGLARSGS*LRSIFSKSMSRSSSQNNEEKPHHHLKLTNLLPLPHHSNDHY*IK.N | 4 |
| U | YMR179W | 1 | 1 | 6.3% | 758 | 84697 | 6.0 | SPT21 SGDID:S000004791, Chr XIII from 619857-622133, Verified ORF, "Protein required for normal transcription at several loci including HTA2-HTB2 and HHF2-HHT2, but not required at the other histone loci; functionally related to Spt10p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20858.20858.4 | 3.5648 | 0.0608 | 90.8% | 5494.4565 | 5493.8076 | 271 | 3.063 | 13.8% | 1 | K.NS*AKSTQAGCRRSSVIEHLNDHDDSILSDILS*EPGIEGQKLQQKQKGR.K | 4 |
| U | YBR117C | 1 | 1 | 6.3% | 681 | 75029 | 6.1 | TKL2 SGDID:S000000321, Chr II from 476431-474386, reverse complement, Verified ORF, "Transketolase, similar to Tkl1p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21422.21422.3 | 3.1859 | 0.1142 | 94.7% | 5036.7544 | 5039.399 | 237 | 3.343 | 13.7% | 1 | K.YAHQS*FGLDEFGRS*GKGPEIYKLFDFTADGVASRAEKTINYYK.G | 3 |
| U | YGR124W | 1 | 1 | 6.3% | 572 | 64593 | 5.9 | ASN2 SGDID:S000003356, Chr VII from 739949-741667, Verified ORF, "Asparagine synthetase, isozyme of Asn1p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" |
| U | YPR145W | 1 | 1 | 6.3% | 572 | 64470 | 6.1 | ASN1 SGDID:S000006349, Chr XVI from 822616-824334, Verified ORF, "Asparagine synthetase, isozyme of Asn2p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_30.17623.17623.4 | 4.4029 | 0.195 | 100.0% | 4203.3364 | 4201.6387 | 8 | 3.942 | 20.0% | 1 | K.FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIR.A | 4 |
| U | YKL133C | 1 | 1 | 6.3% | 463 | 54438 | 9.1 | YKL133C SGDID:S000001616, Chr XI from 193069-191678, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_05_itms_2.12951.12951.3 | 2.4032 | 0.1575 | 91.4% | 3346.7344 | 3347.8853 | 87 | 4.029 | 19.6% | 1 | K.NVLSKSELLNNQQLDWKNFKGLPFIGKSK.P | 3 |
| U | YML085C | 1 | 2 | 6.3% | 447 | 49800 | 5.1 | TUB1 SGDID:S000004550, Chr XIII from 99400-99376,99259-97941, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22721.22721.3 | 4.496 | 0.4296 | 100.0% | 3011.2444 | 3011.4514 | 1 | 7.025 | 25.9% | 2 | R.NLDIPRPSFANLNNLIAQVVSSVTASLR.F | 3 |
| U | YOR201C | 2 | 5 | 6.3% | 412 | 46387 | 9.2 | YOR201C SGDID:S000005727, Chr XV from 721708-720470, reverse complement, Verified ORF, "Ribose methyltransferase that modifies a functionally critical, conserved nucleotide in mitochondrial 21S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_23.16891.16891.3 | 3.5878 | 0.2632 | 100.0% | 2767.3442 | 2768.1865 | 3 | 5.262 | 27.0% | 2 | R.APEPIVDSLNVSVATALLIDNILTCK.- | 3 |
| * | Jamie_FT_01_itms_36.21086.21086.2 | 5.0681 | 0.4533 | 100.0% | 2769.8323 | 2768.1865 | 1 | 8.13 | 50.0% | 3 | R.APEPIVDSLNVSVATALLIDNILTCK.- | 2 |
| U | YBR002C | 1 | 1 | 6.3% | 286 | 32694 | 7.8 | RER2 SGDID:S000000206, Chr II from 242570-241710, reverse complement, Verified ORF, "Cis-prenyltransferase involved in dolichol synthesis; participates in endoplasmic reticulum (ER) protein sorting" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14646.14646.2 | 2.0172 | 0.0427 | 90.8% | 2200.0923 | 2198.3008 | 10 | 3.748 | 35.3% | 1 | K.KEMDVKEGHEAGFVS*MS*R.I | 2 |
| U | YGL147C | 1 | 1 | 6.3% | 191 | 21569 | 9.7 | RPL9A SGDID:S000003115, Chr VII from 228334-227759, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins" |
| U | YNL067W | 1 | 1 | 6.3% | 191 | 21657 | 9.7 | RPL9B SGDID:S000005011, Chr XIV from 499682-500257, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Ap and has similarity to E. coli L6 and rat L9 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_15.08964.08964.2 | 2.101 | 0.1201 | 98.2% | 1278.4521 | 1278.5066 | 19 | 3.867 | 59.1% | 1 | K.SLVDNMITGVTK.G | 2 |
| U | Reverse_YDR099W | 1 | 1 | 6.2% | 273 | 31061 | 4.9 | BMH2 SGDID:S000002506, Chr IV from 653602-654423, Verified ORF, "14-3-3 protein, minor isoform; binds proteins and DNA, involved in regulation of many processes including exocytosis and vesicle transport, Ras/MAPK signaling during pseudohyphal development, rapamycin-sensitive signaling, and others" |
| U | Reverse_YER177W | 1 | 1 | 6.4% | 267 | 30091 | 4.9 | BMH1 SGDID:S000000979, Chr V from 545606-546409, Verified ORF, "14-3-3 protein, major isoform; binds proteins and DNA, involved in regulation of many processes including exocytosis and vesicle transport, Ras/MAPK signaling during pseudohyphal development, rapamycin-sensitive signaling, and others" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_20.11450.11450.2 | 1.7419 | 0.1293 | 95.6% | 1886.5322 | 1887.0538 | 2 | 4.472 | 46.9% | 1 | R.IPHTPPLETTAIESAT*K.Y | 2 |
| U | Reverse_YLL023C | 1 | 1 | 6.1% | 279 | 32186 | 10.0 | YLL023C SGDID:S000003946, Chr XII from 98835-97996, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_13.07418.07418.4 | 2.9921 | 0.0811 | 91.6% | 2220.4966 | 2215.4912 | 68 | 3.624 | 31.2% | 1 | R.WQAFAAKMYKS*NEYRLK.I | 4 |
| U | YNL069C | 1 | 8 | 6.1% | 198 | 22249 | 10.5 | RPL16B SGDID:S000005013, Chr XIV from 495002-494975,494525-493957, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has similarity to Rpl16Ap, E. coli L13 and rat L13a ribosomal proteins; transcriptionally regulated by Rap1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_16.09299.09299.2 | 3.3099 | 0.2697 | 100.0% | 1356.0322 | 1354.5052 | 1 | 5.339 | 72.7% | 8 | R.AEALNISGEFFR.N | 2 |
| U | YGL135W | 1 | 3 | 6.0% | 217 | 24486 | 9.7 | RPL1B SGDID:S000003103, Chr VII from 254646-255299, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal" |
| U | YPL220W | 1 | 3 | 6.0% | 217 | 24486 | 9.7 | RPL1A SGDID:S000006141, Chr XVI from 135789-136442, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl1Bp and has similarity to E. coli L1 and rat L10a ribosomal proteins; rpl1a rpl1b double null mutation is lethal" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_23.13322.13322.2 | 4.5032 | 0.3604 | 100.0% | 1492.6921 | 1490.7399 | 1 | 6.767 | 83.3% | 3 | R.NFLETVELQVGLK.N | 2 |
| U | YIL133C | 1 | 3 | 6.0% | 199 | 22201 | 10.5 | RPL16A SGDID:S000001395, Chr IX from 99416-99386,99095-98527, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has similarity to Rpl16Bp, E. coli L13 and rat L13a ribosomal proteins; transcriptionally regulated by Rap1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_17.10195.10195.2 | 2.1892 | 0.0571 | 95.7% | 1411.8922 | 1412.5419 | 14 | 3.514 | 63.6% | 3 | R.AEELNISGEFFR.N | 2 |
| U | YLR090W | 1 | 1 | 5.9% | 459 | 51347 | 6.2 | XDJ1 SGDID:S000004080, Chr XII from 320702-322081, Verified ORF, "Putative chaperone, homolog of E. coli DnaJ, closely related to Ydj1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20487.20487.2 | 2.1089 | 0.0394 | 92.3% | 2895.0522 | 2895.1028 | 12 | 2.885 | 25.0% | 1 | K.NFDDGAGEDLYTSITISLSEALTGFEK.F | 2 |
| U | Reverse_YGL105W | 1 | 1 | 5.9% | 376 | 42084 | 7.9 | ARC1 SGDID:S000003073, Chr VII from 307440-308570, Verified ORF, "Protein that binds tRNA and methionyl- and glutamyl-tRNA synthetases (Mes1p and Gus1p), delivering tRNA to them, stimulating catalysis, and ensuring their localization to the cytoplasm; also binds quadruplex nucleic acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15167.15167.2 | 1.8583 | 0.0648 | 91.2% | 2390.0122 | 2389.7634 | 59 | 3.164 | 28.6% | 1 | -.RVQANAISAVKFSEGKANTLKR.V | 2 |
| U | Reverse_YCL050C | 1 | 1 | 5.9% | 321 | 36493 | 5.0 | APA1 SGDID:S000000555, Chr III from 38801-37836, reverse complement, Verified ORF, "Diadenosine 5',5''-P1,P4-tetraphosphate phosphorylase I (AP4A phosphorylase), involved in catabolism of bis(5'-nucleosidyl) tetraphosphates; has similarity to Apa2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_26.18835.18835.2 | 1.6193 | 0.1054 | 91.9% | 2287.392 | 2286.46 | 71 | 3.385 | 30.6% | 1 | K.TTETQIFKLNGNDFAS*KYK.D | 2 |
| U | Reverse_YKL064W | 1 | 1 | 5.7% | 969 | 109736 | 7.5 | MNR2 SGDID:S000001547, Chr XI from 317408-320317, Verified ORF, "Putative magnesium transporter; has similarity to Alr1p and Alr2p, which mediate influx of Mg2+ and other divalent cations" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_37.25379.25379.4 | 2.1776 | 0.1932 | 93.7% | 6604.5366 | 6603.178 | 53 | 3.216 | 12.7% | 1 | K.TMDINIQALYNSHSRSLLKEYHNLSSVMT*VIHDQIDGLY*MAIESQPSAEWQENYR.K | 4 |
| U | YJR121W | 2 | 7 | 5.7% | 511 | 54794 | 5.7 | ATP2 SGDID:S000003882, Chr X from 647522-649057, Verified ORF, "Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21564.21564.2 | 3.1357 | 0.2911 | 100.0% | 3359.5122 | 3359.8035 | 4 | 4.876 | 25.0% | 1 | R.VALTGLTIAEYFRDEEGQDVLLFIDNIFR.F | 2 |
| * | Jamie_FT_04_itms_13.18037.18037.2 | 4.2959 | 0.4061 | 100.0% | 1922.9722 | 1924.1174 | 1 | 6.59 | 63.3% | 6 | R.DEEGQDVLLFIDNIFR.F | 2 |
| U | YLR448W | 1 | 1 | 5.7% | 176 | 19986 | 10.1 | RPL6B SGDID:S000004440, Chr XII from 1028849-1028863,1029248-1029763, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Bp and to rat L6 ribosomal protein; binds to 5.8S rRNA" |
| U | YML073C | 1 | 1 | 5.7% | 176 | 19961 | 10.1 | RPL6A SGDID:S000004538, Chr XIII from 124172-124158,123742-123227, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Bp and to rat L6 ribosomal protein; binds to 5.8S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_9.05250.05250.2 | 2.0437 | 0.1662 | 99.5% | 1059.0322 | 1060.1925 | 10 | 4.401 | 72.2% | 1 | K.VSVEGVNVEK.F | 2 |
| U | Reverse_YPL089C | 1 | 1 | 5.6% | 676 | 73484 | 9.3 | RLM1 SGDID:S000006010, Chr XVI from 381147-379117, reverse complement, Verified ORF, "MADS-box transcription factor, component of the protein kinase C-mediated MAP kinase pathway involved in the maintenance of cell integrity; phosphorylated and activated by the MAP-kinase Slt2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20600.20600.4 | 3.5834 | 0.0966 | 95.6% | 4435.9766 | 4433.724 | 226 | 3.494 | 16.2% | 1 | K.SPKNSMS*SRLLDQNINVS*ASKHFDGYDSPDKVEHLLNK.D | 4 |
| U | YER062C | 1 | 1 | 5.6% | 250 | 27814 | 6.2 | HOR2 SGDID:S000000864, Chr V from 280680-279928, reverse complement, Verified ORF, "One of two redundant DL-glycerol-3-phosphatases (RHR2/GPP1 encodes the other) involved in glycerol biosynthesis; induced in response to hyperosmotic stress and oxidative stress, and during the diauxic transition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07044.07044.4 | 3.1272 | 0.0736 | 94.4% | 1726.5765 | 1727.8657 | 289 | 3.155 | 38.5% | 1 | K.IIGIAT*T*FDLDFLK.E | 4 |
| U | YBL057C | 1 | 1 | 5.6% | 214 | 23128 | 5.4 | PTH2 SGDID:S000000153, Chr II from 113447-112803, reverse complement, Verified ORF, "One of two (see also PTH1) mitochondrially-localized peptidyl-tRNA hydrolases; dispensable for cell growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07033.07033.2 | 2.5469 | 0.0655 | 97.9% | 1431.3922 | 1431.6042 | 9 | 3.885 | 59.1% | 1 | K.SSAT*LLRSKEMK.E | 2 |
| U | YGR145W | 1 | 1 | 5.5% | 707 | 81748 | 6.6 | ENP2 SGDID:S000003377, Chr VII from 781772-783895, Uncharacterized ORF, "Essential nucleolar protein of unknown function; contains WD repeats, interacts with Mpp10p and Bfr2p, and has homology to Spb1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_11.09786.09786.4 | 3.586 | 0.0824 | 94.6% | 4506.2563 | 4504.827 | 1 | 3.31 | 18.9% | 1 | R.FLNPFKLDT*EGVNHVS*INEVNGLLAAGTETNVVEFWDPR.S | 4 |
| U | YGL026C | 1 | 1 | 5.5% | 707 | 76626 | 6.5 | TRP5 SGDID:S000002994, Chr VII from 448540-446417, reverse complement, Verified ORF, "Tryptophan synthase involved in tryptophan biosynthesis, regulated by the general control system of amino acid biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_23.16854.16854.4 | 4.099 | 0.2644 | 100.0% | 4418.2163 | 4412.8296 | 309 | 4.712 | 17.5% | 1 | R.LELLSHIADSFVYVVSRMGTTGVQSSVAS*DLDELIS*RVR.K | 4 |
| U | Reverse_YDR034C-C | 1 | 1 | 5.5% | 438 | 49689 | 7.7 | YDR034C-C SGDID:S000007344, Chr IV from 519352-518036, reverse complement, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | Reverse_YLR410W-B | 1 | 1 | 1.4% | 1770 | 202121 | 8.2 | YLR410W-B SGDID:S000007380, Chr XII from 941480-942772,942774-946793, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| U | Reverse_YLR410W-A | 1 | 1 | 5.5% | 438 | 49771 | 7.7 | YLR410W-A SGDID:S000007379, Chr XII from 941480-942796, transposable_element_gene, "TyA Gag protein; the main structural constituent of virus-like particles (VLPs)" |
| U | Reverse_YDR034C-D | 1 | 1 | 1.4% | 1770 | 201964 | 8.2 | YDR034C-D SGDID:S000007345, Chr IV from 519352-518060,518058-514039, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_31.18113.18113.3 | 2.8128 | 0.1139 | 90.2% | 2863.2244 | 2860.0232 | 84 | 3.351 | 23.9% | 1 | K.VWTSFNEESTLT*HPPLVNNGVKT*K.A | 3 |
| U | YDL082W | 1 | 1 | 5.5% | 199 | 22554 | 11.2 | RPL13A SGDID:S000002240, Chr IV from 308424-308427,308793-309388, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Bp; not essential for viability; has similarity to rat L13 ribosomal protein" |
| U | YMR142C | 1 | 1 | 5.5% | 199 | 22525 | 11.1 | RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_10.05503.05503.2 | 3.1319 | 0.2697 | 100.0% | 1335.5721 | 1334.4313 | 12 | 4.879 | 70.0% | 1 | R.NQEIFDANVQR.L | 2 |
| U | YHR019C | 2 | 2 | 5.4% | 554 | 62207 | 5.8 | DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23235.23235.4 | 4.8293 | 0.3488 | 100.0% | 3542.1765 | 3541.038 | 1 | 5.528 | 27.6% | 1 | R.HLSEYTHIEAELAFLTFDDLLQHIETLIVK.S | 4 |
| * | Jamie_FT_01_itms_39.23112.23112.3 | 4.5851 | 0.3109 | 100.0% | 3545.4543 | 3541.038 | 1 | 5.656 | 27.6% | 1 | R.HLSEYTHIEAELAFLTFDDLLQHIETLIVK.S | 3 |
| U | YPR036W | 1 | 1 | 5.4% | 478 | 54416 | 6.4 | VMA13 SGDID:S000006240, Chr XVI from 643833-645269, Verified ORF, "Subunit H of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; serves as an activator or a structural stabilizer of the V-ATPase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22260.22260.2 | 3.9326 | 0.3221 | 100.0% | 2902.2522 | 2901.4136 | 1 | 5.998 | 36.0% | 1 | K.IIIQVALNDITHVVELLPESIDVLDK.T | 2 |
