D parc

DTASelect v2.0.16
/data/6/jamest/xu/aug07/hx1/parc
/scratch/yates/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
--trypstat
Jump to the summary table.

sequest.params modifications:

*	X	0.0
#	X	0.0
@	X	0.0
Static	C	57.0

true	Use criteria
0.0	Minimum peptide confidence
0.05	Peptide false positive rate
0.0	Minimum protein confidence
1.0	Protein false positive rate
1	Minimum charge state
16	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
false	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
1000	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

YBL050W

44.5%

292

32803

5.1

SEC17 SGDID:S000000146, Chr II from 125128-125157,125274-126122, Verified ORF, "Peripheral membrane protein required for vesicular transport between ER and Golgi and for the 'priming' step in homotypic vacuole fusion, part of the cis-SNARE complex; has similarity to alpha-SNAP"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.09235.09235.2	2.4895	0.1033	98.9%	1038.0922	1038.25	31	4.207	61.1%	1	K.KGVPSSGFMK.L	2
*	PARC_hx1_02_itms.11141.11141.1	2.2805	0.2075	100.0%	1205.99	1207.369	3	4.703	65.0%	3	K.ELNLAGDSFLK.A	1
*	PARC_hx1_02_itms.11183.11183.2	2.7236	0.1558	100.0%	1208.9722	1207.369	1	3.976	80.0%	2	K.ELNLAGDSFLK.A	2
*	PARC_hx1_03_itms.07652.07652.2	4.2751	0.4468	100.0%	1859.7122	1859.9438	1	7.424	68.8%	2	K.KAGNEDEAGNTYVEAYK.C	2
*	PARC_hx1_02_itms.07696.07696.2	5.4894	0.4558	100.0%	1734.2922	1731.7698	1	8.441	73.3%	2	K.AGNEDEAGNTYVEAYK.C	2
*	PARC_hx1_04_itms.15634.15634.2	2.5964	0.0786	98.3%	1907.0721	1907.0869	1	3.893	50.0%	1	K.FELGEILENDLHDYAK.A	2
*	PARC_hx1_04_itms.14760.14760.2	4.3349	0.4004	100.0%	2634.5322	2632.809	1	8.07	47.7%	1	K.AIDCYELAGEWYAQDQSVALSNK.C	2
*	PARC_hx1_02_itms.09777.09777.2	5.5015	0.4398	100.0%	1672.9722	1673.8169	1	7.831	78.6%	3	K.ALDGQYIEASDIYSK.L	2
*	PARC_hx1_02_itms.09750.09750.1	3.6726	0.2794	100.0%	1674.63	1673.8169	1	7.214	57.1%	1	K.ALDGQYIEASDIYSK.L	1
*	PARC_hx1_02_itms.09560.09560.2	4.8185	0.3628	100.0%	1488.1322	1488.65	1	8.394	78.6%	4	K.GLCQLAATDAVAAAR.T	2
*	PARC_hx1_02_itms.06689.06689.3	3.0247	0.3066	100.0%	2691.0244	2692.8154	3	5.193	21.0%	1	L.AATDAVAAARTLQEGQSEDPNFADSR.E	3
*	PARC_hx1_02_itms.06020.06020.2	5.8443	0.499	100.0%	1793.9922	1794.829	1	9.426	80.0%	15	R.TLQEGQSEDPNFADSR.E	2
*	PARC_hx1_02_itms.09302.09302.1	1.6219	0.0897	97.4%	958.43	959.0643	2	3.412	75.0%	1	K.EFDNFMR.L	1