| U | Reverse_YCR028C | 1 | 1 | 5.3% | 512 | 58257 | 7.2 | FEN2 SGDID:S000000623, Chr III from 172419-170881, reverse complement, Verified ORF, "Plasma membrane H+-pantothenate symporter; confers sensitivity to the antifungal agent fenpropimorph" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_41.24201.24201.2 | 1.5482 | 0.1319 | 93.3% | 3108.912 | 3106.4004 | 28 | 3.026 | 23.1% | 1 | R.PIKSMY*VAS*CLTSVIGVAFIGSPYNNR.Q | 2 |
| U | YBR283C | 1 | 1 | 5.3% | 490 | 53312 | 8.1 | SSH1 SGDID:S000000487, Chr II from 770411-768939, reverse complement, Verified ORF, "Subunit of the Ssh1 translocon complex; Sec61p homolog involved in co-translational pathway of protein translocation; not essential" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_49.29378.29378.3 | 4.2574 | 0.3463 | 100.0% | 2526.2043 | 2523.072 | 1 | 6.277 | 35.0% | 1 | K.VIPIAAVTGASVLSLITVIGESLGLK.G | 3 |
| U | YLR212C | 1 | 2 | 5.3% | 473 | 52628 | 4.7 | TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_31.18324.18324.2 | 3.915 | 0.2468 | 100.0% | 2781.0122 | 2780.1106 | 1 | 5.576 | 35.4% | 2 | R.NPNIDLQHTNQLISTIISSVTNSIR.F | 2 |
| U | YLR355C | 1 | 1 | 5.3% | 395 | 44368 | 9.0 | ILV5 SGDID:S000004347, Chr XII from 839252-838065, reverse complement, Verified ORF, "Acetohydroxyacid reductoisomerase, mitochondrial protein involved in branched-chain amino acid biosynthesis, also required for maintenance of wild-type mitochondrial DNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.10926.10926.2 | 2.3871 | 0.2485 | 100.0% | 2245.892 | 2245.4563 | 13 | 5.149 | 35.0% | 1 | K.NDTFALIGYGSQGYGQGLNLR.D | 2 |
| U | YDL198C | 1 | 1 | 5.3% | 300 | 33215 | 10.0 | GGC1 SGDID:S000002357, Chr IV from 104552-103650, reverse complement, Verified ORF, "Mitochondrial GTP/GDP transporter, essential for mitochondrial genome maintenance; has a role in mitochondrial iron transport; member of the mitochondrial carrier family; (putative) mitochondrial carrier protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14421.14421.2 | 2.2105 | 0.158 | 99.5% | 1957.4722 | 1955.3103 | 198 | 4.179 | 33.3% | 1 | R.GFIKILRDEGLFNLYR.G | 2 |
| U | Reverse_YLL041C | 1 | 1 | 5.3% | 266 | 30231 | 8.8 | SDH2 SGDID:S000003964, Chr XII from 53930-53130, reverse complement, Verified ORF, "Iron-sulfur protein subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer of electrons to ubiquinone" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_41.27558.27558.2 | 2.3383 | 0.1005 | 98.1% | 1817.6522 | 1817.9868 | 61 | 3.615 | 42.3% | 1 | R.YLSMS*NNLMAKRT*K.T | 2 |
| U | YER001W | 1 | 1 | 5.2% | 762 | 88529 | 7.2 | MNN1 SGDID:S000000803, Chr V from 153519-155807, Verified ORF, "Alpha-1,3-mannosyltransferase, integral membrane glycoprotein of the Golgi complex, required for addition of alpha1,3-mannose linkages to N-linked and O-linked oligosaccharides, one of five S. cerevisiae proteins of the MNN1 family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_27.15978.15978.4 | 4.5077 | 0.1632 | 100.0% | 4483.5767 | 4479.8345 | 186 | 3.533 | 16.2% | 1 | K.NTAHCTHGDKENFWLGFLAAGHTYALQGVY*SGAIGDYVKK.T | 4 |
| U | YGL236C | 1 | 1 | 5.2% | 669 | 74215 | 8.3 | MTO1 SGDID:S000003205, Chr VII from 55796-53787, reverse complement, Verified ORF, "Mitochondrial protein, forms a heterodimer complex with Mss1p that performs the 5-carboxymethylaminomethyl modification of the wobble uridine base in mitochondrial tRNAs; required for respiration in paromomycin-resistant 15S rRNA mutants" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_9.15574.15574.4 | 2.2569 | 0.1795 | 93.5% | 3772.6965 | 3772.115 | 392 | 3.974 | 18.1% | 1 | K.VIKGVVLDDGT*QVGADQVIITTGTFLS*AEIHIGDK.R | 4 |
| U | YMR296C | 1 | 1 | 5.2% | 558 | 62207 | 6.2 | LCB1 SGDID:S000004911, Chr XIII from 860890-859214, reverse complement, Verified ORF, "Component of serine palmitoyltransferase, responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.19136.19136.3 | 4.3642 | 0.2542 | 100.0% | 3524.9343 | 3524.9954 | 221 | 5.831 | 22.3% | 1 | K.FIEPYEEEEKFLQSIVDHALINYNVLITR.N | 3 |
| U | YGR175C | 1 | 1 | 5.2% | 496 | 55126 | 6.5 | ERG1 SGDID:S000003407, Chr VII from 848428-846938, reverse complement, Verified ORF, "Squalene epoxidase, catalyzes the epoxidation of squalene to 2,3-oxidosqualene; plays an essential role in the ergosterol-biosynthesis pathway and is the specific target of the antifungal drug terbinafine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20712.20712.2 | 3.1167 | 0.2798 | 100.0% | 2835.9722 | 2834.1956 | 1 | 5.739 | 30.0% | 1 | R.KSYDSVINVLSVALYSLFAADSDNLK.A | 2 |
| U | Reverse_YOR100C | 1 | 1 | 5.2% | 327 | 34754 | 9.8 | CRC1 SGDID:S000005626, Chr XV from 514278-513295, reverse complement, Verified ORF, "Mitochondrial inner membrane carnitine transporter, required for carnitine-dependent transport of acetyl-CoA from peroxisomes to mitochondria during fatty acid beta-oxidation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17491.17491.2 | 1.7586 | 0.1192 | 94.5% | 1997.6122 | 1999.231 | 128 | 3.65 | 34.4% | 1 | K.YFGKVSNTFLTGKVQT*K.A | 2 |
| U | YGL031C | 1 | 2 | 5.2% | 155 | 17614 | 11.3 | RPL24A SGDID:S000002999, Chr VII from 437939-437472, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Bp and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
| U | YGR148C | 1 | 2 | 5.2% | 155 | 17547 | 11.4 | RPL24B SGDID:S000003380, Chr VII from 787784-787317, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Ap and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_20.11665.11665.2 | 2.2668 | 0.1895 | 100.0% | 1006.1722 | 1006.2358 | 2 | 5.144 | 85.7% | 2 | R.IAWTVLFR.K | 2 |
| U | Reverse_YPL103C | 1 | 1 | 5.1% | 468 | 54368 | 7.8 | YPL103C SGDID:S000006024, Chr XVI from 359403-357997, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.22115.22115.2 | 2.25 | 0.0311 | 92.8% | 3049.5723 | 3050.2031 | 121 | 2.715 | 26.1% | 1 | K.KVQLTEWWSLELVNDCGNSTMY*S*K.M | 2 |
| U | YEL002C | 1 | 1 | 5.1% | 430 | 49392 | 5.9 | WBP1 SGDID:S000000728, Chr V from 150013-148721, reverse complement, Verified ORF, "Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_27.15786.15786.3 | 2.6156 | 0.1813 | 96.2% | 2629.0144 | 2631.645 | 137 | 3.796 | 26.2% | 1 | K.SVHAVHS*HADGTS*YDEEPYKIK.D | 3 |
| U | YOR051C | 2 | 2 | 5.1% | 412 | 47352 | 4.8 | YOR051C SGDID:S000005577, Chr XV from 426085-424847, reverse complement, Uncharacterized ORF, "Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23097.23097.3 | 3.8781 | 0.3128 | 100.0% | 2380.2544 | 2380.7893 | 3 | 5.262 | 33.8% | 1 | K.TLNDIFHGIYALALSELTIFK.A | 3 |
| * | Jamie_FT_01_itms_39.23083.23083.2 | 4.9731 | 0.5208 | 100.0% | 2380.8523 | 2380.7893 | 1 | 8.237 | 52.5% | 1 | K.TLNDIFHGIYALALSELTIFK.A | 2 |
| U | YLR197W | 1 | 1 | 5.0% | 504 | 56864 | 8.9 | SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17959.17959.3 | 3.8104 | 0.2497 | 100.0% | 2886.4744 | 2884.2798 | 30 | 4.393 | 25.0% | 1 | K.NDNHIIQAIALLDQLDKDINTFAMR.V | 3 |
| U | YDL055C | 1 | 2 | 5.0% | 361 | 39566 | 6.3 | PSA1 SGDID:S000002213, Chr IV from 356759-355674, reverse complement, Verified ORF, "GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase), synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_16.09041.09041.2 | 2.6552 | 0.0554 | 97.5% | 1778.6122 | 1779.0464 | 4 | 4.719 | 47.1% | 2 | K.IGPDVVIGPNVTIGDGVR.I | 2 |
| U | YGR086C | 1 | 1 | 5.0% | 339 | 38349 | 4.6 | PIL1 SGDID:S000003318, Chr VII from 650621-649602, reverse complement, Verified ORF, "Long chain base-responsive inhibitor of protein kinases Pkh1p and Pkh2p, acts along with Lsp1p to down-regulate heat stress resistance via regulation of the Pkc1p and Ypk1p pathways; phosphorylated by Phk1p and Phk2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_30.21169.21169.2 | 1.7315 | 0.0963 | 92.7% | 1906.5721 | 1907.0416 | 29 | 3.258 | 37.5% | 1 | K.ALLELLDDSPVTPGET*R.P | 2 |
| U | YBR191W | 1 | 1 | 5.0% | 160 | 18242 | 10.4 | RPL21A SGDID:S000000395, Chr II from 606265-606275,606664-607135, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp and has similarity to rat L21 ribosomal protein" |
| U | YPL079W | 1 | 1 | 5.0% | 160 | 18274 | 10.4 | RPL21B SGDID:S000006000, Chr XVI from 406633-406643,407065-407536, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Ap and has similarity to rat L21 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_10.05557.05557.2 | 2.2044 | 0.1807 | 100.0% | 859.03217 | 859.01044 | 1 | 4.448 | 85.7% | 1 | K.VGDIVDIK.A | 2 |
| U | Reverse_YDR006C | 1 | 1 | 4.9% | 901 | 101082 | 9.1 | SOK1 SGDID:S000002413, Chr IV from 461244-458539, reverse complement, Verified ORF, "Protein whose overexpression suppresses the growth defect of mutants lacking protein kinase A activity; involved in cAMP-mediated signaling; localized to the nucleus; similar to the mouse testis-specific protein PBS13" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20652.20652.3 | 2.9768 | 0.1089 | 92.2% | 4669.344 | 4668.7393 | 86 | 3.055 | 14.5% | 1 | K.LDSSNASNGSSDNNTANT*SANLSMSPT*IVGSSRSLLDSSQDIYK.Q | 3 |
| U | YLL024C | 2 | 5 | 4.9% | 639 | 69470 | 5.1 | SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.13526.13526.3 | 6.401 | 0.3865 | 100.0% | 3365.3342 | 3365.8047 | 1 | 8.191 | 34.2% | 4 | K.GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVK.A | 3 |
| * | Jamie_FT_02_itms_18.13535.13535.4 | 4.5131 | 0.2189 | 100.0% | 3366.0566 | 3365.8047 | 1 | 4.502 | 23.9% | 1 | K.GKEEHVLIFDLGGGTFDVSLLSIEDGIFEVK.A | 4 |
| U | YNL041C | 1 | 1 | 4.8% | 839 | 96976 | 5.3 | COG6 SGDID:S000004986, Chr XIV from 551988-549469, reverse complement, Verified ORF, "Component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.16964.16964.4 | 3.6875 | 0.0742 | 94.4% | 4816.0967 | 4821.2266 | 40 | 3.1 | 16.7% | 1 | R.IKRLS*S*SVEKIQRTSEKLLSNETNEVPTNNVVLQEIDQYR.L | 4 |
| U | YKL049C | 1 | 1 | 4.8% | 229 | 26841 | 9.3 | CSE4 SGDID:S000001532, Chr XI from 346408-345719, reverse complement, Verified ORF, "Centromere protein that resembles histones, required for proper kinetochore function; homolog of human CENP-A" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.11372.11372.2 | 1.6599 | 0.0994 | 93.3% | 1485.9922 | 1484.5199 | 7 | 3.368 | 60.0% | 1 | K.Y*QRSTDLLIS*K.I | 2 |
| U | YKL104C | 2 | 2 | 4.7% | 717 | 80047 | 6.4 | GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_12.10167.10167.2 | 1.9154 | 0.1487 | 97.8% | 1710.4922 | 1708.0143 | 6 | 4.179 | 42.9% | 1 | K.LVLLELEGSYGLLCK.S | 2 |
| * | Jamie_FT_01_itms_23.13475.13475.2 | 2.5165 | 0.0898 | 98.6% | 2037.0922 | 2036.3818 | 30 | 3.827 | 38.9% | 1 | K.HGVLALVDENLPIIAFGTR.D | 2 |
| U | Reverse_YDR131C | 1 | 1 | 4.7% | 556 | 65243 | 7.1 | YDR131C SGDID:S000002538, Chr IV from 718455-716785, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_41.27386.27386.3 | 2.9142 | 0.1893 | 97.1% | 3005.0044 | 3003.311 | 24 | 4.407 | 27.0% | 1 | K.NLYSGSVSNHTPMLTPPT*LT*LTKLQK.S | 3 |
| U | YHR007C | 2 | 2 | 4.7% | 530 | 60720 | 8.7 | ERG11 SGDID:S000001049, Chr VIII from 121678-120086, reverse complement, Verified ORF, "Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23251.23251.2 | 2.7006 | 0.1681 | 100.0% | 2710.5322 | 2712.1643 | 44 | 4.468 | 25.0% | 1 | K.SIVGEALEYVNIGLSHFLALPLAQR.I | 2 |
| * | Jamie_FT_01_itms_39.23341.23341.3 | 5.3068 | 0.4894 | 100.0% | 2711.6943 | 2712.1643 | 1 | 8.681 | 36.5% | 1 | K.SIVGEALEYVNIGLSHFLALPLAQR.I | 3 |
| U | Reverse_YIR026C | 1 | 1 | 4.7% | 364 | 41185 | 8.0 | YVH1 SGDID:S000001465, Chr IX from 405964-404870, reverse complement, Verified ORF, "Protein phosphatase involved in vegetative growth at low temperatures, sporulation, and glycogen accumulation; transcription induced by low temperature and nitrogen starvation; member of the dual-specificity family of protein phosphatases" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_16.12408.12408.2 | 1.898 | 0.2289 | 99.6% | 2171.8123 | 2174.267 | 176 | 4.182 | 34.4% | 1 | K.S*T*QLHIAPIVWKGCSCR.S | 2 |
| U | Reverse_YNL267W | 1 | 1 | 4.6% | 1066 | 119923 | 6.5 | PIK1 SGDID:S000005211, Chr XIV from 140879-144079, Verified ORF, "Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokineses through the actin cytoskeleton" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21601.21601.4 | 3.6002 | 0.0989 | 95.8% | 5662.0166 | 5656.165 | 233 | 3.378 | 13.9% | 1 | R.GKPSIYDGKNGDLAKATNS*ISGDRNINKGDYTRHVYSNDLY*KPKRKPLK.I | 4 |
| U | YPL106C | 2 | 2 | 4.6% | 693 | 77367 | 5.2 | SSE1 SGDID:S000006027, Chr XVI from 352272-350191, reverse complement, Verified ORF, "ATPase that is a component of the heat shock protein Hsp90 chaperone complex; binds unfolded proteins; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_9.05045.05045.2 | 1.6233 | 0.0727 | 91.4% | 894.6722 | 893.9749 | 7 | 3.145 | 78.6% | 1 | R.YNIADAAR.I | 2 | |
| * | Jamie_FT_03_itms_14.17014.17014.2 | 1.7792 | 0.0894 | 92.7% | 2633.5723 | 2635.8938 | 8 | 3.799 | 26.1% | 1 | R.IAGLNPVRIVNDVTAAGVS*Y*GIFK.T | 2 |
| U | YHR203C | 2 | 7 | 4.6% | 261 | 29410 | 10.1 | RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| U | YJR145C | 2 | 7 | 4.6% | 261 | 29410 | 10.1 | RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_21.12218.12218.3 | 3.3029 | 0.0985 | 97.1% | 1456.3143 | 1456.8148 | 62 | 4.088 | 50.0% | 4 | K.LRESLPLIVFLR.N | 3 | |
| Jamie_FT_01_itms_20.11989.11989.2 | 2.8623 | 0.2658 | 100.0% | 1456.6122 | 1456.8148 | 14 | 5.331 | 54.5% | 3 | K.LRESLPLIVFLR.N | 2 |
| U | Reverse_YPR162C | 1 | 1 | 4.5% | 529 | 60706 | 6.8 | ORC4 SGDID:S000006366, Chr XVI from 868300-866711, reverse complement, Verified ORF, "Subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.17304.17304.2 | 2.4038 | 0.1542 | 99.4% | 2653.9722 | 2651.7605 | 98 | 4.03 | 26.1% | 1 | K.ITNDISFTSQGT*GVNT*TPAVTPIR.S | 2 |