contaminant_KERATIN03

39.0%

593

59519

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.10653.10653.2	2.8837	0.3136	97.3%	1450.8522	1451.4949	2	6.211	53.3%	1	L.GGGFSSGGFSGGSFSR.G	2
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx1_02_itms.07760.07760.2	4.4567	0.4099	100.0%	1382.1522	1382.4668	1	7.555	81.8%	2	R.ALEESNYELEGK.I	2
*	PARC_hx1_02_itms.07782.07782.1	3.2213	0.2684	100.0%	1383.57	1382.4668	2	5.447	59.1%	2	R.ALEESNYELEGK.I	1
*	PARC_hx1_04_itms.06120.06120.2	3.3368	0.4796	100.0%	1119.1122	1119.1416	1	7.793	94.4%	16	K.HGNSHQGEPR.D	2
*	PARC_hx1_04_itms.16859.16859.3	5.5204	0.3353	100.0%	2367.8342	2368.6523	2	6.326	41.2%	4	K.NQILNLTTDNANILLQIDNAR.L	3
*	PARC_hx1_04_itms.16811.16811.2	5.9053	0.3179	100.0%	2370.8523	2368.6523	1	7.04	52.5%	7	K.NQILNLTTDNANILLQIDNAR.L	2
	PARC_hx1_02_itms.08522.08522.2	3.486	0.1704	100.0%	1202.0922	1202.3097	1	5.643	90.0%	2	R.QSVEADINGLR.R	2 2
*	PARC_hx1_02_itms.09380.09380.1	2.1444	0.091	98.3%	1031.55	1032.2224	69	3.788	68.8%	2	R.VLDELTLTK.A	1
*	PARC_hx1_02_itms.09382.09382.2	3.4526	0.2716	100.0%	1031.6522	1032.2224	2	5.255	93.8%	2	R.VLDELTLTK.A	2
*	PARC_hx1_04_itms.20727.20727.2	5.9878	0.5454	100.0%	2096.2922	2097.3853	1	10.06	76.5%	1	K.ADLEMQIESLTEELAYLK.K	2
*	PARC_hx1_04_itms.18077.18077.3	5.4443	0.3974	100.0%	2874.2344	2874.2134	1	7.796	34.6%	3	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S	3
*	PARC_hx1_04_itms.18038.18038.2	5.2985	0.408	100.0%	2875.632	2874.2134	1	8.316	48.1%	6	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S	2
*	PARC_hx1_03_itms.07565.07565.2	3.5976	0.3289	100.0%	1493.7922	1494.6041	4	5.983	63.6%	4	R.SQYEQLAEQNRK.D	2
*	PARC_hx1_02_itms.09345.09345.2	3.0846	0.2584	100.0%	1109.6322	1110.1681	1	5.598	81.2%	2	K.DAEAWFNEK.S	2
*	PARC_hx1_02_itms.09388.09388.1	2.3665	0.0475	98.3%	1111.5	1110.1681	1	4.171	75.0%	3	K.DAEAWFNEK.S	1
*	PARC_hx1_04_itms.14219.14219.2	5.7514	0.3818	100.0%	1997.5521	1998.151	1	8.626	71.9%	4	K.ELTTEIDNNIEQISSYK.S	2
*	PARC_hx1_02_itms.08744.08744.2	4.1317	0.4001	100.0%	1390.9722	1391.4778	1	7.173	83.3%	5	K.QSLEASLAETEGR.Y	2
*	PARC_hx1_05_itms.24940.24940.2	4.4768	0.4125	100.0%	2748.5723	2748.0747	1	8.596	47.7%	1	R.YCVQLSQIQAQISALEEQLQQIR.A	2
*	PARC_hx1_03_itms.11135.11135.2	3.3786	0.1309	95.5%	1428.1921	1428.6285	14	4.342	68.2%	1	Q.ISALEEQLQQIR.A	2
*	PARC_hx1_02_itms.10971.10971.2	5.7805	0.3421	100.0%	2085.2322	2084.2104	1	7.169	68.8%	5	R.AETECQNTEYQQLLDIK.I	2
*	PARC_hx1_02_itms.07503.07503.1	2.629	0.1575	100.0%	1165.61	1166.2761	20	4.294	75.0%	1	R.LENEIQTYR.S	1
*	PARC_hx1_02_itms.07518.07518.2	3.6501	0.1545	100.0%	1169.2722	1166.2761	1	3.988	93.8%	2	R.LENEIQTYR.S	2

Similarities: contaminant_KERATIN05(1:22)
contaminant_KERATIN02(1:22)
contaminant_KERATIN08(1:22)
contaminant_KERATIN12(1:22)
contaminant_KERATIN07(1:22)
contaminant_KERATIN10(1:22)
contaminant_KERATIN04(1:22)