| U | YDR219C | 1 | 1 | 4.5% | 465 | 53168 | 8.7 | YDR219C SGDID:S000002627, Chr IV from 906846-905449, reverse complement, Uncharacterized ORF, "Mitochondria-associated F-box protein involved in maintenance of normal mitochondrial morphology" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_38.25535.25535.2 | 1.1615 | 0.2428 | 96.2% | 2374.9321 | 2377.7031 | 80 | 4.101 | 20.0% | 1 | K.LGVIDPARKTISYRTNEVESK.E | 2 |
| U | Reverse_YKL141W | 1 | 1 | 4.5% | 198 | 22068 | 10.2 | SDH3 SGDID:S000001624, Chr XI from 179672-180268, Verified ORF, "Cytochrome b subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer of electrons to ubiquinone" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_10.05523.05523.2 | 1.5701 | 0.1004 | 92.6% | 916.5722 | 919.0286 | 450 | 3.507 | 68.8% | 1 | R.RSSSLAAAR.S | 2 |
| U | YJL012C | 1 | 1 | 4.4% | 721 | 83155 | 6.8 | VTC4 SGDID:S000003549, Chr X from 413314-411149, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.21941.21941.3 | 4.1516 | 0.3296 | 100.0% | 3608.9043 | 3608.9783 | 1 | 5.21 | 25.0% | 1 | R.LLDSNNPPTQLDFEILEEELSDIIADVHDLAK.F | 3 |
| U | Reverse_YDR244W | 1 | 1 | 4.4% | 612 | 69324 | 5.0 | PEX5 SGDID:S000002652, Chr IV from 950557-952395, Verified ORF, "Peroxisomal membrane signal receptor for C-terminal tripeptide signal sequence (PTS1) of peroxisomal matrix proteins, required for peroxisomal matrix protein import, tetratricopeptide repeat protein, also involved in PTS1-independent import" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.22851.22851.2 | 2.3345 | 0.2677 | 90.6% | 2994.632 | 2996.1338 | 148 | 5.127 | 23.1% | 1 | K.IQTPNAST*QLSHVNSFPPLRGSS*PGIE.M | 2 |
| U | YFL037W | 1 | 1 | 4.4% | 457 | 50923 | 4.7 | TUB2 SGDID:S000001857, Chr VI from 56335-57708, Verified ORF, "Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_22.13028.13028.3 | 3.176 | 0.087 | 93.8% | 2243.1543 | 2243.631 | 59 | 3.332 | 30.3% | 1 | R.LHFFMVGYAPLTAIGSQSFR.S | 3 |
| U | YMR126C | 1 | 1 | 4.4% | 342 | 39187 | 7.3 | YMR126C SGDID:S000004733, Chr XIII from 521788-520760, reverse complement, Uncharacterized ORF, "Protein of unknown function, deletion causes sensitivity to thermal stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_14.07971.07971.3 | 3.2097 | 0.1445 | 98.5% | 1947.7444 | 1947.164 | 182 | 4.158 | 35.7% | 1 | K.FVKFCLY*FGEVSLTR.D | 3 |
| U | Reverse_YDR055W | 1 | 1 | 4.3% | 444 | 45777 | 9.2 | PST1 SGDID:S000002462, Chr IV from 563524-564858, Verified ORF, "Cell wall protein that contains a putative GPI-attachment site; secreted by regenerating protoplasts; up-regulated by activation of the cell integrity pathway, as mediated by Rlm1p; upregulated by cell wall damage via disruption of FKS1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.19139.19139.2 | 1.7287 | 0.0762 | 90.2% | 2135.2922 | 2137.3086 | 206 | 3.184 | 30.6% | 1 | K.IDGSTFKKEEAKSSS*KSVK.A | 2 |
| U | YDR238C | 1 | 1 | 4.2% | 973 | 109019 | 5.6 | SEC26 SGDID:S000002646, Chr IV from 940810-937889, reverse complement, Verified ORF, "Essential beta-coat protein of the COPI coatomer, involved in ER-to-Golgi protein trafficking and maintenance of normal ER morphology; shares 43% sequence identity with mammalian beta-coat protein (beta-COP)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_41.24505.24505.3 | 3.1007 | 0.1871 | 98.5% | 4717.9443 | 4714.335 | 67 | 4.376 | 16.2% | 1 | R.NAFIGLAELDRENALHYLENNIADIENLDPLLQAVFVQFIR.Q | 3 |
| U | Reverse_YBR216C | 1 | 1 | 4.2% | 674 | 77741 | 5.6 | YBP1 SGDID:S000000420, Chr II from 657595-655571, reverse complement, Verified ORF, "Protein required for oxidation of specific cysteine residues of the transcription factor Yap1p, resulting in the nuclear localization of Yap1p in response to stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_14.17329.17329.3 | 2.125 | 0.1888 | 92.0% | 3359.3943 | 3362.6372 | 270 | 3.926 | 21.3% | 1 | K.VLHQNT*ELYHIGSFLIVGNY*DLGVNKEK.A | 3 |
| U | YOR386W | 1 | 1 | 4.2% | 565 | 66274 | 9.1 | PHR1 SGDID:S000005913, Chr XV from 1066835-1068532, Verified ORF, "DNA photolyase involved in photoreactivation, repairs pyrimidine dimers in the presence of visible light; induced by DNA damage; regulated by transcriptional repressor Rph1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_14.17282.17282.2 | 1.6625 | 0.116 | 93.8% | 2750.412 | 2752.106 | 82 | 3.132 | 23.9% | 1 | K.SKWCLPDVSEEAALSRLKDFLGTK.S | 2 |
| U | Reverse_YFR005C | 1 | 1 | 4.2% | 448 | 52167 | 7.1 | SAD1 SGDID:S000001901, Chr VI from 155868-154522, reverse complement, Verified ORF, "Conserved zinc-finger domain protein involved in pre-mRNA splicing, required for assembly of U4 snRNA into the U4/U6 particle" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.13321.13321.2 | 1.5381 | 0.1426 | 93.8% | 2467.3123 | 2466.6238 | 136 | 3.47 | 27.8% | 1 | R.YKVHLIELES*S*FEVLTQNR.N | 2 |
| U | Reverse_YNL041C | 1 | 1 | 4.1% | 839 | 96976 | 5.3 | COG6 SGDID:S000004986, Chr XIV from 551988-549469, reverse complement, Verified ORF, "Component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17941.17941.3 | 3.6815 | 0.0831 | 94.9% | 4131.8643 | 4134.4175 | 34 | 3.49 | 18.2% | 1 | K.LQEAKLRYQDIEQLVVNNTPVENTENSLLKES*T*R.Q | 3 |
| U | YDR194C | 1 | 1 | 4.1% | 664 | 76269 | 9.0 | MSS116 SGDID:S000002602, Chr IV from 847941-845947, reverse complement, Verified ORF, "DEAD-box protein required for efficient splicing of mitochondrial Group I and II introns; presumed RNA helicase due to DEAD-box motif" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.17135.17135.3 | 3.8462 | 0.1708 | 99.3% | 3076.7043 | 3075.4429 | 32 | 3.807 | 23.1% | 1 | K.VLDEADRLLEIGFRDDLETISGILNEK.N | 3 |
| U | YOR073W | 1 | 1 | 4.1% | 590 | 66706 | 9.3 | SGO1 SGDID:S000005599, Chr XV from 464772-466544, Verified ORF, "Component of the spindle checkpoint, involved in sensing lack of tension on mitotic chromosomes; protects centromeric Rec8p at meiosis I; required for accurate chromosomal segregation at meiosis II and for mitotic chromosome stability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19227.19227.2 | 2.23 | 0.0103 | 90.0% | 2810.4922 | 2809.0955 | 194 | 3.181 | 23.9% | 1 | K.KVIDEVMPVSNMSSNSEISFT*RTR.R | 2 |
| U | YPR083W | 1 | 1 | 4.1% | 579 | 64959 | 5.5 | MDM36 SGDID:S000006287, Chr XVI from 704852-706591, Verified ORF, "Protein required for normal mitochondrial morphology and inheritance" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_26.18438.18438.3 | 3.3259 | 0.125 | 96.2% | 2915.5144 | 2917.1345 | 153 | 3.701 | 25.0% | 1 | K.RKVEGKS*MLNDEEDLHLSKAT*LNK.C | 3 |
| U | YKR048C | 1 | 1 | 4.1% | 417 | 47885 | 4.3 | NAP1 SGDID:S000001756, Chr XI from 526282-525029, reverse complement, Verified ORF, "Protein that interacts with mitotic cyclin Clb2p; required for the regulation of microtubule dynamics during mitosis; controls bud morphogenesis; involved in the transport of H2A and H2B histones to the nucleus" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_13.07250.07250.2 | 1.5145 | 0.1517 | 94.2% | 2135.8323 | 2134.1284 | 312 | 3.649 | 34.4% | 1 | K.IQNEDQDEELEEDLEER.L | 2 |
| U | YGL075C | 1 | 3 | 4.1% | 387 | 44585 | 8.3 | MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13548.13548.2 | 2.711 | 0.3006 | 100.0% | 2091.9722 | 2092.269 | 14 | 5.683 | 40.0% | 3 | K.IVWFFEDQTDLETEYR.S | 2 |
| U | Reverse_YBR065C | 1 | 1 | 4.1% | 364 | 40925 | 9.5 | ECM2 SGDID:S000000269, Chr II from 369676-368582, reverse complement, Verified ORF, "Pre-mRNA splicing factor, facilitates the cooperative formation of U2/U6 helix II in association with stem II in the spliceosome, function may be regulated by Slu7p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_6.14268.14268.2 | 1.6058 | 0.2241 | 99.2% | 1854.6322 | 1853.898 | 5 | 3.799 | 42.9% | 1 | K.KS*TKKKDNKANDTS*K.T | 2 |
| U | YJL088W | 1 | 1 | 4.1% | 338 | 37845 | 6.3 | ARG3 SGDID:S000003624, Chr X from 268715-269731, Verified ORF, "Ornithine carbamoyltransferase (carbamoylphosphate:L-ornithine carbamoyltransferase), catalyzes the sixth step in the biosynthesis of the arginine precursor ornithine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_28.16566.16566.2 | 1.8643 | 0.098 | 94.3% | 1728.5322 | 1729.0812 | 159 | 4.023 | 42.3% | 1 | R.ILVQRAQHFKNVFK.A | 2 |
| U | YAL047C | 2 | 2 | 4.0% | 622 | 72105 | 5.1 | SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.18893.18893.4 | 3.5623 | 0.3291 | 100.0% | 3034.2166 | 3032.4636 | 1 | 5.04 | 33.3% | 1 | K.TLDTQLEIVIEILHKEYDQFINSIR.L | 4 |
| * | Jamie_FT_01_itms_32.19056.19056.3 | 3.6357 | 0.2314 | 100.0% | 3036.1743 | 3032.4636 | 27 | 4.268 | 24.0% | 1 | K.TLDTQLEIVIEILHKEYDQFINSIR.L | 3 |
| U | Reverse_YPL179W | 1 | 1 | 4.0% | 549 | 61421 | 9.3 | PPQ1 SGDID:S000006100, Chr XVI from 208156-209805, Verified ORF, "Putative protein serine/threonine phosphatase; null mutation enhances efficiency of translational suppressors" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_32.22373.22373.2 | 1.9159 | 0.1219 | 96.8% | 2260.912 | 2263.3396 | 29 | 3.6 | 28.6% | 1 | K.KSSKPNPIGSTPS*SPAGFS*GAK.V | 2 |
| U | Reverse_YJR122W | 1 | 1 | 4.0% | 497 | 57055 | 7.9 | CAF17 SGDID:S000003883, Chr X from 649691-651184, Verified ORF, "Mitochondrial protein that interacts with Ccr4p in the two-hybrid system; 3'-untranslated region contains a putative mRNA localization element common to genes encoding mitochondrial proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_28.16404.16404.2 | 2.3565 | 0.1311 | 99.3% | 2191.112 | 2193.5083 | 359 | 3.485 | 28.9% | 1 | R.LLAVGYLGENS*ILLGAPRQK.R | 2 |
| U | YGR264C | 2 | 3 | 3.9% | 751 | 85678 | 6.6 | MES1 SGDID:S000003496, Chr VII from 1021859-1019604, reverse complement, Verified ORF, "Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_30.21247.21247.3 | 4.0894 | 0.2683 | 100.0% | 3051.8342 | 3051.5654 | 1 | 5.248 | 28.6% | 2 | K.SDAVVAVGLNIIYAVSSIITPYMPEIGEK.I | 3 |
| * | Jamie_FT_02_itms_30.21236.21236.2 | 2.0421 | 0.1062 | 97.1% | 3052.3523 | 3051.5654 | 37 | 4.1 | 23.2% | 1 | K.SDAVVAVGLNIIYAVSSIITPYMPEIGEK.I | 2 |
| U | YDR502C | 1 | 1 | 3.9% | 384 | 42256 | 5.4 | SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
| U | YLR180W | 1 | 1 | 3.9% | 382 | 41818 | 5.2 | SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_12.06710.06710.2 | 2.3749 | 0.2166 | 100.0% | 1445.2122 | 1445.6182 | 1 | 4.667 | 64.3% | 1 | R.FVIGGPQGDAGLTGR.K | 2 |
| U | YMR055C | 1 | 1 | 3.9% | 306 | 35028 | 8.6 | BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10393.10393.2 | 2.1072 | 0.1154 | 97.9% | 1466.5721 | 1466.5902 | 100 | 3.41 | 45.5% | 1 | R.QFPDFDADEIIR.L | 2 |
| U | Reverse_YJR127C | 1 | 1 | 3.8% | 1380 | 155062 | 8.0 | RSF2 SGDID:S000003888, Chr X from 662974-658832, reverse complement, Verified ORF, "Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_15.19234.19234.4 | 2.5372 | 0.1646 | 94.3% | 6175.7363 | 6181.102 | 94 | 3.217 | 13.1% | 1 | K.AFLYVPIILRMAPNANIT*S*MSNETPTLIGGNKLYLNEWYKLMTDIRQRSTMK.W | 4 |
| U | YMR186W | 1 | 5 | 3.8% | 705 | 80900 | 4.8 | HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20533.20533.2 | 4.383 | 0.4352 | 100.0% | 2963.412 | 2961.2952 | 1 | 7.31 | 40.4% | 5 | K.DLTNLLFETALLTSGFSLEEPTSFASR.I | 2 |
| U | YHR020W | 1 | 1 | 3.8% | 688 | 77386 | 6.4 | YHR020W SGDID:S000001062, Chr VIII from 143989-146055, Uncharacterized ORF, "Protein required for cell viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.23546.23546.2 | 2.6356 | 0.2851 | 95.5% | 2940.4521 | 2938.3875 | 1 | 5.423 | 28.0% | 1 | D.AEEEVLQILDFYAGVYEELLAVPVVK.G | 2 |
| U | Reverse_YDL070W | 1 | 1 | 3.8% | 638 | 72513 | 6.1 | BDF2 SGDID:S000002228, Chr IV from 331025-332941, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_9.08420.08420.2 | 1.15 | 0.2848 | 97.8% | 2524.372 | 2522.758 | 57 | 4.109 | 15.2% | 1 | R.SNATASQPAALLASHAHRTDMNTR.S | 2 |
| U | YOR204W | 2 | 3 | 3.8% | 604 | 65553 | 7.8 | DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20750.20750.2 | 3.143 | 0.2584 | 100.0% | 2310.6921 | 2308.6746 | 11 | 4.657 | 35.7% | 2 | K.SALLDLLSASTDGLTLIFVETK.R | 2 |
| * | Jamie_FT_01_itms_32.18804.18804.2 | 2.4407 | 0.1432 | 99.5% | 2467.5923 | 2464.862 | 56 | 3.797 | 25.0% | 1 | K.SALLDLLSASTDGLTLIFVETKR.M | 2 |
| U | Reverse_YPL086C | 1 | 1 | 3.8% | 557 | 63657 | 9.0 | ELP3 SGDID:S000006007, Chr XVI from 386443-384770, reverse complement, Verified ORF, "Histone acetyltransferase subunit of the Elongator complex, which is a component of the RNA polymerase II holoenzyme; activity is directed specifically towards histones H3 and H4; disruption confers resistance to K. lactis zymotoxin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.18936.18936.2 | 2.2944 | 0.0616 | 95.8% | 2221.4521 | 2221.6787 | 1 | 3.485 | 35.0% | 1 | R.HPKCMVAVVAIGSATRVPKAK.L | 2 |
| U | YIR019C | 1 | 1 | 3.7% | 1367 | 136110 | 4.3 | MUC1 SGDID:S000001458, Chr IX from 393672-389569, reverse complement, Verified ORF, "GPI-anchored cell surface glycoprotein required for diploid pseudohyphal formation and haploid invasive growth, transcriptionally regulated by the MAPK pathway (via Ste12p and Tec1p) and the cAMP pathway (via Flo8p)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15410.15410.4 | 3.847 | 0.0686 | 94.7% | 4996.8965 | 4995.1953 | 210 | 2.832 | 14.6% | 1 | K.TIVSSASAGENTAPSATTPVTTAIPTT*VITTESSVGTNS*AGETTTGYTTK.S | 4 |
| U | Reverse_YPL226W | 1 | 1 | 3.7% | 1196 | 134330 | 5.9 | NEW1 SGDID:S000006147, Chr XVI from 121767-125357, Verified ORF, "ATP binding cassette family member; Asn/Gln-rich rich region supports [NU+] prion formation, susceptibility to [PSI+] prion induction and aggregation of a fragment of the human Machado-Joseph Disease protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17652.17652.4 | 3.521 | 0.0824 | 93.9% | 4777.3364 | 4772.1875 | 1 | 2.837 | 16.3% | 1 | K.ILTSKGAGNPGLCAVRS*SLSLSCSVHSLSPKQAGPYSFTVDT*MK.A | 4 |
| U | YER033C | 1 | 1 | 3.7% | 1076 | 119350 | 4.9 | ZRG8 SGDID:S000000835, Chr V from 221286-218056, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function, transcription is induced under conditions of zinc deficiency" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_11.16891.16891.4 | 3.1032 | 0.1102 | 93.9% | 4507.8965 | 4502.5674 | 280 | 3.5 | 16.7% | 1 | R.HSNFSGNTNNSS*QRSSDDSLDFLPSTPSQMNY*DSIPPPAK.H | 4 |
| U | YGL234W | 1 | 3 | 3.7% | 802 | 86068 | 5.3 | ADE5,7 SGDID:S000003203, Chr VII from 56482-58890, Verified ORF, "Bifunctional enzyme of the 'de novo' purine nucleotide biosynthetic pathway, contains aminoimidazole ribotide synthetase and glycinamide ribotide synthetase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19697.19697.3 | 6.5088 | 0.5904 | 100.0% | 3275.2144 | 3272.5957 | 1 | 9.972 | 33.6% | 3 | R.FGDPETQAVLSLLDDQTDLAQVFLAAAEHR.L | 3 |
| U | Reverse_YLR429W | 1 | 1 | 3.7% | 651 | 72553 | 5.9 | CRN1 SGDID:S000004421, Chr XII from 990773-992728, Verified ORF, "Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_12.10340.10340.3 | 2.9425 | 0.2563 | 99.6% | 2738.1543 | 2740.091 | 122 | 5.025 | 23.9% | 1 | K.EINFADWIGIQRDSLKSFGTTALR.D | 3 |
| U | Reverse_YIL002C | 1 | 1 | 3.6% | 946 | 108430 | 6.7 | INP51 SGDID:S000001264, Chr IX from 353428-350588, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_6.14113.14113.4 | 2.515 | 0.1521 | 92.7% | 4127.4966 | 4125.4434 | 6 | 3.811 | 19.2% | 1 | K.TGPDFKYT*PPFDIAMEHFYPFS*EGAIMQQNLQDK.E | 4 |
| U | YDR362C | 1 | 1 | 3.6% | 672 | 74709 | 6.6 | TFC6 SGDID:S000002770, Chr IV from 1198687-1196669, reverse complement, Verified ORF, "One of six subunits of RNA polymerase III transcription initiation factor complex (TFIIIC); part of TFIIIC TauB domain that binds BoxB promoter sites of tRNA and other genes; cooperates with Tfc3p in DNA binding; human homolog is TFIIIC-110" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.19033.19033.2 | 2.0315 | 0.0977 | 96.3% | 2629.8323 | 2626.9077 | 18 | 4.077 | 26.1% | 1 | K.KNSTKNMKS*SSPGSSLGQKGRPIR.L | 2 |
| U | YBR189W | 1 | 1 | 3.6% | 195 | 22299 | 10.1 | RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Bp and has similarity to E. coli S4 and rat S9 ribosomal proteins" |
| U | YPL081W | 1 | 1 | 3.6% | 197 | 22443 | 10.0 | RPS9A SGDID:S000006002, Chr XVI from 404947-404953,405455-406041, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_10.05729.05729.2 | 1.9596 | 0.0119 | 92.6% | 909.6722 | 907.99884 | 8 | 3.995 | 91.7% | 1 | K.VEDFLER.R | 2 |
| U | Reverse_YOR188W | 1 | 1 | 3.5% | 1137 | 129971 | 8.9 | MSB1 SGDID:S000005714, Chr XV from 685767-689180, Verified ORF, "Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway, potential Cdc28p substrate; multicopy suppressor of temperature-sensitive mutations in CDC24 and CDC42, and of mutations in BEM4" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14849.14849.4 | 3.1963 | 0.0946 | 92.9% | 4458.0166 | 4459.442 | 78 | 2.696 | 15.8% | 1 | R.DATYKSSDACSDNTNTSLKLSHVAS*SHSSQLDDDT*INSPK.Y | 4 |
| U | YKL038W | 1 | 1 | 3.5% | 1170 | 128240 | 7.9 | RGT1 SGDID:S000001521, Chr XI from 365248-368760, Verified ORF, "Glucose-responsive transcription factor that regulates expression of several glucose transporter (HXT) genes in response to glucose; binds to promoters and acts both as a transcriptional activator and repressor" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.13950.13950.4 | 3.5586 | 0.1408 | 97.1% | 4148.4966 | 4143.401 | 284 | 3.476 | 16.2% | 1 | R.PPNPPANNPT*VQEGPSAMGSSPVAGNLSAAPPSEGNPDFYK.K | 4 |
| U | Reverse_YER033C | 1 | 1 | 3.5% | 1076 | 119350 | 4.9 | ZRG8 SGDID:S000000835, Chr V from 221286-218056, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function, transcription is induced under conditions of zinc deficiency" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_21.15421.15421.4 | 3.3554 | 0.0727 | 90.0% | 4164.5767 | 4165.4307 | 77 | 2.528 | 17.6% | 1 | K.VTPKTSGTTGT*LSAKIASTHETEDDSNNRKLSFSYNPK.G | 4 |
| U | YER091C | 2 | 3 | 3.5% | 767 | 85860 | 6.5 | MET6 SGDID:S000000893, Chr V from 342163-339860, reverse complement, Verified ORF, "Cobalamin-independent methionine synthase, involved in amino acid biosynthesis; requires a minimum of two glutamates on the methyltetrahydrofolate substrate, similar to bacterial metE homologs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22631.22631.3 | 4.0404 | 0.1658 | 99.3% | 3058.4043 | 3058.5366 | 3 | 4.901 | 29.8% | 1 | K.ADKDSLDLEPLSLLEQLLPLYTEILSK.L | 3 |
| * | Jamie_FT_01_itms_38.22639.22639.2 | 3.7352 | 0.2929 | 100.0% | 3059.8323 | 3058.5366 | 1 | 5.593 | 36.5% | 2 | K.ADKDSLDLEPLSLLEQLLPLYTEILSK.L | 2 |
| U | YKR024C | 1 | 1 | 3.5% | 742 | 83308 | 9.3 | DBP7 SGDID:S000001732, Chr XI from 487015-484787, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box family involved in ribosomal biogenesis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21501.21501.2 | 2.0785 | 0.029 | 90.3% | 3128.672 | 3130.3584 | 20 | 3.131 | 24.0% | 1 | K.DVNVNRNDKFIRKDEKS*SKNKDVGDK.E | 2 |
| U | Reverse_YHL047C | 1 | 1 | 3.5% | 637 | 71554 | 8.4 | ARN2 SGDID:S000001039, Chr VIII from 10211-8298, reverse complement, Verified ORF, "Transporter, member of the ARN family of transporters that specifically recognize siderophore-iron chelates; responsible for uptake of iron bound to the siderophore triacetylfusarinine C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_14.17297.17297.2 | 1.994 | 0.1489 | 98.2% | 2752.0322 | 2754.9702 | 4 | 3.933 | 26.2% | 1 | R.KAIWDNIPDDEKT*QVYERDPLK.Q | 2 |
| U | YDR023W | 1 | 1 | 3.5% | 462 | 53310 | 6.1 | SES1 SGDID:S000002430, Chr IV from 489504-490892, Verified ORF, "Cytosolic seryl-tRNA synthetase, class II aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser), displays tRNA-dependent amino acid recognition which enhances discrimination of the serine substrate, interacts with peroxin Pex21p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_9.16117.16117.2 | 1.4132 | 0.1611 | 93.8% | 1745.3522 | 1743.7789 | 347 | 3.899 | 30.0% | 1 | K.PEDLEAVGPIAS*VT*GK.P | 2 |
| U | YJL158C | 1 | 1 | 3.5% | 227 | 23242 | 4.7 | CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family" |
| U | YKL164C | 1 | 1 | 2.3% | 341 | 34622 | 6.5 | PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" |
| U | YKL163W | 1 | 1 | 2.5% | 325 | 33004 | 5.7 | PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway" |
| U | YJL160C | 1 | 1 | 2.8% | 287 | 30215 | 9.0 | YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| U | YJL159W | 1 | 1 | 2.1% | 387 | 38619 | 5.4 | HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_8.04463.04463.2 | 2.0736 | 0.2237 | 100.0% | 830.6322 | 829.9749 | 52 | 5.452 | 71.4% | 1 | R.IGSIVANR.Q | 2 |
| U | Reverse_YDR478W | 1 | 1 | 3.5% | 198 | 22541 | 9.6 | SNM1 SGDID:S000002886, Chr IV from 1414565-1415161, Verified ORF, "Subunit of RNase MRP, which cleaves pre-rRNA; not shared between Rnase MRP and nuclear Rnase P, in contrast to all other Rnase MRP protein subunits; binds to the NME1 RNA subunit of Rnase MRP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07003.07003.2 | 2.1214 | 0.0247 | 95.7% | 875.1922 | 874.9695 | 56 | 2.803 | 91.7% | 1 | K.KVAY*SVK.G | 2 |
| U | YGR061C | 2 | 2 | 3.4% | 1358 | 148904 | 5.3 | ADE6 SGDID:S000003293, Chr VII from 615969-611893, reverse complement, Verified ORF, "Formylglycinamidine-ribonucleotide (FGAM)-synthetase, catalyzes a step in the 'de novo' purine nucleotide biosynthetic pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21261.21261.2 | 2.8899 | 0.2764 | 100.0% | 1795.4521 | 1795.104 | 1 | 5.802 | 46.9% | 1 | R.SDGGLLITLLEMAFASR.C | 2 |
| * | Jamie_FT_01_itms_27.16158.16158.4 | 3.2171 | 0.1082 | 94.6% | 3568.8564 | 3572.8071 | 129 | 2.842 | 21.4% | 1 | R.SQFS*KFFNERQDTFAFGACNGCQFLSRLK.D | 4 |
| U | YOR206W | 1 | 1 | 3.4% | 710 | 81601 | 8.5 | NOC2 SGDID:S000005732, Chr XV from 727512-729644, Verified ORF, "Protein that forms a nucleolar complex with Mak21p that binds to 90S and 66S pre-ribosomes, as well as a nuclear complex with Noc3p that binds to 66S pre-ribosomes; both complexes mediate intranuclear transport of ribosomal precursors" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_21.15657.15657.2 | 2.1566 | 0.3529 | 100.0% | 2803.112 | 2804.3958 | 1 | 6.113 | 32.6% | 1 | P.VIISLRRYIKTSTNVKLNKRLSTV.V | 2 |
| U | Reverse_YDR295C | 1 | 1 | 3.4% | 674 | 77059 | 8.7 | HDA2 SGDID:S000002703, Chr IV from 1054641-1052617, reverse complement, Verified ORF, "Subunit of a possibly tetrameric trichostatin A-sensitive class II histone deacetylase complex that contains an Hda1p homodimer and an Hda2p-Hda3p heterodimer; required for the activity of the complex; has similarity to Hda3p; Ploidy-related" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_19.21604.21604.2 | 1.3334 | 0.204 | 96.0% | 2745.0723 | 2745.9717 | 53 | 3.87 | 18.2% | 1 | R.FRTGNAAAKEVQVNNKNKLDY*QR.N | 2 |
| U | YLR088W | 1 | 1 | 3.4% | 614 | 69221 | 6.3 | GAA1 SGDID:S000004078, Chr XII from 316108-317952, Verified ORF, "Subunit of the GPI (glycosylphosphatidylinositol):protein transamidase complex, removes the GPI-anchoring signal and attaches GPI to proteins in the ER" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.10935.10935.4 | 3.415 | 0.0625 | 92.0% | 2482.0166 | 2483.9216 | 2 | 3.332 | 33.3% | 1 | R.WPVWSKNIIVVFSENPRAALR.S | 4 |
| U | YLR029C | 1 | 1 | 3.4% | 204 | 24422 | 11.4 | RPL15A SGDID:S000004019, Chr XII from 202591-201977, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl15Bp and has similarity to rat L15 ribosomal protein; binds to 5.8 S rRNA" |
| U | YMR121C | 1 | 1 | 3.4% | 204 | 24422 | 11.4 | RPL15B SGDID:S000004728, Chr XIII from 510347-509733, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl15Ap and has similarity to rat L15 ribosomal protein; binds to 5.8 S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_11.06271.06271.2 | 1.6576 | 0.1931 | 99.5% | 883.03217 | 883.03784 | 139 | 3.74 | 66.7% | 1 | K.QGFVIYR.V | 2 |
| U | Reverse_YLL034C | 1 | 1 | 3.3% | 837 | 93069 | 5.4 | RIX7 SGDID:S000003957, Chr XII from 73145-70632, reverse complement, Verified ORF, "Putative ATPase of the AAA family, required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_4.12232.12232.3 | 2.7095 | 0.2327 | 98.4% | 3331.5842 | 3335.775 | 58 | 4.205 | 22.2% | 1 | K.EET*NPLEIFLSKDLRGPRLMAPDIMDPR.N | 3 |
| U | YOL152W | 1 | 1 | 3.3% | 629 | 71997 | 9.1 | FRE7 SGDID:S000005512, Chr XV from 40747-42636, Verified ORF, "Putative ferric reductase with similarity to Fre2p; expression induced by low copper levels" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22404.22404.2 | 2.8992 | 0.1564 | 100.0% | 2308.632 | 2307.8276 | 4 | 4.551 | 37.5% | 1 | R.SGVPPILFLNLLWLSSLPIAR.R | 2 |
| U | YBR139W | 1 | 1 | 3.3% | 508 | 57639 | 5.3 | YBR139W SGDID:S000000343, Chr II from 515658-517184, Uncharacterized ORF, "Putative serine type Carboxypeptidase; green fluorescent protein (GFP)-fusion protein localizes to the vacuole; YBR139W is not an essential gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.21768.21768.2 | 1.719 | 0.1415 | 96.3% | 2129.632 | 2129.4656 | 17 | 3.698 | 37.5% | 1 | K.DAYIFLELFFEAFPHLR.S | 2 |
| U | YCR053W | 1 | 1 | 3.3% | 514 | 57474 | 5.6 | THR4 SGDID:S000000649, Chr III from 216692-218236, Verified ORF, "Threonine synthase, conserved protein that catalyzes formation of threonine from 0-phosphohomoserine; expression is regulated by the GCN4-mediated general amino acid control pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.22089.22089.2 | 3.3608 | 0.383 | 100.0% | 2060.7922 | 2060.3599 | 1 | 6.812 | 50.0% | 1 | K.DVALQFVGNLFEYFLQR.T | 2 |
| U | Reverse_YNR069C | 1 | 1 | 3.3% | 489 | 54831 | 5.8 | BSC5 SGDID:S000005352, Chr XIV from 762592-761123, reverse complement, Verified ORF, "Protein of unknown function, ORF exhibits genomic organization compatible with a translational readthrough-dependent mode of expression" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_11.09425.09425.2 | 1.7088 | 0.1563 | 97.3% | 1849.4922 | 1847.8926 | 189 | 3.917 | 33.3% | 1 | K.LT*GNETNGAVANWEYK.G | 2 |
| U | YBR218C | 2 | 5 | 3.2% | 1180 | 130167 | 6.5 | PYC2 SGDID:S000000422, Chr II from 662244-658702, reverse complement, Verified ORF, "Pyruvate carboxylase isoform, cytoplasmic enzyme that converts pyruvate to oxaloacetate; highly similar to isoform Pyc1p but differentially regulated; mutations in the human homolog are associated with lactic acidosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_23.16956.16956.4 | 3.728 | 0.1384 | 98.2% | 4031.4565 | 4033.6091 | 4 | 3.688 | 19.4% | 1 | R.IQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDK.I | 4 |
| * | Jamie_FT_03_itms_16.18538.18538.3 | 6.7574 | 0.4012 | 100.0% | 4036.2844 | 4033.6091 | 1 | 7.707 | 25.7% | 4 | R.IQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDK.I | 3 |
| U | YBR059C | 1 | 1 | 3.2% | 1108 | 123989 | 7.7 | AKL1 SGDID:S000000263, Chr II from 360185-356859, reverse complement, Verified ORF, "Ser-Thr protein kinase, member (with Ark1p and Prk1p) of the Ark kinase family; involved in endocytosis and actin cytoskeleton organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.23528.23528.4 | 2.7 | 0.1858 | 96.7% | 4068.8564 | 4074.3076 | 70 | 3.673 | 19.0% | 1 | K.LSDSEENLLNDMFLSSFEISS*KLPMNAS*DGHAAVSR.I | 4 |