contaminant_KERATIN13

35.9%

643

65494

6.6

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.15184.15184.2	3.2497	0.2	97.7%	1964.4321	1965.2542	1	5.339	53.1%	1	N.QSLLQPLNVEIDPEIQK.V	2
*	PARC_hx1_04_itms.15183.15183.2	5.1395	0.3317	100.0%	1835.8922	1837.1234	1	7.407	73.3%	2	Q.SLLQPLNVEIDPEIQK.V	2
*	PARC_hx1_02_itms.08012.08012.2	3.1779	0.2029	97.4%	1185.1522	1185.3196	20	4.029	72.2%	1	L.NVEIDPEIQK.V	2
*	PARC_hx1_02_itms.08046.08046.1	3.1092	0.1211	100.0%	1186.53	1185.3196	2	4.092	72.2%	1	L.NVEIDPEIQK.V	1
*	PARC_hx1_04_itms.13473.13473.1	3.47	0.2164	100.0%	1385.57	1384.5315	1	4.819	68.2%	5	K.SLNNQFASFIDK.V	1
*	PARC_hx1_04_itms.13471.13471.2	4.3046	0.2605	100.0%	1386.4321	1384.5315	1	6.113	81.8%	14	K.SLNNQFASFIDK.V	2
	PARC_hx1_02_itms.08331.08331.1	2.7442	0.1253	100.0%	1475.61	1476.6726	4	3.893	59.1%	2	R.FLEQQNQVLQTK.W	1 1
	PARC_hx1_02_itms.08342.08342.2	4.834	0.0036	100.0%	1476.4122	1476.6726	1	6.23	90.9%	2	R.FLEQQNQVLQTK.W	2 2
*	PARC_hx1_02_itms.11065.11065.1	1.6514	0.1313	97.3%	1475.62	1476.6293	1	3.987	54.5%	1	K.WELLQQVDTSTR.T	1
*	PARC_hx1_02_itms.11097.11097.2	4.7751	0.4469	100.0%	1476.2722	1476.6293	1	6.916	90.9%	6	K.WELLQQVDTSTR.T	2
*	PARC_hx1_02_itms.08061.08061.2	3.8025	0.2951	100.0%	1290.1322	1290.416	1	5.504	85.0%	1	W.ELLQQVDTSTR.T	2
*	PARC_hx1_04_itms.14074.14074.2	3.2507	0.257	97.0%	1383.6522	1384.4875	1	5.504	75.0%	1	R.THNLEPYFESF.I	2
*	PARC_hx1_02_itms.08984.08984.2	3.6806	0.3312	100.0%	1300.6921	1301.4316	1	6.53	83.3%	3	K.NMQDMVEDYR.N	2
*	PARC_hx1_02_itms.08986.08986.1	2.5393	0.1865	100.0%	1302.51	1301.4316	5	3.874	72.2%	2	K.NMQDMVEDYR.N	1
*	PARC_hx1_02_itms.08674.08674.1	2.2258	0.0341	98.6%	1265.52	1266.3934	57	3.582	55.0%	1	R.TNAENEFVTIK.K	1
*	PARC_hx1_02_itms.08678.08678.2	3.9282	0.3133	100.0%	1266.1522	1266.3934	1	6.292	85.0%	4	R.TNAENEFVTIK.K	2
*	PARC_hx1_01_itms.12185.12185.2	3.2018	0.3512	100.0%	1796.1122	1797.0148	1	6.366	57.1%	1	K.LDNLQQEIDFLTALY.Q	2
*	PARC_hx1_03_itms.23087.23087.3	6.5486	0.4573	100.0%	4532.2744	4530.035	1	8.416	23.7%	2	K.LDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNR.Q	3
*	PARC_hx1_03_itms.10494.10494.2	3.5486	0.2745	96.7%	1606.2122	1606.7913	1	6.417	65.4%	1	Q.ISETNVILSMDNNR.Q	2
*	PARC_hx1_02_itms.07011.07011.2	4.4741	0.3806	100.0%	1341.1921	1341.4607	1	6.841	81.8%	9	K.SKAEAESLYQSK.Y	2
*	PARC_hx1_02_itms.06293.06293.2	3.9966	0.306	100.0%	1125.8722	1126.2084	1	6.417	83.3%	2	K.AEAESLYQSK.Y	2
*	PARC_hx1_02_itms.08367.08367.1	3.0129	0.2089	100.0%	1179.58	1180.303	10	4.827	66.7%	2	K.YEELQITAGR.H	1
*	PARC_hx1_02_itms.08426.08426.2	3.8483	0.2406	100.0%	1180.3522	1180.303	1	6.778	94.4%	3	K.YEELQITAGR.H	2
	PARC_hx1_02_itms.08312.08312.2	3.1798	0.1527	100.0%	973.7922	974.102	6	4.302	92.9%	2	K.IEISELNR.V	2 2
	PARC_hx1_02_itms.08252.08252.1	2.2867	0.1457	100.0%	975.6	974.102	17	3.881	64.3%	2	K.IEISELNR.V	1 1
*	PARC_hx1_02_itms.07178.07178.2	2.7478	0.0541	98.8%	1073.8121	1074.2223	28	4.547	75.0%	3	R.LRSEIDNVK.K	2
*	PARC_hx1_03_itms.07475.07475.2	2.1899	0.0899	97.9%	1202.1921	1202.3964	21	3.09	66.7%	1	R.LRSEIDNVKK.Q	2
*	PARC_hx1_02_itms.08912.08912.2	4.3761	0.4369	100.0%	1717.5122	1717.8333	1	8.167	71.4%	3	K.QISNLQQSISDAEQR.G	2
*	PARC_hx1_02_itms.08931.08931.3	3.3617	0.3329	100.0%	1717.7644	1717.8333	1	5.844	46.4%	1	K.QISNLQQSISDAEQR.G	3
*	PARC_hx1_02_itms.09710.09710.2	5.3146	0.2871	100.0%	1358.2722	1358.4912	1	6.382	90.9%	4	K.LNDLEDALQQAK.E	2
*	PARC_hx1_02_itms.09742.09742.1	3.1079	0.2963	100.0%	1359.65	1358.4912	1	5.504	63.6%	3	K.LNDLEDALQQAK.E	1
*	PARC_hx1_02_itms.08201.08201.2	2.9821	0.2335	100.0%	1142.2722	1142.2689	2	5.077	81.2%	1	R.DYQELMNTK.L	2
*	PARC_hx1_02_itms.08222.08222.1	3.344	0.1635	100.0%	1143.51	1142.2689	1	4.709	75.0%	2	R.DYQELMNTK.L	1
*	PARC_hx1_03_itms.07347.07347.2	5.5809	0.3286	100.0%	2384.0723	2385.298	1	10.773	41.7%	4	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G	2