| U | Reverse_YDR186C | 2 | 2 | 3.2% | 877 | 98331 | 5.4 | YDR186C SGDID:S000002594, Chr IV from 835487-832854, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07107.07107.2 | 2.1466 | 0.0449 | 96.7% | 878.65216 | 877.0311 | 3 | 2.656 | 85.7% | 1 | K.FNLALGNK.E | 2 |
| * | Jamie_FT_01_itms_29.17208.17208.2 | 2.1559 | 0.0868 | 96.2% | 2226.132 | 2227.309 | 167 | 3.229 | 28.9% | 1 | K.DNDEATSTNSFSQAISNRLR.H | 2 |
| U | YGL125W | 1 | 1 | 3.2% | 600 | 68560 | 5.8 | MET13 SGDID:S000003093, Chr VII from 272526-274328, Verified ORF, "Isozyme of methylenetetrahydrofolate reductase, catalyzes the reduction of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate in the methionine biosynthesis pathway" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.19911.19911.2 | 2.5788 | 0.1147 | 99.5% | 2597.412 | 2595.8457 | 235 | 3.9 | 30.6% | 1 | K.EEFY*HILNEWKLNMNKYDK.P | 2 |
| U | Reverse_YOR377W | 1 | 1 | 3.2% | 525 | 61036 | 7.0 | ATF1 SGDID:S000005904, Chr XV from 1046222-1047799, Verified ORF, "Alcohol acetyltransferase with potential roles in lipid and sterol metabolism; responsible for the major part of volatile acetate ester production during fermentation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_05_itms_8.18033.18033.2 | 1.3774 | 0.2631 | 99.0% | 1954.2522 | 1956.123 | 43 | 4.592 | 25.0% | 1 | K.YISCLEELSEQSGVVNK.T | 2 |
| U | Reverse_YAR002W | 1 | 1 | 3.2% | 539 | 59039 | 9.3 | NUP60 SGDID:S000000063, Chr I from 152259-153878, Verified ORF, "Subunit of the nuclear pore complex (NPC), functions to anchor Nup2p to the NPC in a dynamic process that is controlled by the nucleoplasmic concentration of Gsp1p-GTP; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15560.15560.2 | 1.7774 | 0.0974 | 93.6% | 2078.0522 | 2077.2246 | 24 | 3.187 | 34.4% | 1 | K.RY*PASPVTASARRLS*KR.H | 2 |
| U | YHR070W | 1 | 1 | 3.2% | 499 | 56514 | 8.8 | TRM5 SGDID:S000001112, Chr VIII from 234883-236382, Verified ORF, "tRNA(m(1)G37)methyltransferase, methylates a tRNA base adjacent to the anticodon that has a role in prevention of frameshifting; highly conserved across Archaea, Bacteria, and Eukarya" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_7.14907.14907.2 | 1.7167 | 0.1335 | 95.7% | 1898.9521 | 1899.0648 | 237 | 4.268 | 36.7% | 1 | K.KDVIVLANDLNPES*YK.Y | 2 |
| U | YHL012W | 1 | 1 | 3.2% | 493 | 56000 | 5.3 | YHL012W SGDID:S000001004, Chr VIII from 78932-80413, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13517.13517.2 | 1.8261 | 0.0748 | 92.1% | 1731.0322 | 1731.0891 | 181 | 3.651 | 36.7% | 1 | K.LAILKLT*GKANPIIGK.E | 2 |
| U | Reverse_YBR079C | 1 | 1 | 3.1% | 964 | 110344 | 6.3 | RPG1 SGDID:S000000283, Chr II from 398271-395377, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14760.14760.3 | 3.2794 | 0.2163 | 99.3% | 3587.3643 | 3587.981 | 16 | 3.685 | 23.3% | 1 | K.RTAEALEQARKQREANAIEEKRRAIAEEYR.R | 3 |
| U | Reverse_YFL054C | 1 | 1 | 3.1% | 646 | 70507 | 8.4 | YFL054C SGDID:S000001840, Chr VI from 22787-20847, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23019.23019.2 | 1.9545 | 0.0832 | 94.1% | 2228.9722 | 2227.278 | 114 | 3.837 | 31.6% | 1 | K.LTPPRTSESSSSSRGS*EYSM.- | 2 |
| U | YIL121W | 1 | 1 | 3.1% | 542 | 59618 | 9.1 | QDR2 SGDID:S000001383, Chr IX from 132241-133869, Verified ORF, "Multidrug transporter required for resistance to quinidine, barban, cisplatin, and bleomycin; member of the major facilitator superfamily of transporters conferring multiple drug resistance (MFS-MDR)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_22.16323.16323.2 | 1.8265 | 0.0779 | 92.7% | 2043.4521 | 2041.2904 | 12 | 2.953 | 34.4% | 1 | R.CILS*AVFIAALS*KMVEK.M | 2 |
| U | YDR130C | 1 | 1 | 3.1% | 291 | 33186 | 9.8 | FIN1 SGDID:S000002537, Chr IV from 716617-715742, reverse complement, Verified ORF, "Spindle pole body-related intermediate filament protein, forms cell cycle-specific filaments between spindle pole bodies in mother and daughter cells, able to self-assemble, expression induced during S/G2, localization cell-cycle dependent" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_11.06360.06360.2 | 1.8952 | 0.0863 | 96.3% | 956.2322 | 955.9572 | 2 | 3.122 | 81.2% | 1 | K.IGGDGSLT*R.I | 2 |
| U | YLR441C | 1 | 2 | 3.1% | 255 | 28743 | 10.0 | RPS1A SGDID:S000004433, Chr XII from 1018904-1018137, reverse complement, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Bp and has similarity to rat S3a ribosomal protein" |
| U | YML063W | 1 | 2 | 3.1% | 255 | 28812 | 10.0 | RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_15.08725.08725.2 | 1.8617 | 0.1948 | 99.6% | 939.47217 | 939.1454 | 1 | 4.42 | 85.7% | 2 | R.IFAIAFTR.K | 2 |
| U | Reverse_YGL197W | 1 | 1 | 3.0% | 1487 | 167074 | 7.7 | MDS3 SGDID:S000003165, Chr VII from 124703-129166, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Pmd1p, for growth under alkaline conditions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_28.16463.16463.4 | 3.8078 | 0.0651 | 94.1% | 4594.2964 | 4597.7983 | 31 | 3.111 | 15.2% | 1 | R.SGQINMS*NPFGISGVSNHSDRPGGAFVT*PVNTSSTELSGAGTATK.E | 4 |
| U | YJR030C | 1 | 1 | 3.0% | 745 | 84290 | 7.2 | YJR030C SGDID:S000003791, Chr X from 486110-483873, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10727.10727.4 | 2.9939 | 0.1341 | 95.9% | 2616.1365 | 2616.6743 | 9 | 3.253 | 27.8% | 1 | R.S*GSKISQQVY*VRSNNPDYTSPK.R | 4 |
| U | YHL019C | 1 | 1 | 3.0% | 605 | 69990 | 6.9 | APM2 SGDID:S000001011, Chr VIII from 69545-67728, reverse complement, Verified ORF, "Protein of unknown function, homologous to the medium chain of mammalian clathrin-associated protein complex; involved in vesicular transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_14.18822.18822.2 | 1.6943 | 0.2895 | 100.0% | 2082.6921 | 2082.5012 | 15 | 4.785 | 35.3% | 1 | K.KKRKKKKGT*KGKSVGKSK.L | 2 |
| U | Reverse_YER156C | 1 | 1 | 3.0% | 338 | 38174 | 7.5 | YER156C SGDID:S000000958, Chr V from 484336-483320, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_17.09722.09722.2 | 1.83 | 0.0451 | 90.6% | 1109.7122 | 1108.3292 | 1 | 4.233 | 66.7% | 1 | R.LGRLPEPLGR.R | 2 |
| U | YKL210W | 1 | 1 | 2.9% | 1024 | 114266 | 5.1 | UBA1 SGDID:S000001693, Chr XI from 39164-42238, Verified ORF, "Ubiquitin activating enzyme, involved in ubiquitin-mediated protein degradation and essential for viability" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.21954.21954.2 | 2.6605 | 0.1029 | 99.5% | 3432.0923 | 3431.6501 | 2 | 3.682 | 24.1% | 1 | K.VGPETEEIFNDSFWESLDFVTNALDNVDAR.T | 2 |
| U | YDR475C | 1 | 1 | 2.9% | 876 | 98691 | 9.6 | YDR475C SGDID:S000002883, Chr IV from 1410084-1407454, reverse complement, Uncharacterized ORF, "Protein of unknown function; previously annotated as two separate ORFs, YDR474C and YDR475C, which were merged as a result of corrections to the systematic reference sequence" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_33.31608.31608.4 | 3.1559 | 0.1115 | 94.4% | 2722.6165 | 2728.0098 | 58 | 3.669 | 25.0% | 1 | R.SMLDVLDNPSSSRSKSKSRSSSKSR.I | 4 |
| U | YHR047C | 1 | 1 | 2.9% | 856 | 97663 | 5.3 | AAP1' SGDID:S000001089, Chr VIII from 201303-198733, reverse complement, Verified ORF, "Arginine/alanine aminopeptidase, overproduction stimulates glycogen accumulation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23191.23191.2 | 2.0736 | 0.0361 | 91.1% | 2921.632 | 2922.3477 | 6 | 2.951 | 27.1% | 1 | K.STWVFEPEDILNALDKFTLDLVLNK.L | 2 |
| U | Reverse_YMR075W | 1 | 1 | 2.9% | 684 | 78837 | 8.8 | YMR075W SGDID:S000004680, Chr XIII from 413981-416035, Uncharacterized ORF, "Nuclear protein of unknown function" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15236.15236.2 | 2.35 | 0.2992 | 92.9% | 2361.5322 | 2358.6282 | 256 | 4.591 | 28.9% | 1 | N.WGITSRINSEETMNETLFTK.L | 2 |
| U | YBL060W | 1 | 1 | 2.9% | 687 | 78768 | 6.4 | YBL060W SGDID:S000000156, Chr II from 107934-109997, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_40.23817.23817.2 | 1.6664 | 0.0849 | 90.1% | 2416.872 | 2417.6836 | 3 | 3.064 | 34.2% | 1 | K.SFFGWLKPSKTTTLIEHT*SR.R | 2 |
| U | YOR137C | 1 | 1 | 2.9% | 622 | 71846 | 7.7 | SIA1 SGDID:S000005663, Chr XV from 583681-581813, reverse complement, Verified ORF, "Protein of unassigned function involved in activation of the Pma1p plasma membrane H+-ATPase by glucose" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_27.26656.26656.2 | 2.0414 | 0.448 | 100.0% | 2145.0723 | 2146.1882 | 1 | 5.806 | 35.3% | 1 | D.T*DNIAVFGEEWVY*KGSGI.W | 2 |
| U | YKL081W | 1 | 2 | 2.9% | 412 | 46520 | 7.8 | TEF4 SGDID:S000001564, Chr XI from 282535-282739,283066-284099, Verified ORF, "Translation elongation factor EF-1 gamma" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10667.10667.2 | 2.4502 | 0.0891 | 98.8% | 1408.6122 | 1406.578 | 17 | 4.177 | 59.1% | 2 | R.NYASEALISYFK.L | 2 |
| U | YPL160W | 2 | 2 | 2.8% | 1090 | 124141 | 5.8 | CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.22074.22074.3 | 3.5119 | 0.2259 | 100.0% | 3610.2244 | 3609.1125 | 1 | 4.445 | 23.3% | 1 | R.LPWDEKYLVESLSDSTIYQSFYTIAHLLFK.D | 3 |
| * | Jamie_FT_01_itms_35.20870.20870.3 | 4.6702 | 0.3233 | 100.0% | 2840.2444 | 2840.245 | 1 | 5.592 | 31.5% | 1 | K.YLVESLSDSTIYQSFYTIAHLLFK.D | 3 |
| U | YAL035W | 1 | 2 | 2.8% | 1002 | 112268 | 5.8 | FUN12 SGDID:S000000033, Chr I from 76428-79436, Verified ORF, "GTPase, required for general translation initiation by promoting Met-tRNAiMet binding to ribosomes and ribosomal subunit joining; homolog of bacterial IF2" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_38.22501.22501.2 | 3.9154 | 0.3618 | 100.0% | 3045.5923 | 3043.5708 | 1 | 5.617 | 38.9% | 2 | K.YVSIVPTSAVTGEGVPDLLWLLLELTQK.R | 2 |
| U | YAR019C | 1 | 1 | 2.8% | 974 | 110285 | 8.0 | CDC15 SGDID:S000000072, Chr I from 175133-172209, reverse complement, Verified ORF, "Protein kinase of the Mitotic Exit Network that is localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13399.13399.4 | 2.8295 | 0.129 | 93.8% | 3244.1765 | 3246.6445 | 64 | 3.752 | 23.1% | 1 | K.LIFSKSLLKLYDYTGQPDPIKQT*EPNR.R | 4 |
| U | YGR162W | 2 | 2 | 2.8% | 952 | 107101 | 6.0 | TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_43.25339.25339.3 | 4.9964 | 0.3995 | 100.0% | 2847.2644 | 2848.2231 | 1 | 7.646 | 33.7% | 1 | R.TGQATLEGSQLLDSLFGILDNIIQTAK.I | 3 |
| * | Jamie_FT_01_itms_43.25439.25439.2 | 2.97 | 0.3327 | 100.0% | 2847.892 | 2848.2231 | 1 | 6.605 | 32.7% | 1 | R.TGQATLEGSQLLDSLFGILDNIIQTAK.I | 2 |
| U | Reverse_YBR179C | 1 | 1 | 2.8% | 855 | 97808 | 7.0 | FZO1 SGDID:S000000383, Chr II from 589109-586542, reverse complement, Verified ORF, "Mitochondrial integral membrane protein involved in mitochondrial fusion and maintenance of the mitochondrial genome; contains N-terminal GTPase domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_16.12337.12337.3 | 2.6684 | 0.1267 | 90.5% | 2951.1543 | 2949.2463 | 58 | 3.396 | 27.2% | 1 | K.QWSLYSLFGKWT*PAFLDTISLS*VK.L | 3 |
| U | Reverse_YGL014W | 1 | 1 | 2.8% | 888 | 97798 | 6.6 | PUF4 SGDID:S000002982, Chr VII from 466146-468812, Verified ORF, "Member of the PUF protein family, which is defined by the presence of Pumilio homology domains that confer RNA binding activity; preferentially binds mRNAs encoding nucleolar ribosomal RNA-processing factors" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_39.26165.26165.2 | 1.2625 | 0.184 | 93.2% | 2861.8123 | 2860.8755 | 3 | 3.772 | 20.8% | 1 | K.ESVSNTPPIFSTS*SPT*NDFSISQTR.T | 2 |
| U | YNL258C | 1 | 1 | 2.8% | 754 | 88072 | 5.0 | DSL1 SGDID:S000005202, Chr XIV from 160374-158110, reverse complement, Verified ORF, "Endoplasmic reticulum (ER)-localized peripheral membrane protein required for Golgi-to-ER retrograde traffic; component of the ER target site that interacts with coatomer, the major component of the COPI vesicle protein coat" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_34.20149.20149.2 | 2.1319 | 0.0408 | 92.6% | 2592.5723 | 2591.914 | 11 | 3.071 | 30.0% | 1 | K.EYMNLS*RIVSMIKNSIFIS*GK.E | 2 |
| U | YLR214W | 1 | 1 | 2.8% | 686 | 78854 | 9.2 | FRE1 SGDID:S000004204, Chr XII from 568569-570629, Verified ORF, "Ferric reductase and cupric reductase, reduces siderophore-bound iron and oxidized copper prior to uptake by transporters; expression induced by low copper and iron levels" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20948.20948.2 | 2.8344 | 0.2933 | 100.0% | 2166.2322 | 2166.6758 | 17 | 4.897 | 33.3% | 1 | R.RADLMAIALFPVVYLFGIR.N | 2 |
| U | Reverse_YDL040C | 1 | 1 | 2.7% | 854 | 98905 | 8.8 | NAT1 SGDID:S000002198, Chr IV from 381435-378871, reverse complement, Verified ORF, "Subunit of the N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_35.32985.32985.4 | 2.904 | 0.1462 | 96.1% | 2637.8167 | 2633.529 | 79 | 3.683 | 25.8% | 1 | K.QS*SSNQGNNQIEDSNEDLSDSKR.K | 4 |
| U | YIL107C | 1 | 1 | 2.7% | 827 | 93417 | 8.7 | PFK26 SGDID:S000001369, Chr IX from 165758-163275, reverse complement, Verified ORF, "6-phosphofructo-2-kinase, inhibited by phosphoenolpyruvate and sn-glycerol 3-phosphate, has negligible fructose-2,6-bisphosphatase activity, transcriptional regulation involves protein kinase A" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_20.20479.20479.2 | 2.0529 | 0.0486 | 92.6% | 2519.172 | 2517.628 | 31 | 3.522 | 28.6% | 1 | R.YSVIPTAPPSARS*S*FASDFLSR.K | 2 |
| U | Reverse_YFL042C | 1 | 1 | 2.7% | 674 | 76347 | 5.0 | YFL042C SGDID:S000001852, Chr VI from 47744-45720, reverse complement, Uncharacterized ORF, "Due to a sequence change (deletion of G at 46151), YFL043C is now part of YFL042C." |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_17.09843.09843.4 | 2.6938 | 0.1356 | 94.5% | 2011.7765 | 2007.1649 | 258 | 3.743 | 31.4% | 1 | K.EVQQLPS*GIEAITANSIR.R | 4 |