Similarities: contaminant_KERATIN22(4:30)

contaminant_KERATIN05

35.7%

471

51531

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_03_itms.07882.07882.2	2.9825	0.3009	100.0%	1108.9722	1107.2181	1	5.964	80.0%	1	R.ISSVLAGGSCR.A	2
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
	PARC_hx1_02_itms.08000.08000.1	3.0102	0.2872	100.0%	1301.65	1302.4241	1	6.355	63.6%	2	R.ALEEANADLEVK.I	1 1 1 1
	PARC_hx1_02_itms.08004.08004.2	4.5595	0.325	100.0%	1305.2122	1302.4241	1	6.344	81.8%	4	R.ALEEANADLEVK.I	2 2 2 2
	PARC_hx1_04_itms.09762.09762.2	2.0344	0.0974	98.3%	1036.5521	1037.1661	25	3.383	83.3%	1	K.IRDWYQR.Q	2 2 2
	PARC_hx1_02_itms.08505.08505.1	1.9086	0.0793	98.4%	919.51	920.0093	3	3.31	83.3%	1	K.DYSPYFK.T	1 1
*	PARC_hx1_04_itms.14896.14896.2	4.8538	0.3157	100.0%	2054.5322	2055.339	1	6.26	58.3%	4	K.ILTATVDNANVLLQIDNAR.L	2
*	PARC_hx1_02_itms.08250.08250.2	2.5064	0.1419	100.0%	1038.3522	1038.1454	7	4.797	85.7%	1	K.YETELNLR.M	2
	PARC_hx1_02_itms.09429.09429.2	2.6813	0.2812	100.0%	1205.0521	1205.3716	1	5.269	75.0%	1	R.MSVEADINGLR.R	2 2
	PARC_hx1_02_itms.09734.09734.2	3.731	0.1607	100.0%	1029.5721	1030.2096	1	5.48	93.8%	1	R.VLDELTLAR.A	2 2 2 2 2
	PARC_hx1_02_itms.09736.09736.1	2.0179	0.0782	98.6%	1029.75	1030.2096	6	4.111	68.8%	1	R.VLDELTLAR.A	1 1 1 1 1
*	PARC_hx1_03_itms.10426.10426.2	3.7692	0.1997	100.0%	2088.7922	2087.269	1	6.721	52.5%	1	R.GQVGGDVNVEMDAAPGVDLSR.I	2
*	PARC_hx1_02_itms.11912.11912.2	3.6259	0.3257	100.0%	1172.7722	1173.2671	2	6.548	81.2%	1	K.DAEEWFFTK.T	2
*	PARC_hx1_02_itms.11874.11874.1	2.7658	0.2091	100.0%	1174.37	1173.2671	1	6.129	68.8%	1	K.DAEEWFFTK.T	1
	PARC_hx1_02_itms.06658.06658.2	3.8523	0.4354	100.0%	1362.3722	1362.4796	1	7.47	75.0%	2	R.EVATNSELVQSGK.S	2 2
	PARC_hx1_02_itms.07731.07731.1	2.282	0.2071	100.0%	1220.53	1221.3068	8	4.415	55.0%	1	K.ASLENSLEETK.G	1 1 1
	PARC_hx1_02_itms.07755.07755.2	3.0742	0.2333	100.0%	1221.8922	1221.3068	1	5.351	75.0%	1	K.ASLENSLEETK.G	2 2 2
	PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.R	2 2 2 2 2 2
*	PARC_hx1_02_itms.09497.09497.2	2.994	0.2364	97.5%	1534.2922	1533.6348	1	5.264	57.7%	1	R.LLEGEDAHLSSSQF.S	2

Similarities: contaminant_KERATIN03(1:18)
contaminant_KERATIN02(1:18)
contaminant_KERATIN08(10:9)
contaminant_KERATIN12(6:13)
contaminant_KERATIN07(8:11)
contaminant_KERATIN10(5:14)
contaminant_KERATIN04(3:16)