| U | Reverse_YMR284W | 1 | 1 | 2.7% | 602 | 70648 | 6.4 | YKU70 SGDID:S000004897, Chr XIII from 838186-839994, Verified ORF, "Subunit of the telomeric Ku complex (Yku70p-Yku80p), involved in telomere length maintenance, structure and telomere position effect; relocates to sites of double-strand cleavage to promote nonhomologous end joining during DSB repair" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17791.17791.2 | 1.7574 | 0.0717 | 90.0% | 1867.0521 | 1864.8773 | 216 | 3.294 | 33.3% | 1 | K.VSSPS*LTYLSPHS*NSK.L | 2 |
| U | Reverse_YOR372C | 1 | 1 | 2.7% | 554 | 60523 | 9.5 | NDD1 SGDID:S000005899, Chr XV from 1036467-1034803, reverse complement, Verified ORF, "Transcriptional activator essential for nuclear division; localized to the nucleus; essential component of the mechanism that activates the expression of a set of late-S-phase-specific genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_41.34013.34013.3 | 2.4252 | 0.1291 | 91.8% | 1628.2144 | 1631.6536 | 309 | 3.788 | 39.3% | 1 | R.AQSKS*GSDSLLSQSR.K | 3 |
| U | Reverse_YIL061C | 1 | 1 | 2.7% | 300 | 34447 | 10.0 | SNP1 SGDID:S000001323, Chr IX from 245556-244654, reverse complement, Verified ORF, "Component of U1 snRNP required for mRNA splicing via spliceosome; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06908.06908.2 | 1.9142 | 0.0362 | 93.0% | 1039.5322 | 1039.2657 | 60 | 2.876 | 78.6% | 1 | R.PKFYKVTR.G | 2 |
| U | YGR094W | 1 | 1 | 2.6% | 1104 | 125770 | 7.0 | VAS1 SGDID:S000003326, Chr VII from 672190-675504, Verified ORF, "Mitochondrial and cytoplasmic valyl-tRNA synthetase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_37.22110.22110.2 | 2.7024 | 0.3919 | 100.0% | 3432.672 | 3432.7668 | 2 | 6.493 | 23.2% | 1 | K.FTLEQDEDVLDTWFSSGLWPFSTLGWPEK.T | 2 |
| U | Reverse_YBL037W | 1 | 1 | 2.6% | 1025 | 115011 | 8.6 | APL3 SGDID:S000000133, Chr II from 147212-150289, Verified ORF, "Alpha-adaptin, large subunit of the clathrin associated protein complex (AP-2); involved in vesicle mediated transport" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.13716.13716.2 | 1.638 | 0.1193 | 93.7% | 3193.7722 | 3191.4045 | 129 | 3.271 | 19.2% | 1 | K.LNITNTS*GGCKFHIALIPS*DEVDFPKR.I | 2 |
| U | YLR347C | 1 | 1 | 2.6% | 861 | 94776 | 4.6 | KAP95 SGDID:S000004339, Chr XII from 826412-823827, reverse complement, Verified ORF, "Karyopherin beta, forms a dimeric complex with Srp1p (Kap60p) that mediates nuclear import of cargo proteins via a nuclear localization signal (NLS), interacts with nucleoporins to guide transport across the nuclear pore complex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23060.23060.2 | 3.0607 | 0.3493 | 100.0% | 2306.4722 | 2304.5586 | 16 | 5.79 | 33.3% | 1 | K.DSAFIEDDVFYAISALAASLGK.G | 2 |
| U | Reverse_YJL141C | 1 | 1 | 2.6% | 807 | 91245 | 8.4 | YAK1 SGDID:S000003677, Chr X from 150308-147885, reverse complement, Verified ORF, "Serine-threonine protein kinase that is part of a glucose-sensing system involved in growth control in response to glucose availability; translocates from the cytoplasm to the nucleus and phosphorylates Pop2p in response to a glucose signal" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_18.19428.19428.2 | 1.7942 | 0.0794 | 92.1% | 2383.612 | 2381.7832 | 4 | 3.518 | 30.0% | 1 | R.LQKFPPQLPPSTSPPYASLRR.Y | 2 |
| U | YJL130C | 3 | 4 | 2.5% | 2214 | 245123 | 5.9 | URA2 SGDID:S000003666, Chr X from 172285-165641, reverse complement, Verified ORF, "Bifunctional carbamoylphosphate synthetase (CPSase)-aspartate transcarbamylase (ATCase), catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.10985.10985.2 | 1.9619 | 0.1302 | 97.8% | 1256.3722 | 1256.5284 | 231 | 4.248 | 50.0% | 1 | K.VVGVNLIELATK.A | 2 |
| * | Jamie_FT_02_itms_23.16614.16614.2 | 2.0216 | 0.1069 | 96.8% | 2169.9521 | 2170.5725 | 182 | 3.672 | 28.9% | 1 | R.SIHITGVSNKEDLALIMTVK.A | 2 |
| * | Jamie_FT_01_itms_33.19272.19272.2 | 4.1946 | 0.4455 | 100.0% | 2495.112 | 2494.9316 | 1 | 7.838 | 45.5% | 2 | K.DSLPLLLAAVEEGKLTIDDIVLR.L | 2 |
| U | YNR047W | 1 | 1 | 2.5% | 893 | 100546 | 8.0 | YNR047W SGDID:S000005330, Chr XIV from 708525-711206, Uncharacterized ORF, "Putative protein kinase that, when overexpressed, interferes with pheromone-induced growth arrest; localizes to the cytoplasm; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_27.19082.19082.2 | 1.8024 | 0.1528 | 97.6% | 2218.6921 | 2219.1106 | 14 | 4.226 | 28.6% | 1 | K.NASAHNS*SQSSLEGDSASSSSK.L | 2 |
| U | Reverse_YDR138W | 1 | 1 | 2.5% | 752 | 87829 | 5.3 | HPR1 SGDID:S000002545, Chr IV from 730573-732831, Verified ORF, "Subunit of THO/TREX, related complexes that couple transcription elongation with mitotic recombination and elongation with mRNA metabolism and export, subunit of an RNA Pol II complex; regulates lifespan; similar to Top1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_35.24163.24163.2 | 1.4202 | 0.151 | 93.1% | 2380.912 | 2383.7996 | 217 | 3.66 | 25.0% | 1 | R.ADQLKKRHEQNIKYLLKEK.F | 2 |
| U | Reverse_YER077C | 1 | 1 | 2.5% | 688 | 79548 | 9.4 | YER077C SGDID:S000000879, Chr V from 316596-314530, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15089.15089.2 | 1.8148 | 0.1318 | 96.5% | 2070.7722 | 2073.3628 | 192 | 3.653 | 31.2% | 1 | R.EKVQTKQLNTLSHFSRR.L | 2 |
| U | YBR138C | 1 | 1 | 2.5% | 524 | 60459 | 7.9 | YBR138C SGDID:S000000342, Chr II from 515330-513756, reverse complement, Uncharacterized ORF, "Cytoplasmic protein of unknown function, potentially phosphorylated by Cdc28p; YBR138C is not an essential gene" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_22.12684.12684.2 | 1.7453 | 0.1598 | 97.7% | 1582.3322 | 1580.6512 | 11 | 3.735 | 50.0% | 1 | R.NRY*VSYGPSLDTK.N | 2 |
| U | YJL138C | 1 | 3 | 2.5% | 395 | 44697 | 5.1 | TIF2 SGDID:S000003674, Chr X from 154609-153422, reverse complement, Verified ORF, "Translation initiation factor eIF4A, identical to Tif1p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" |
| U | YKR059W | 1 | 3 | 2.5% | 395 | 44697 | 5.1 | TIF1 SGDID:S000001767, Chr XI from 554629-555816, Verified ORF, "Translation initiation factor eIF4A, identical to Tif2p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_15.08672.08672.2 | 2.363 | 0.0374 | 96.8% | 1115.7522 | 1115.3585 | 38 | 3.536 | 66.7% | 3 | R.ILISTDLLAR.G | 2 |
| U | Reverse_YER164W | 1 | 1 | 2.4% | 1468 | 168241 | 6.5 | CHD1 SGDID:S000000966, Chr V from 505387-509793, Verified ORF, "Nucleosome remodeling factor that functions in regulation of transcription elongation; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SILK complexes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_28.16509.16509.4 | 3.648 | 0.0548 | 90.6% | 4193.7363 | 4193.627 | 381 | 2.538 | 18.1% | 1 | K.NQRNSFRTPIKVTSQKESQSKPKS*KSKS*KTRSKPK.S | 4 |
| U | YMR205C | 1 | 2 | 2.4% | 959 | 104618 | 6.7 | PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.13499.13499.3 | 3.6429 | 0.2568 | 100.0% | 2670.4744 | 2670.9812 | 3 | 4.968 | 29.5% | 2 | K.YEFDGLIIVGGFEAFESLHQLER.A | 3 |
| U | Reverse_YLR188W | 1 | 1 | 2.4% | 695 | 75950 | 9.8 | MDL1 SGDID:S000004178, Chr XII from 528302-530389, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane, mediates export of peptides generated upon proteolysis of mitochondrial proteins, plays a role in the regulation of cellular resistance to oxidative stress" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_20.11883.11883.2 | 1.7104 | 0.1701 | 97.5% | 1866.3322 | 1866.0842 | 26 | 4.03 | 37.5% | 1 | R.FS*GTEVVSGHKGLVIVR.T | 2 |
| U | YOR330C | 1 | 1 | 2.3% | 1254 | 143502 | 8.8 | MIP1 SGDID:S000005857, Chr XV from 943380-939616, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial DNA polymerase" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_24.17561.17561.3 | 3.1618 | 0.1909 | 98.4% | 3302.5144 | 3304.7917 | 168 | 4.225 | 19.6% | 1 | K.ADQRIRLPVNMPDYPTLHKIANDSAIPEK.Q | 3 |
| U | YER110C | 1 | 2 | 2.3% | 1113 | 122601 | 4.6 | KAP123 SGDID:S000000912, Chr V from 382099-378758, reverse complement, Verified ORF, "Karyopherin beta, mediates nuclear import of ribosomal proteins prior to assembly into ribosomes and import of histones H3 and H4; localizes to the nuclear pore, nucleus, and cytoplasm; exhibits genetic interactions with RAI1" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_28.19963.19963.3 | 5.3005 | 0.4763 | 100.0% | 2874.3843 | 2875.3342 | 1 | 8.778 | 32.0% | 2 | K.NIVIYNYATVALDGLLEFIAYDAIAK.Y | 3 |
| U | YLL032C | 1 | 1 | 2.3% | 825 | 94597 | 7.2 | YLL032C SGDID:S000003955, Chr XII from 76746-74269, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_23.16704.16704.2 | 1.8461 | 0.1467 | 97.6% | 2150.5923 | 2152.2021 | 8 | 3.954 | 33.3% | 1 | K.S*RTTIDNTSQSGASPQRHK.M | 2 |
| U | YML002W | 1 | 1 | 2.3% | 737 | 84602 | 6.7 | YML002W SGDID:S000004461, Chr XIII from 264541-266754, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_36.21497.21497.2 | 1.7628 | 0.1142 | 94.3% | 2176.5322 | 2179.409 | 2 | 3.478 | 37.5% | 1 | K.IPENLFTDEASILY*WMR.I | 2 |
| U | YHR149C | 1 | 1 | 2.3% | 734 | 81849 | 5.0 | SKG6 SGDID:S000001192, Chr VIII from 396662-394458, reverse complement, Uncharacterized ORF, "Protein of unknown function; found in the bud tip and bud neck, potential Cdc28p substrate; Skg6p interacts with Zds1p and Zds2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_11.06053.06053.4 | 2.9305 | 0.1324 | 96.3% | 1845.0565 | 1850.6287 | 36 | 3.704 | 33.3% | 1 | R.DDSDSSSS*SASS*TKNSK.S | 4 |
| U | YJR053W | 1 | 1 | 2.3% | 574 | 66087 | 5.9 | BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_14.08295.08295.2 | 2.3035 | 0.1189 | 99.0% | 1516.1522 | 1515.768 | 14 | 3.854 | 58.3% | 1 | K.VIGNMILDEQNLR.W | 2 |
| U | Reverse_YKL014C | 1 | 1 | 2.2% | 1764 | 203286 | 7.3 | URB1 SGDID:S000001497, Chr XI from 416556-411262, reverse complement, Verified ORF, "Nucleolar protein required for the normal accumulation of 25S and 5.8S rRNAs, associated with the 27SA2 pre-ribosomal particle; proposed to be involved in the biogenesis of the 60S ribosomal subunit" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20917.20917.3 | 3.0657 | 0.1268 | 94.7% | 4478.724 | 4481.997 | 54 | 3.74 | 16.4% | 1 | K.NVPLRSINMLNKSPLASIYQFFSSSKMSSILSNSS*NT*KK.I | 3 |
| U | YAL021C | 1 | 1 | 2.2% | 837 | 94670 | 6.9 | CCR4 SGDID:S000000019, Chr I from 113360-110847, reverse complement, Verified ORF, "Component of the CCR4-NOT transcriptional complex, which is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_03_itms_13.16754.16754.2 | 1.585 | 0.1134 | 92.4% | 2139.0522 | 2139.5027 | 40 | 3.723 | 32.4% | 1 | K.ILTEKSVTGLIFYLRDNR.P | 2 |
| U | Reverse_YGR250C | 1 | 1 | 2.2% | 781 | 89513 | 5.4 | YGR250C SGDID:S000003482, Chr VII from 993526-991181, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06992.06992.4 | 3.5618 | 0.0344 | 91.0% | 1962.6965 | 1962.8058 | 42 | 3.228 | 35.4% | 1 | K.NSEVSGEENFSVSS*S*SR.T | 4 |
| U | YBL009W | 1 | 1 | 2.2% | 676 | 76372 | 9.4 | YBL009W SGDID:S000000105, Chr II from 207197-209227, Uncharacterized ORF, "haspin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15571.15571.2 | 2.0878 | 0.0391 | 91.6% | 1904.5322 | 1904.0494 | 71 | 2.962 | 39.3% | 1 | K.FWKNDNLLSRSLSS*R.S | 2 |
| U | Reverse_YMR097C | 1 | 1 | 2.2% | 367 | 42144 | 9.5 | MTG1 SGDID:S000004703, Chr XIII from 460526-459423, reverse complement, Verified ORF, "Peripheral GTPase of the mitochondrial inner membrane, essential for respiratory competence, likely functions in assembly of the large ribosomal subunit, has homologs in plants and animals" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_13.07479.07479.2 | 2.2125 | 0.0166 | 95.5% | 959.2922 | 959.1337 | 22 | 3.612 | 78.6% | 1 | K.LLNRVDTK.N | 2 |
| U | YDL171C | 1 | 1 | 2.1% | 2145 | 238100 | 6.6 | GLT1 SGDID:S000002330, Chr IV from 155641-149204, reverse complement, Verified ORF, "NAD(+)-dependent glutamate synthase (GOGAT), synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_27.19290.19290.4 | 3.4356 | 0.1368 | 97.1% | 4892.2563 | 4891.158 | 2 | 3.757 | 17.0% | 1 | K.FKSDENVIVGNTCFYGATSGT*AFISGSAGERFGVRNS*GATIVVER.I | 4 |
| U | YGR204W | 1 | 2 | 2.1% | 946 | 102205 | 6.8 | ADE3 SGDID:S000003436, Chr VII from 905939-908779, Verified ORF, "Cytoplasmic trifunctional enzyme C1-tetrahydrofolate synthase, involved in single carbon metabolism and required for biosynthesis of purines, thymidylate, methionine, and histidine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_21.15830.15830.2 | 3.6608 | 0.2924 | 100.0% | 2079.9922 | 2080.4878 | 6 | 5.688 | 36.8% | 2 | R.VTGFDITVASELMAILALSK.D | 2 |
| U | YDR138W | 1 | 1 | 2.1% | 752 | 87829 | 5.3 | HPR1 SGDID:S000002545, Chr IV from 730573-732831, Verified ORF, "Subunit of THO/TREX, related complexes that couple transcription elongation with mitotic recombination and elongation with mRNA metabolism and export, subunit of an RNA Pol II complex; regulates lifespan; similar to Top1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13749.13749.2 | 1.8352 | 0.1047 | 94.3% | 2056.632 | 2056.1997 | 266 | 3.653 | 33.3% | 1 | K.ERKKRALEEEAS*FPER.E | 2 |
| U | Reverse_YBR302C | 1 | 1 | 2.1% | 379 | 45165 | 8.5 | COS2 SGDID:S000000506, Chr II from 811473-810334, reverse complement, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| U | Reverse_YNL336W | 1 | 1 | 2.1% | 381 | 45288 | 8.5 | COS1 SGDID:S000005280, Chr XIV from 8330-9475, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| U | Reverse_YML132W | 1 | 1 | 2.1% | 379 | 45165 | 8.5 | COS3 SGDID:S000004601, Chr XIII from 7244-8383, Verified ORF, "Protein involved in salt resistance; interacts with sodium:hydrogen antiporter Nha1p; member of a family of conserved, often subtelomerically-encoded proteins" |