contaminant_KERATIN18

33.3%

562

59822

8.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.11523.11523.2	1.9111	0.1538	97.1%	1398.7122	1398.6017	2	3.63	54.5%	1	K.TLNNKFASFIDK.V	2 2 2 2
	PARC_hx1_03_itms.10101.10101.2	3.5006	0.0935	100.0%	1203.6721	1204.3684	1	5.206	83.3%	3	K.WTLLQEQGTK.T	2 2
	PARC_hx1_04_itms.17747.17747.2	3.6776	0.3766	100.0%	1890.9521	1892.1216	1	6.986	67.9%	2	R.QNLEPLFEQYINNLR.R	2 2
	PARC_hx1_02_itms.07992.07992.1	1.7854	0.2974	100.0%	1016.52	1017.1271	1	4.878	75.0%	1	R.QLDSIVGER.G	1 1
	PARC_hx1_02_itms.07982.07982.2	1.697	0.1109	95.4%	1017.09216	1017.1271	9	4.456	75.0%	1	R.QLDSIVGER.G	2 2
*	PARC_hx1_02_itms.11187.11187.2	2.4621	0.0356	97.9%	1205.1322	1205.3685	54	3.097	66.7%	1	R.NMQDLVEDLK.N	2
	PARC_hx1_02_itms.08882.08882.2	3.3261	0.2767	100.0%	1223.2522	1223.3684	1	6.085	80.0%	1	R.TAAENEFVTLK.K	2
	PARC_hx1_02_itms.12552.12552.2	3.4934	0.2806	100.0%	1408.4122	1408.551	1	5.435	72.7%	3	K.ADTLTDEINFLR.A	2
	PARC_hx1_03_itms.14960.14960.3	3.6404	0.1737	100.0%	1959.2644	1961.1975	5	4.271	39.1%	1	S.MDNNRNLDLDSIIAEVK.A	3 3
	PARC_hx1_04_itms.16573.16573.1	3.0439	0.3354	100.0%	1329.53	1330.5211	6	6.025	59.1%	4	R.NLDLDSIIAEVK.A	1 1 1
	PARC_hx1_04_itms.16559.16559.2	4.5585	0.2401	100.0%	1330.4922	1330.5211	1	6.262	77.3%	4	R.NLDLDSIIAEVK.A	2 2 2
	PARC_hx1_02_itms.06951.06951.2	2.8576	0.2444	100.0%	1107.7322	1108.196	1	5.256	81.2%	3	K.AQYEEIAQR.S	2 2 2
	PARC_hx1_03_itms.08164.08164.2	2.7106	0.3097	100.0%	1455.5122	1456.5547	1	5.344	68.2%	1	R.SRAEAESWYQTK.Y	2
	PARC_hx1_02_itms.07844.07844.2	3.1227	0.3157	100.0%	1213.3522	1213.2891	1	6.452	83.3%	1	R.AEAESWYQTK.Y	2
	PARC_hx1_02_itms.07797.07797.1	2.3449	0.2938	100.0%	1165.47	1166.2761	1	4.499	72.2%	1	K.YEELQVTAGR.H	1
	PARC_hx1_02_itms.07790.07790.2	3.6991	0.3826	100.0%	1165.9321	1166.2761	1	7.154	94.4%	2	K.YEELQVTAGR.H	2
	PARC_hx1_02_itms.09203.09203.2	3.3208	0.3102	100.0%	1371.3322	1371.4929	1	6.047	62.5%	1	C.ANLQAAIADAEQR.G	2
	PARC_hx1_02_itms.09158.09158.1	2.49	0.2181	100.0%	1115.59	1116.2566	1	4.781	66.7%	1	K.LEGLEDALQK.A	1
	PARC_hx1_02_itms.09184.09184.2	3.76	0.3389	100.0%	1118.9922	1116.2566	1	5.246	88.9%	3	K.LEGLEDALQK.A	2
	PARC_hx1_02_itms.08477.08477.1	2.63	0.2356	100.0%	1153.41	1154.3234	2	4.903	68.8%	1	K.EYQELMNVK.L	1
	PARC_hx1_02_itms.08469.08469.2	2.831	0.2535	100.0%	1153.8722	1154.3234	6	4.816	81.2%	1	K.EYQELMNVK.L	2
	PARC_hx1_04_itms.14429.14429.2	4.0094	0.3816	100.0%	1264.0922	1264.4644	1	6.704	90.0%	13	K.LALDVEIATYR.K	2 2 2 2
*	PARC_hx1_03_itms.07839.07839.2	3.9739	0.3879	100.0%	1437.4521	1436.562	1	7.933	68.8%	2	R.ATGGGLSSVGGGSSTIK.Y	2

Similarities: contaminant_KERATIN22(5:18)
contaminant_KERATIN17(9:14)
contaminant_KERATIN15(2:21)
contaminant_KERATIN16(1:22)