| U | Reverse_YJR161C | 1 | 1 | 2.1% | 383 | 45709 | 8.4 | COS5 SGDID:S000003922, Chr X from 743914-742763, reverse complement, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| U | Reverse_YHL048W | 1 | 1 | 2.1% | 381 | 45880 | 8.3 | COS8 SGDID:S000001040, Chr VIII from 6400-7545, Verified ORF, "Nuclear membrane protein, member of a family of conserved, often subtelomerically-encoded proteins; regulation suggests a potential role in the unfolded protein response" |
| U | Reverse_YFL062W | 1 | 1 | 2.1% | 379 | 45312 | 8.8 | COS4 SGDID:S000001832, Chr VI from 6426-7565, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| U | Reverse_YDL248W | 1 | 1 | 2.1% | 383 | 45680 | 8.6 | COS7 SGDID:S000002407, Chr IV from 1802-2953, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_12.06905.06905.2 | 1.9257 | 0.0164 | 90.8% | 894.6322 | 895.0434 | 10 | 2.694 | 78.6% | 1 | K.FSLVDVSK.E | 2 |
| U | YFL007W | 1 | 1 | 2.0% | 2143 | 245993 | 5.9 | BLM10 SGDID:S000001887, Chr VI from 123474-129905, Verified ORF, "Protein involved in nuclear assembly and or regulation of proteasomal core particles; required for normal resistance to bleomycin, may be involved in protection against oxidative damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_18.13573.13573.3 | 2.4671 | 0.1486 | 90.6% | 5181.534 | 5185.6074 | 137 | 4.077 | 14.0% | 1 | R.RFDKQHLS*FQWHVPSSDEITLSISILESLSEY*CINNVEELMK.A | 3 |
| U | YLR067C | 1 | 1 | 2.0% | 965 | 112646 | 9.3 | PET309 SGDID:S000004057, Chr XII from 270711-267814, reverse complement, Verified ORF, "Specific translational activator for the COX1 mRNA, also influences stability of intron-containing COX1 primary transcripts; located in the mitochondrial inner membrane" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_31.18339.18339.2 | 1.7715 | 0.0795 | 91.5% | 2400.6921 | 2399.638 | 28 | 3.007 | 33.3% | 1 | K.KY*DITPSTAT*HTIMLKVYR.G | 2 |
| U | Reverse_YPL150W | 1 | 1 | 2.0% | 901 | 100646 | 9.4 | YPL150W SGDID:S000006071, Chr XVI from 268187-270892, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_3.11674.11674.2 | 1.6222 | 0.1341 | 94.2% | 2250.1921 | 2251.3125 | 17 | 3.778 | 38.2% | 1 | K.T*MCERT*FGFDTLKANGNK.D | 2 |
| U | Reverse_YNR047W | 1 | 1 | 2.0% | 893 | 100546 | 8.0 | YNR047W SGDID:S000005330, Chr XIV from 708525-711206, Uncharacterized ORF, "Putative protein kinase that, when overexpressed, interferes with pheromone-induced growth arrest; localizes to the cytoplasm; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_22.12663.12663.3 | 2.8839 | 0.2026 | 98.7% | 2021.1843 | 2023.0348 | 249 | 3.974 | 30.9% | 1 | K.S*SGRSPSGNLTDKLS*LDK.P | 3 |
| U | YOR144C | 1 | 1 | 2.0% | 791 | 91262 | 7.0 | ELG1 SGDID:S000005670, Chr XV from 605092-602717, reverse complement, Verified ORF, "Protein required for S phase progression and telomere homeostasis, forms an alternative replication factor C complex important for DNA replication and genome integrity; mutants are sensitive to DNA damage" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_14.11558.11558.2 | 1.7885 | 0.1062 | 94.3% | 2130.9521 | 2133.2388 | 1 | 3.261 | 36.7% | 1 | K.NWIETSFHT*LEKPT*LR.N | 2 |
| U | YER041W | 1 | 1 | 2.0% | 759 | 87390 | 7.2 | YEN1 SGDID:S000000843, Chr V from 232460-234739, Verified ORF, "Protein of unknown function, has similarity to endonuclease Rth1p; potentially phosphorylated by Cdc28p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_29.16913.16913.2 | 1.7682 | 0.0826 | 91.7% | 1816.6921 | 1818.8949 | 7 | 2.983 | 39.3% | 1 | R.SYT*TTGKAVINFIS*R.L | 2 |
| U | Reverse_YNL118C | 1 | 1 | 1.9% | 970 | 108667 | 5.9 | DCP2 SGDID:S000005062, Chr XIV from 405566-402654, reverse complement, Verified ORF, "Protein required for the decapping of mRNAs, functions to allow the production of active Dcp1p, contains a pyrophosphatase MutT motif and several alpha-helical leucine-rich motifs" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_27.16064.16064.2 | 1.7748 | 0.1067 | 93.9% | 2023.7322 | 2021.9628 | 5 | 3.77 | 35.3% | 1 | K.GPGWEVSNS*EASANLNT*K.S | 2 |
| U | Reverse_YGR288W | 1 | 1 | 1.9% | 473 | 54325 | 6.6 | MAL13 SGDID:S000003520, Chr VII from 1070299-1071720, Verified ORF, "MAL-activator protein, part of complex locus MAL1; nonfunctional in genomic reference strain S288C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08929.08929.2 | 1.8715 | 0.0748 | 94.7% | 995.0522 | 994.0953 | 1 | 3.934 | 75.0% | 1 | R.ANSIQAFSR.H | 2 |
| U | YJL109C | 1 | 1 | 1.8% | 1769 | 200080 | 6.5 | UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23028.23028.2 | 2.5322 | 0.1955 | 100.0% | 3381.2722 | 3380.9067 | 1 | 4.316 | 25.0% | 1 | K.VLGNVLQILPVDEFVNAVLPLLSTSTNEDIR.Y | 2 |
| U | YER164W | 1 | 1 | 1.8% | 1468 | 168240 | 6.5 | CHD1 SGDID:S000000966, Chr V from 505387-509793, Verified ORF, "Nucleosome remodeling factor that functions in regulation of transcription elongation; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SILK complexes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_20.14929.14929.2 | 1.9023 | 0.0732 | 92.8% | 2886.5923 | 2888.6792 | 212 | 4.025 | 22.0% | 1 | K.NSVNGDGT*AANSDSDDDSTSRSS*RRR.A | 2 |
| U | Reverse_YDR038C | 1 | 1 | 1.8% | 1091 | 120296 | 5.5 | ENA5 SGDID:S000002445, Chr IV from 530693-527418, reverse complement, Verified ORF, "Protein with similarity to P-type ATPase sodium pumps" |
| U | Reverse_YDR040C | 1 | 1 | 1.8% | 1091 | 120357 | 5.6 | ENA1 SGDID:S000002447, Chr IV from 538463-535188, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ and Li+ efflux to allow salt tolerance" |
| U | Reverse_YDR039C | 1 | 1 | 1.8% | 1091 | 120317 | 5.5 | ENA2 SGDID:S000002446, Chr IV from 534578-531303, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Jamie_FT_01_itms_23.13649.13649.2 | 1.8617 | 0.0646 | 91.3% | 2250.7522 | 2252.4175 | 3 | 3.585 | 34.2% | 1 | K.VGDKGYWSSCCSIISEFAGK.G | 2 |
| U | Reverse_YNL278W | 1 | 1 | 1.8% | 1060 | 118280 | 8.9 | CAF120 SGDID:S000005222, Chr XIV from 113271-116453, Verified ORF, "Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_17.12971.12971.2 | 1.8853 | 0.0676 | 92.2% | 2174.152 | 2172.527 | 57 | 3.091 | 30.6% | 1 | K.KEFKVS*GVVKIITSSDILK.P | 2 |
| U | Reverse_YLR305C | 1 | 1 | 1.7% | 1900 | 214606 | 7.5 | STT4 SGDID:S000004296, Chr XII from 743865-738163, reverse complement, Verified ORF, "Phosphatidylinositol-4-kinase that functions in the Pkc1p protein kinase pathway; required for normal vacuole morphology, cell wall integrity, and actin cytoskeleton organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_19.14226.14226.4 | 3.4465 | 0.0761 | 92.5% | 3979.8164 | 3978.417 | 122 | 3.04 | 17.7% | 1 | K.ASKHLRSLT*TARWSSSS*PVLITTKSHKLKFEYR.P | 4 |
| U | Reverse_YLR223C | 1 | 1 | 1.7% | 1085 | 122491 | 4.7 | IFH1 SGDID:S000004213, Chr XII from 585492-582235, reverse complement, Verified ORF, "Essential protein with a highly acidic N-terminal domain; IFH1 exhibits genetic interactions with FHL1, overexpression interferes with silencing at telomeres and HM loci; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_11.16964.16964.2 | 1.5344 | 0.1307 | 92.9% | 2152.912 | 2150.363 | 83 | 3.939 | 29.4% | 1 | K.SLKEDNLMLPLS*TS*LSLK.P | 2 |
| U | YNR011C | 1 | 1 | 1.7% | 876 | 99813 | 8.4 | PRP2 SGDID:S000005294, Chr XIV from 646952-644322, reverse complement, Verified ORF, "RNA-dependent ATPase in the DEAH-box family, required for activation of the spliceosome before the first transesterification step in RNA splicing" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_25.14988.14988.2 | 1.9531 | 0.0883 | 94.3% | 1932.0922 | 1933.0663 | 8 | 3.461 | 42.9% | 1 | K.LSKYS*CIMIDEAHER.T | 2 |
| U | YDR266C | 1 | 1 | 1.7% | 639 | 72756 | 9.0 | YDR266C SGDID:S000002674, Chr IV from 1002017-1000098, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_22.12761.12761.2 | 1.6351 | 0.1364 | 95.9% | 1227.7922 | 1229.2462 | 59 | 3.38 | 55.0% | 1 | R.ELNTTS*GGNKK.K | 2 |
| U | YGL195W | 2 | 2 | 1.6% | 2672 | 296697 | 5.3 | GCN1 SGDID:S000003163, Chr VII from 131531-139549, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn20p; proposed to stimulate Gcn2p activation by an uncharged tRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_48.28597.28597.3 | 5.8331 | 0.3318 | 100.0% | 2687.6943 | 2687.1584 | 1 | 6.661 | 35.2% | 1 | K.SLVTSILLDILNLEPCLLENFIR.F | 3 |
| * | Jamie_FT_05_itms_8.17660.17660.2 | 1.8059 | 0.0738 | 91.4% | 2225.5723 | 2226.597 | 21 | 3.119 | 33.3% | 1 | K.SSKEVVRS*VSLQSMIILLR.K | 2 |
| U | YGR184C | 2 | 2 | 1.6% | 1950 | 224836 | 5.5 | UBR1 SGDID:S000003416, Chr VII from 865758-859906, reverse complement, Verified ORF, "Ubiquitin-protein ligase (E3) that interacts with Rad6p/Ubc2p to ubiquitinate substrates of the N-end rule pathway; binds to the Rpn2p, Rpt1p, and Rpt6p proteins of the 19S particle of the 26S proteasome" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_8.15177.15177.2 | 1.6722 | 0.0879 | 90.7% | 1761.4521 | 1759.8705 | 399 | 3.695 | 42.3% | 1 | R.IISS*FLGNRSLT*YK.L | 2 |
| * | Jamie_FT_01_itms_36.21290.21290.2 | 2.2574 | 0.0901 | 97.6% | 1984.7522 | 1983.4347 | 9 | 4.407 | 37.5% | 1 | R.VAFMNPLQTMLSFLIEK.V | 2 |
| U | Reverse_YAL029C | 1 | 1 | 1.6% | 1471 | 169343 | 7.6 | MYO4 SGDID:S000000027, Chr I from 92271-87856, reverse complement, Verified ORF, "One of two type V myosins; required for mother-specific HO expression, for the bud tip localization of ASH1 and IST2 mRNA; facilitates growth and orientation of ER tubules along with She3p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_32.18672.18672.2 | 1.6974 | 0.1286 | 94.8% | 3064.6921 | 3065.5425 | 210 | 2.986 | 21.7% | 1 | K.QLVIY*RRRALQMRMASQVLIS*SRK.L | 2 |
| U | Reverse_YDL195W | 1 | 1 | 1.6% | 1273 | 138703 | 5.7 | SEC31 SGDID:S000002354, Chr IV from 107209-111030, Verified ORF, "Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17833.17833.2 | 1.9998 | 0.0492 | 91.4% | 2343.5122 | 2343.4636 | 17 | 3.356 | 31.6% | 1 | K.FDKT*KLAESLTTNSELGS*IK.P | 2 |
| U | YPR033C | 1 | 1 | 1.6% | 546 | 59953 | 7.7 | HTS1 SGDID:S000006237, Chr XVI from 639016-637376, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial histidine tRNA synthetase; encoded by a single nuclear gene that specifies two messages; efficient mitochondrial localization requires both a presequence and an amino-terminal sequence " |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_8.04718.04718.2 | 1.5765 | 0.1395 | 96.0% | 1044.5922 | 1044.9615 | 264 | 3.869 | 56.2% | 1 | K.GQSEET*ADK.I | 2 |
| U | YMR093W | 1 | 1 | 1.6% | 513 | 57686 | 9.3 | UTP15 SGDID:S000004699, Chr XIII from 454014-455555, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_13.07405.07405.2 | 1.8277 | 0.0562 | 93.8% | 1059.9922 | 1059.1674 | 162 | 3.368 | 71.4% | 1 | R.QVIKT*FSR.F | 2 |
| U | YEL041W | 1 | 1 | 1.6% | 495 | 55874 | 5.8 | YEL041W SGDID:S000000767, Chr V from 75944-77431, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_14.08118.08118.2 | 2.0174 | 0.0589 | 96.3% | 1043.4521 | 1044.2389 | 1 | 3.375 | 92.9% | 1 | R.EVVEWILR.N | 2 |
| U | Reverse_YFL016C | 1 | 1 | 1.6% | 511 | 55561 | 9.2 | MDJ1 SGDID:S000001878, Chr VI from 106230-104695, reverse complement, Verified ORF, "Protein involved in folding of mitochondrially synthesized proteins in the mitochondrial matrix; localizes to the mitochondrial inner membrane; member of the DnaJ family of molecular chaperones" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_10.05592.05592.2 | 2.2414 | 0.0367 | 97.1% | 1043.9521 | 1043.2137 | 248 | 3.769 | 71.4% | 1 | R.YLINNIHR.S | 2 |
| U | YNR016C | 2 | 3 | 1.5% | 2233 | 250351 | 6.3 | ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_25.18101.18101.3 | 4.515 | 0.4106 | 100.0% | 3836.0344 | 3836.3794 | 1 | 7.195 | 22.0% | 1 | K.DLIDSNYVVFDVLLQFLTHQDPVVTAAAAQVYIR.R | 3 |
| * | Jamie_FT_02_itms_25.18132.18132.4 | 4.9625 | 0.1026 | 99.3% | 3836.3364 | 3836.3794 | 10 | 4.197 | 20.2% | 2 | K.DLIDSNYVVFDVLLQFLTHQDPVVTAAAAQVYIR.R | 4 |
| U | YNL172W | 1 | 1 | 1.5% | 1748 | 196143 | 6.0 | APC1 SGDID:S000005116, Chr XIV from 310638-315884, Verified ORF, "Largest subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19481.19481.2 | 2.2292 | 0.0364 | 93.3% | 2987.3323 | 2990.3267 | 90 | 2.872 | 24.0% | 1 | R.MSDSIFAQLVSLLNVNDEMVADEEYR.L | 2 |
| U | YOR153W | 1 | 1 | 1.5% | 1511 | 170437 | 7.8 | PDR5 SGDID:S000005679, Chr XV from 619840-624375, Verified ORF, "Short-lived membrane ABC (ATP-binding cassette) transporter, actively exports various drugs, expression regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_39.23281.23281.2 | 2.2805 | 0.1316 | 99.0% | 2320.892 | 2318.7617 | 60 | 3.724 | 31.0% | 1 | R.VSPLTYFIQALLAVGVANVDVK.C | 2 |
| U | YGL092W | 1 | 1 | 1.5% | 1317 | 145661 | 5.7 | NUP145 SGDID:S000003060, Chr VII from 337909-341862, Verified ORF, "Essential nucleoporin, catalyzes its own cleavage in vivo to generate a C-terminal fragment that assembles into the Nup84p subcomplex of the nuclear pore complex, and an N-terminal fragment of unknown function that is homologous to Nup100p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20426.20426.2 | 2.4074 | 0.0497 | 96.1% | 2382.4521 | 2380.7031 | 177 | 3.36 | 28.9% | 1 | R.NSSNEIEQIFLYLLLNDVVR.A | 2 |
| U | YIL156W | 1 | 1 | 1.5% | 1071 | 123134 | 7.9 | UBP7 SGDID:S000001418, Chr IX from 48091-51306, Verified ORF, "Ubiquitin-specific protease that cleaves ubiquitin-protein fusions" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_04_itms_5.13325.13325.2 | 1.4981 | 0.119 | 90.8% | 2024.4922 | 2027.3481 | 281 | 3.125 | 30.0% | 1 | K.MYENEMNMT*NVVLMVK.K | 2 |
| U | YKL182W | 1 | 2 | 1.4% | 2051 | 228689 | 5.9 | FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_33.19652.19652.2 | 3.4037 | 0.246 | 100.0% | 3070.152 | 3067.5493 | 18 | 5.472 | 25.0% | 2 | K.GYPIQFLTIGAGVPSLEVASEYIETLGLK.Y | 2 |