contaminant_KERATIN02

32.5%

622

61987

5.2

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.07048.07048.2	3.9184	0.4374	100.0%	1233.1721	1233.2833	1	8.448	73.3%	7	T.SGGGGGGGLGSGGSIR.S	2
*	PARC_hx1_02_itms.08693.08693.2	4.3936	0.4073	100.0%	1691.6721	1692.7826	1	7.148	60.5%	1	L.GGFGGGAGGGDGGILTANEK.S	2
*	PARC_hx1_02_itms.06806.06806.2	2.8427	0.2237	100.0%	1066.1322	1066.1742	2	5.382	87.5%	2	K.STMQELNSR.L	2
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx1_02_itms.07899.07899.1	3.2525	0.2999	100.0%	1586.63	1587.6836	1	5.673	61.5%	2	K.VQALEEANNDLENK.I	1
*	PARC_hx1_02_itms.07910.07910.2	5.8291	0.4549	100.0%	1587.2322	1587.6836	1	8.444	88.5%	9	K.VQALEEANNDLENK.I	2
*	PARC_hx1_04_itms.07305.07305.2	2.4737	0.0312	98.2%	812.7322	812.98773	7	4.346	85.7%	1	K.KGPAAIQK.N	2
*	PARC_hx1_02_itms.10112.10112.2	4.407	0.3787	100.0%	1606.1721	1606.7289	1	6.885	87.5%	1	K.NYSPYYNTIDDLK.D	2
*	PARC_hx1_02_itms.10098.10098.1	3.1048	0.1472	100.0%	1607.64	1606.7289	1	4.463	54.2%	2	K.NYSPYYNTIDDLK.D	1
*	PARC_hx1_02_itms.08925.08925.2	5.0347	0.3662	100.0%	1315.7122	1316.4539	1	6.745	86.4%	2	K.DQIVDLTVGNNK.T	2
*	PARC_hx1_02_itms.08892.08892.1	3.4829	0.3637	100.0%	1317.62	1316.4539	1	6.996	72.7%	2	K.DQIVDLTVGNNK.T	1
*	PARC_hx1_02_itms.09093.09093.1	2.0765	0.0242	97.5%	1060.6	1061.1802	2	4.047	62.5%	1	K.TLLDIDNTR.M	1
*	PARC_hx1_02_itms.09088.09088.2	3.01	0.1907	100.0%	1064.1721	1061.1802	1	4.059	93.8%	3	K.TLLDIDNTR.M	2
*	PARC_hx1_02_itms.09448.09448.2	2.461	0.147	100.0%	897.89215	898.02155	20	4.191	75.0%	3	R.MTLDDFR.I	2
*	PARC_hx1_02_itms.09393.09393.1	2.199	0.1115	100.0%	899.46	898.02155	35	3.72	66.7%	2	R.MTLDDFR.I	1
*	PARC_hx1_02_itms.08132.08132.1	1.67	0.1474	98.4%	1066.48	1067.2048	6	3.815	57.1%	1	K.FEMEQNLR.Q	1
*	PARC_hx1_02_itms.08128.08128.2	2.4715	0.1378	100.0%	1066.8121	1067.2048	84	5.182	71.4%	3	K.FEMEQNLR.Q	2
*	PARC_hx1_02_itms.08194.08194.2	3.0012	0.3861	100.0%	1158.1322	1158.2566	1	6.112	85.0%	3	R.QGVDADINGLR.Q	2
*	PARC_hx1_02_itms.08910.08910.1	2.0401	0.2206	100.0%	1190.55	1191.385	103	4.173	61.1%	1	R.QVLDNLTMEK.S	1
*	PARC_hx1_02_itms.08972.08972.2	2.5916	0.0444	98.2%	1192.2722	1191.385	1	3.385	83.3%	2	R.QVLDNLTMEK.S	2
*	PARC_hx1_04_itms.18203.18203.2	5.9948	0.3792	100.0%	2171.372	2172.4702	1	8.096	73.5%	3	K.SDLEMQYETLQEELMALK.K	2
*	PARC_hx1_04_itms.20559.20559.3	4.2678	0.4174	100.0%	2737.4043	2739.0388	1	7.081	34.1%	1	R.YCGQLQMIQEQISNLEAQITDVR.Q	3
*	PARC_hx1_05_itms.24955.24955.2	4.212	0.3858	100.0%	2738.2322	2739.0388	1	6.676	47.7%	1	R.YCGQLQMIQEQISNLEAQITDVR.Q	2
*	PARC_hx1_04_itms.13845.13845.2	3.5417	0.3676	100.0%	1859.3522	1858.0587	1	6.933	60.0%	1	M.IQEQISNLEAQITDVR.Q	2
*	PARC_hx1_02_itms.09434.09434.2	3.3706	0.3134	100.0%	1359.0521	1359.5223	1	6.442	72.7%	1	Q.ISNLEAQITDVR.Q	2
*	PARC_hx1_04_itms.14871.14871.2	5.7143	0.4186	100.0%	2096.4521	2096.308	1	8.296	71.9%	11	R.QEIECQNQEYSLLLSIK.M	2

Similarities: contaminant_KERATIN03(1:25)
contaminant_KERATIN05(1:25)
contaminant_KERATIN08(1:25)
contaminant_KERATIN12(1:25)
contaminant_KERATIN07(1:25)
contaminant_KERATIN10(1:25)

contaminant_KERATIN08

32.4%

469

50499

5.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
	PARC_hx1_02_itms.08000.08000.1	3.0102	0.2872	100.0%	1301.65	1302.4241	1	6.355	63.6%	2	R.ALEEANADLEVK.I	1 1 1 1
	PARC_hx1_02_itms.08004.08004.2	4.5595	0.325	100.0%	1305.2122	1302.4241	1	6.344	81.8%	4	R.ALEEANADLEVK.I	2 2 2 2
	PARC_hx1_04_itms.09762.09762.2	2.0344	0.0974	98.3%	1036.5521	1037.1661	25	3.383	83.3%	1	K.IRDWYQR.Q	2 2 2
	PARC_hx1_02_itms.08505.08505.1	1.9086	0.0793	98.4%	919.51	920.0093	3	3.31	83.3%	1	K.DYSPYFK.T	1 1
*	PARC_hx1_02_itms.07799.07799.2	2.1257	0.1974	98.8%	1203.5721	1202.3097	15	3.918	65.0%	1	R.QTVEADVNGLR.R	2
	PARC_hx1_02_itms.09734.09734.2	3.731	0.1607	100.0%	1029.5721	1030.2096	1	5.48	93.8%	1	R.VLDELTLAR.T	2 2 2 2 2
	PARC_hx1_02_itms.09736.09736.1	2.0179	0.0782	98.6%	1029.75	1030.2096	6	4.111	68.8%	1	R.VLDELTLAR.T	1 1 1 1 1
	PARC_hx1_02_itms.10613.10613.1	1.6422	0.178	98.4%	1276.49	1277.4755	59	4.253	45.0%	1	R.TDLEMQIEGLK.E	1 1
	PARC_hx1_02_itms.10627.10627.2	3.667	0.1639	100.0%	1280.0521	1277.4755	1	4.426	85.0%	2	R.TDLEMQIEGLK.E	2 2
*	PARC_hx1_02_itms.09519.09519.2	4.4868	0.4349	100.0%	2089.4521	2089.2415	1	8.022	62.5%	1	R.GQTGGDVNVEMDAAPGVDLSR.I	2
*	PARC_hx1_02_itms.11176.11176.1	2.5644	0.2637	100.0%	1096.37	1097.2126	2	5.264	62.5%	1	R.DAETWFLSK.T	1
*	PARC_hx1_02_itms.06310.06310.2	3.4095	0.3472	100.0%	1406.3121	1406.4924	2	6.61	70.8%	1	K.EVASNSELVQSSR.S	2
*	PARC_hx1_02_itms.06826.06826.2	2.0411	0.1246	98.3%	990.15216	990.10443	6	3.774	85.7%	1	R.SEVTELRR.V	2
	PARC_hx1_02_itms.07731.07731.1	2.282	0.2071	100.0%	1220.53	1221.3068	8	4.415	55.0%	1	K.ASLENSLEETK.G	1 1 1
	PARC_hx1_02_itms.07755.07755.2	3.0742	0.2333	100.0%	1221.8922	1221.3068	1	5.351	75.0%	1	K.ASLENSLEETK.G	2 2 2
*	PARC_hx1_04_itms.14086.14086.2	4.9439	0.3914	100.0%	2141.652	2142.3516	1	8.201	75.0%	1	R.CEMEQQSQEYQILLDVK.T	2
	PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.R	2 2 2 2 2 2

Similarities: contaminant_KERATIN03(1:17)
contaminant_KERATIN05(10:8)
contaminant_KERATIN02(1:17)
contaminant_KERATIN12(5:13)
contaminant_KERATIN07(8:10)
contaminant_KERATIN10(6:12)
contaminant_KERATIN04(3:15)

YLR093C

30.0%

253

28964

5.7

NYV1 SGDID:S000004083, Chr XII from 327416-327401,327259-326514, reverse complement, Verified ORF, "v-SNARE component of the vacuolar SNARE complex involved in vesicle fusion; inhibits ATP-dependent Ca(2+) transport activity of Pmc1p in the vacuolar membrane"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.12983.12983.2	3.5432	0.1992	100.0%	1200.3922	1198.4044	1	4.815	83.3%	2	R.FNVSYVEVIK.N	2
*	PARC_hx1_02_itms.10400.10400.2	3.0194	0.0952	99.1%	1644.2722	1643.7595	1	4.152	61.5%	1	K.NGETISSCFQPFQK.N	2
*	PARC_hx1_02_itms.09508.09508.3	3.6834	0.2299	100.0%	3368.3342	3366.407	1	5.482	25.0%	1	R.NQTLNSSGNGQSSNGNGQNTISDIGDATEDQIK.D	3
*	PARC_hx1_02_itms.10698.10698.2	3.7903	0.2587	100.0%	1419.2122	1418.605	1	5.935	81.8%	1	K.DVIQIMNDNIDK.F	2
*	PARC_hx1_02_itms.08292.08292.1	2.2347	0.0825	98.1%	773.6	773.9481	2	3.771	75.0%	1	R.VSLLVDK.T	1