| U | Reverse_YDR464W | 1 | 1 | 1.4% | 1435 | 161596 | 8.9 | SPP41 SGDID:S000002872, Chr IV from 1388862-1393169, Verified ORF, "Protein involved in negative regulation of expression of spliceosome components PRP4 and PRP3" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_05_itms_3.13425.13425.2 | 1.1976 | 0.1833 | 92.0% | 2212.6921 | 2210.32 | 108 | 4.44 | 21.1% | 1 | K.KKKKST*SESAPS*KNATSAAK.S | 2 |
| U | YLL003W | 1 | 1 | 1.4% | 946 | 112978 | 9.8 | SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.11294.11294.2 | 2.341 | 0.146 | 99.5% | 1492.7922 | 1490.7393 | 1 | 3.924 | 66.7% | 1 | K.FIALSLAEYTYAK.N | 2 |
| U | Reverse_YLR115W | 1 | 1 | 1.4% | 859 | 96254 | 7.6 | CFT2 SGDID:S000004105, Chr XII from 377986-380565, Verified ORF, "Subunit of the mRNA cleavage and polyadenlylation factor (CPF); required for pre-mRNA cleavage, polyadenylation and poly(A) site recognition, 43% similarity with the mammalian CPSF-100 protein." |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10449.10449.2 | 2.1498 | 0.3347 | 94.7% | 1303.6721 | 1303.5419 | 63 | 5.285 | 50.0% | 1 | T.LILTTKESNGVK.I | 2 |
| U | Reverse_YER001W | 1 | 1 | 1.4% | 762 | 88529 | 7.2 | MNN1 SGDID:S000000803, Chr V from 153519-155807, Verified ORF, "Alpha-1,3-mannosyltransferase, integral membrane glycoprotein of the Golgi complex, required for addition of alpha1,3-mannose linkages to N-linked and O-linked oligosaccharides, one of five S. cerevisiae proteins of the MNN1 family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08766.08766.2 | 1.8031 | 0.0624 | 91.7% | 1365.0922 | 1364.587 | 66 | 3.418 | 55.0% | 1 | R.HNYSYPKLLTK.H | 2 |
| U | YLR266C | 1 | 1 | 1.4% | 701 | 81274 | 6.8 | PDR8 SGDID:S000004256, Chr XII from 677726-675621, reverse complement, Verified ORF, "Transcription factor; targets include ATP-binding cassette (ABC) transporters, major facilitator superfamily transporters, and other genes involved in the pleiotropic drug resistance (PDR) phenomenon" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08840.08840.2 | 1.7474 | 0.0638 | 91.5% | 1316.6122 | 1314.5022 | 16 | 3.072 | 61.1% | 1 | R.EIHKREMNEK.L | 2 |
| U | Reverse_YHR045W | 1 | 1 | 1.4% | 560 | 62692 | 7.0 | YHR045W SGDID:S000001087, Chr VIII from 195544-197226, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07008.07008.2 | 1.6214 | 0.0704 | 90.7% | 1061.2722 | 1061.0966 | 50 | 3.095 | 71.4% | 1 | K.ELS*HPEIR.A | 2 |
| U | Reverse_YOR165W | 1 | 1 | 1.3% | 776 | 89432 | 5.3 | SEY1 SGDID:S000005691, Chr XV from 644566-646896, Verified ORF, "Protein of unknown function, contains two predicted GTP-binding motifs GXXXXGKS and DXXG near the N-terminus, homolog of the Arabidopsis gene RHD3 (Root Hair Defective)" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06680.06680.2 | 1.8119 | 0.1257 | 97.4% | 1185.3722 | 1184.3348 | 2 | 3.552 | 72.2% | 1 | K.EEDILQIAPR.D | 2 |
| U | Reverse_YFL033C | 1 | 1 | 1.2% | 1770 | 196530 | 6.5 | RIM15 SGDID:S000001861, Chr VI from 74425-69113, reverse complement, Verified ORF, "Glucose-repressible protein kinase involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; originally identified as a regulator of IME2" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_25.18001.18001.2 | 2.0059 | 0.1322 | 97.7% | 2244.912 | 2243.3528 | 161 | 3.16 | 27.5% | 1 | R.S*VLEDGAGVSVVTCGLNELDK.T | 2 |
| U | YDR093W | 1 | 1 | 1.2% | 1612 | 182617 | 6.2 | DNF2 SGDID:S000002500, Chr IV from 631277-636115, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport; potential Cdc28p substrate" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_22.16001.16001.2 | 2.0029 | 0.1556 | 98.9% | 2332.4321 | 2330.6133 | 11 | 4.039 | 36.1% | 1 | R.QS*LKCSKIIKSSRDITRTK.F | 2 |
| U | YML072C | 1 | 1 | 1.2% | 1545 | 171075 | 7.1 | TCB3 SGDID:S000004537, Chr XIII from 129367-124730, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; localized to the bud; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; mRNA is targeted to the bud via the mRNA transport system involving She2p; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_35.20670.20670.2 | 1.7224 | 0.0912 | 92.4% | 2228.2522 | 2226.241 | 16 | 3.399 | 30.6% | 1 | K.SQKANNDGVAVFDEECS*FK.A | 2 |
| U | Reverse_YJL042W | 1 | 1 | 1.2% | 1398 | 155207 | 7.3 | MHP1 SGDID:S000003578, Chr X from 361165-365361, Verified ORF, "Microtubule-associated protein involved in assembly and stabilization of microtubules; overproduction results in cell cycle arrest at G2 phase; similar to Drosophila protein MAP and to mammalian MAP4 proteins" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_30.17556.17556.2 | 2.1037 | 0.1317 | 97.9% | 2038.6122 | 2038.1013 | 59 | 3.718 | 34.4% | 1 | R.RIAAGRDVHT*PS*PSREK.R | 2 |
| U | YER114C | 1 | 1 | 1.2% | 1040 | 115688 | 8.8 | BOI2 SGDID:S000000916, Chr V from 393708-390586, reverse complement, Verified ORF, "Protein implicated in polar growth, functionally redundant with Boi1p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_11.06452.06452.2 | 1.4891 | 0.193 | 97.6% | 1588.9722 | 1589.5759 | 4 | 3.779 | 50.0% | 1 | K.RSS*S*ASRTSSFKK.S | 2 |
| U | Reverse_YMR266W | 1 | 1 | 1.2% | 953 | 107672 | 8.6 | YMR266W SGDID:S000004879, Chr XIII from 798517-801378, Uncharacterized ORF, "Membrane protein of unknown function; overexpression suppresses NaCl sensitivity of sro7 mutant" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08797.08797.2 | 1.9973 | 0.0236 | 90.2% | 1328.2522 | 1328.6064 | 29 | 3.297 | 55.0% | 1 | K.AVKNIKHHPRK.K | 2 |
| U | Reverse_YGL205W | 1 | 1 | 1.2% | 748 | 84042 | 8.5 | POX1 SGDID:S000003173, Chr VII from 108162-110408, Verified ORF, "Fatty-acyl coenzyme A oxidase, involved in the fatty acid beta-oxidation pathway; localized to the peroxisomal matrix" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06866.06866.2 | 1.7755 | 0.0495 | 90.9% | 918.21216 | 917.9945 | 248 | 2.743 | 68.8% | 1 | K.VTVSGDPSR.V | 2 |
| U | Reverse_YOL081W | 1 | 1 | 1.1% | 3079 | 351669 | 7.1 | IRA2 SGDID:S000005441, Chr XV from 171069-180308, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_37.24972.24972.4 | 2.7199 | 0.1815 | 96.4% | 4324.1367 | 4323.8975 | 177 | 4.096 | 17.2% | 1 | K.SHTYTHWKKY*IMRMSDLLIANPIT*AFRLINNRTR.R | 4 |
| U | YPL242C | 1 | 1 | 1.1% | 1495 | 172830 | 8.9 | IQG1 SGDID:S000006163, Chr XVI from 95109-90622, reverse complement, Verified ORF, "Essential protein required for determination of budding pattern, promotes localization of axial markers Bud4p and Cdc12p and functionally interacts with Sec3p, localizes to the contractile ring during anaphase, member of the IQGAP family" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06848.06848.2 | 1.5471 | 0.1767 | 96.8% | 1886.2922 | 1886.881 | 221 | 4.18 | 28.1% | 1 | K.S*LGT*NINTAPASPEEPK.E | 2 |
| U | YBL079W | 1 | 1 | 1.1% | 1502 | 169474 | 6.1 | NUP170 SGDID:S000000175, Chr II from 75256-79764, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_26.15242.15242.2 | 1.7309 | 0.0888 | 92.3% | 1701.5122 | 1699.6396 | 2 | 3.049 | 50.0% | 1 | K.KENSS*VTGTTATAGS*K.T | 2 |
| U | YGL131C | 1 | 1 | 1.1% | 1403 | 163203 | 8.6 | SNT2 SGDID:S000003099, Chr VII from 265864-261653, reverse complement, Verified ORF, "DNA binding protein with similarity to the S. pombe Snt2 protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_19.10890.10890.2 | 3.0767 | 0.2698 | 100.0% | 1967.9722 | 1967.2291 | 23 | 5.088 | 43.3% | 1 | A.HNKLLEWELVQDSELI.I | 2 |
| U | Reverse_YPR164W | 1 | 1 | 1.1% | 1407 | 161237 | 5.9 | MMS1 SGDID:S000006368, Chr XVI from 870699-874922, Verified ORF, "Protein likely involved in protection against replication-dependent DNA damage; mutants are sensitive to methyl methanesulfonate (MMS); implicated in regulation of Ty1 transposition" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_02_itms_40.27272.27272.2 | 1.9729 | 0.0538 | 91.5% | 1816.8322 | 1818.9353 | 206 | 3.297 | 35.7% | 1 | R.S*NDLKYSDIIQNSIK.N | 2 |
| U | YDR507C | 1 | 1 | 1.1% | 1142 | 129858 | 9.2 | GIN4 SGDID:S000002915, Chr IV from 1465776-1462348, reverse complement, Verified ORF, "Protein kinase involved in bud growth and assembly of the septin ring, proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Kcc4p and Hsl1p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06761.06761.2 | 2.1304 | 0.0492 | 94.2% | 1228.0721 | 1229.4802 | 211 | 3.244 | 59.1% | 1 | -.MAINGNSIPAIK.D | 2 |
| U | YAL019W | 1 | 1 | 1.1% | 1131 | 128507 | 5.4 | FUN30 SGDID:S000000017, Chr I from 114920-118315, Verified ORF, "Protein whose overexpression affects chromosome stability, potential Cdc28p substrate; homolog of Snf2p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06873.06873.3 | 2.8428 | 0.2336 | 100.0% | 1485.5944 | 1489.5015 | 138 | 4.677 | 38.6% | 1 | K.SNS*FNLQSARER.L | 3 |
| U | YNL243W | 1 | 1 | 1.1% | 968 | 108996 | 5.5 | SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_20.11701.11701.2 | 2.3256 | 0.0385 | 96.0% | 1260.6522 | 1259.4886 | 57 | 3.598 | 60.0% | 1 | R.IDSDLQKALKK.A | 2 |
| U | Reverse_YLL007C | 1 | 2 | 1.1% | 665 | 76622 | 5.9 | YLL007C SGDID:S000003930, Chr XII from 136298-134301, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_16.09149.09149.2 | 1.8024 | 0.0712 | 95.2% | 833.5122 | 833.02136 | 96 | 3.695 | 75.0% | 2 | K.LAVNFIR.I | 2 |
| U | Reverse_YML059C | 1 | 1 | 1.0% | 1679 | 187132 | 8.1 | NTE1 SGDID:S000004524, Chr XIII from 158258-153219, reverse complement, Verified ORF, "Serine esterase that deacylates exogenous lysophospholipids, homolog of human neuropathy target esterase (NTE); mammalian NTE1 deacylates phosphatidylcholine to glycerophosphocholine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_53.31440.31440.2 | 1.207 | 0.173 | 90.5% | 1944.8722 | 1946.0813 | 1 | 3.713 | 34.4% | 1 | K.PELDASGSSKDVT*KFKR.I | 2 |
| U | Reverse_YDR127W | 1 | 1 | 1.0% | 1588 | 174754 | 6.3 | ARO1 SGDID:S000002534, Chr IV from 704479-709245, Verified ORF, "Pentafunctional arom protein, catalyzes steps 2 through 6 in the biosynthesis of chorismate, which is a precursor to aromatic amino acids" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_18.10268.10268.2 | 2.9136 | 0.0142 | 96.9% | 1784.7322 | 1784.9236 | 98 | 3.446 | 46.7% | 1 | K.AGNVVNLFLSANS*ELR.T | 2 |
| U | YGL094C | 1 | 1 | 1.0% | 1115 | 127039 | 6.7 | PAN2 SGDID:S000003062, Chr VII from 334468-331121, reverse complement, Verified ORF, "Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, which acts to control poly(A) tail length and regulate the stoichiometry and activity of postreplication repair complexes" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_11.06253.06253.2 | 1.7275 | 0.0969 | 93.8% | 1347.7322 | 1348.3317 | 1 | 3.486 | 65.0% | 1 | R.Y*RGHIGGNS*VK.D | 2 |
| U | Reverse_YGR204W | 1 | 1 | 1.0% | 946 | 102205 | 6.8 | ADE3 SGDID:S000003436, Chr VII from 905939-908779, Verified ORF, "Cytoplasmic trifunctional enzyme C1-tetrahydrofolate synthase, involved in single carbon metabolism and required for biosynthesis of purines, thymidylate, methionine, and histidine" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.06961.06961.2 | 2.0104 | 0.027 | 92.6% | 1045.3121 | 1045.2272 | 64 | 3.001 | 75.0% | 1 | K.EALVRSTIR.D | 2 |
| U | YOR328W | 1 | 1 | 0.8% | 1564 | 176460 | 7.9 | PDR10 SGDID:S000005855, Chr XV from 931798-936492, Verified ORF, "ABC (ATP-binding cassette) membrane pump involved in the pleiotropic drug resistance network, regulated by Pdr1p and Pdr3p, similar to Pdr5p" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_15.08949.08949.2 | 1.9755 | 0.086 | 95.6% | 1501.3922 | 1502.5754 | 281 | 3.314 | 50.0% | 1 | R.TLT*SQSSLLSQEK.R | 2 |
| U | Reverse_YGL140C | 1 | 1 | 0.7% | 1219 | 137476 | 8.1 | YGL140C SGDID:S000003108, Chr VII from 245017-241358, reverse complement, Uncharacterized ORF, "Hypothetical protein" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_10.05469.05469.2 | 1.6349 | 0.1142 | 94.3% | 978.77216 | 981.13983 | 450 | 3.698 | 62.5% | 1 | R.TLGKYATAR.A | 2 |
| U | YHR119W | 1 | 1 | 0.7% | 1080 | 123912 | 9.0 | SET1 SGDID:S000001161, Chr VIII from 346046-349288, Verified ORF, "Histone methyltransferase, subunit of the COMPASS (Set1C) complex which methylates Rad6p ubiquitinated histone H3 on lysine 4; required in transcriptional silencing near telomeres and at the silent mating type loci; contains a SET domain" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_7.04043.04043.2 | 1.229 | 0.166 | 92.4% | 1058.6122 | 1056.9811 | 108 | 3.592 | 50.0% | 1 | R.Y*NHNDGTR.R | 2 |
| U | Reverse_YDR150W | 1 | 1 | 0.6% | 2748 | 313032 | 5.4 | NUM1 SGDID:S000002557, Chr IV from 755623-763869, Verified ORF, "Protein required for nuclear migration, localizes to the mother cell cortex and the bud tip; may mediate interactions of dynein and cytoplasmic microtubules with the cell cortex" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_23.13321.13321.2 | 1.7803 | 0.084 | 92.4% | 2010.0721 | 2009.3281 | 298 | 3.058 | 31.2% | 1 | K.QLLNKYSDNSLLIMNNK.E | 2 |
| U | Reverse_YKL129C | 1 | 1 | 0.6% | 1271 | 142507 | 9.4 | MYO3 SGDID:S000001612, Chr XI from 200163-196348, reverse complement, Verified ORF, "One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization" |
| Filename | XCorr | DeltCN | Conf% | ObsM+H+ | CalcM+H+ | SpR | ZScore | Ion% | # | Sequence | ||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| * | Jamie_FT_01_itms_12.07160.07160.2 | 2.008 | 0.0557 | 95.9% | 893.33215 | 894.06165 | 138 | 3.614 | 78.6% | 1 | K.VYKNGGKK.E | 2 |
| Proteins | Peptide IDs | Spectra | |
| Unfiltered | 11789 | 233739 | 289814 |
| Filtered | 400 | 688 | 1386 |
| Forward matches | 277 | 562 | 1259 |
| Decoy matches | 123 | 126 | 127 |
| Forward FP rate | 44.4% | 22.42% | 10.09% |