contaminant_KERATIN22

29.3%

645

65865

8.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_03_itms.07676.07676.2	4.2319	0.4664	100.0%	1255.2922	1255.3298	1	8.399	80.8%	2	R.GFSSGSAVVSGGSR.R	2
*	PARC_hx1_02_itms.08066.08066.1	2.051	0.2784	100.0%	831.57	831.9878	1	6.144	68.8%	1	R.SLVGLGGTK.S	1
	PARC_hx1_02_itms.11523.11523.2	1.9111	0.1538	97.1%	1398.7122	1398.6017	2	3.63	54.5%	1	K.TLNNKFASFIDK.V	2 2 2 2
	PARC_hx1_02_itms.08331.08331.1	2.7442	0.1253	100.0%	1475.61	1476.6726	4	3.893	59.1%	2	R.FLEQQNQVLQTK.W	1 1
	PARC_hx1_02_itms.08342.08342.2	4.834	0.0036	100.0%	1476.4122	1476.6726	1	6.23	90.9%	2	R.FLEQQNQVLQTK.W	2 2
*	PARC_hx1_02_itms.08414.08414.2	3.4399	0.2747	100.0%	1037.4722	1038.1454	1	6.095	100.0%	1	R.YLDGLTAER.T	2
*	PARC_hx1_04_itms.13778.13778.2	5.4717	0.3987	100.0%	2128.392	2129.2598	1	9.078	67.6%	3	R.TSQNSELNNMQDLVEDYK.K	2
*	PARC_hx1_02_itms.08768.08768.2	2.9725	0.3671	100.0%	1209.2322	1209.3416	1	6.057	75.0%	2	R.TAAENDFVTLK.K	2
*	PARC_hx1_04_itms.16205.16205.2	4.4085	0.0538	100.0%	1461.2922	1461.6982	1	5.377	86.4%	2	K.VDLLNQEIEFLK.V	2
	PARC_hx1_04_itms.16573.16573.1	3.0439	0.3354	100.0%	1329.53	1330.5211	6	6.025	59.1%	4	R.NLDLDSIIAEVK.A	1 1 1
	PARC_hx1_04_itms.16559.16559.2	4.5585	0.2401	100.0%	1330.4922	1330.5211	1	6.262	77.3%	4	R.NLDLDSIIAEVK.A	2 2 2
	PARC_hx1_02_itms.06951.06951.2	2.8576	0.2444	100.0%	1107.7322	1108.196	1	5.256	81.2%	3	K.AQYEEIAQR.S	2 2 2
*	PARC_hx1_02_itms.08504.08504.2	3.7023	0.3083	100.0%	1194.3121	1194.33	1	6.118	88.9%	2	K.YEELQVTVGR.H	2
	PARC_hx1_02_itms.08312.08312.2	3.1798	0.1527	100.0%	973.7922	974.102	6	4.302	92.9%	2	K.IEISELNR.V	2 2
	PARC_hx1_02_itms.08252.08252.1	2.2867	0.1457	100.0%	975.6	974.102	17	3.881	64.3%	2	K.IEISELNR.V	1 1
*	PARC_hx1_03_itms.07357.07357.2	2.4721	0.2477	100.0%	995.0722	995.16675	1	4.573	87.5%	2	R.LQGEIAHVK.K	2
*	PARC_hx1_02_itms.08318.08318.2	4.678	0.2499	100.0%	1333.1721	1330.3971	1	6.502	86.4%	2	K.NVQDAIADAEQR.G	2
*	PARC_hx1_02_itms.10238.10238.1	3.3917	0.3566	100.0%	1371.68	1372.5181	1	6.642	68.2%	1	K.LNDLEEALQQAK.E	1
*	PARC_hx1_02_itms.10250.10250.2	5.3137	0.2581	100.0%	1373.3121	1372.5181	1	6.505	86.4%	1	K.LNDLEEALQQAK.E	2
	PARC_hx1_02_itms.09074.09074.2	3.1631	0.2567	100.0%	1140.1721	1140.2965	2	5.732	81.2%	1	R.DYQELMNVK.L	2 2
	PARC_hx1_02_itms.09062.09062.1	3.0213	0.1963	100.0%	1140.47	1140.2965	3	4.994	75.0%	1	R.DYQELMNVK.L	1 1
	PARC_hx1_04_itms.14429.14429.2	4.0094	0.3816	100.0%	1264.0922	1264.4644	1	6.704	90.0%	13	K.LALDVEIATYR.K	2 2 2 2

Similarities: contaminant_KERATIN13(4:18)
contaminant_KERATIN18(5:17)
contaminant_KERATIN17(4:18)
contaminant_KERATIN15(4:18)
contaminant_KERATIN16(1:21)

YGL212W

27.5%

316

36711

8.4

VAM7 SGDID:S000003180, Chr VII from 91436-92386, Verified ORF, "Component of the vacuole SNARE complex involved in vacuolar morphogenesis; SNAP-25 homolog; functions with a syntaxin homolog Vam3p in vacuolar protein trafficking"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.07764.07764.2	2.5965	0.2541	100.0%	1438.9321	1439.5396	1	4.556	75.0%	3	R.RYDDPEMIDER.R	2
*	PARC_hx1_02_itms.09518.09518.1	1.9648	0.0854	98.6%	1183.54	1184.2938	16	3.47	62.5%	1	R.FLNELYNDR.F	1
*	PARC_hx1_02_itms.09566.09566.2	3.4182	0.2362	100.0%	1184.1522	1184.2938	1	4.816	93.8%	2	R.FLNELYNDR.F	2
*	PARC_hx1_03_itms.10782.10782.2	3.6441	0.2381	100.0%	1162.7322	1163.3593	1	4.954	83.3%	2	K.IAQDFLQLSK.P	2
*	PARC_hx1_02_itms.07342.07342.2	3.253	0.254	100.0%	1577.9122	1578.5989	2	6.654	65.4%	1	K.ECDDIGTANIAQDR.G	2
*	PARC_hx1_02_itms.08156.08156.2	5.3249	0.4691	100.0%	1836.0922	1835.9658	1	11.469	70.6%	3	R.LLGVATSDNSSTTEVQGR.T	2
*	PARC_hx1_02_itms.07949.07949.2	4.7494	0.4743	100.0%	1666.0721	1663.864	1	7.123	73.1%	3	R.TNNDLQQGQMQMVR.D	2
*	PARC_hx1_04_itms.09774.09774.2	4.2463	0.3371	100.0%	1338.2722	1338.463	1	7.476	85.0%	3	R.DQEQELVALHR.I	2

YMR197C

26.7%

217

24668

6.6

VTI1 SGDID:S000004810, Chr XIII from 659197-658544, reverse complement, Verified ORF, "Protein involved in cis-Golgi membrane traffic; v-SNARE that interacts with two t-SNARES, Sed5p and Pep12p; required for multiple vacuolar sorting pathways"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_05_itms.13149.13149.2	2.9546	0.2811	100.0%	1455.1122	1455.6108	11	5.276	50.0%	1	K.ASLAEAPSQPLSQR.N	2
*	PARC_hx1_02_itms.09920.09920.2	5.1082	0.4623	100.0%	1693.2722	1693.7673	1	8.528	82.1%	6	R.LFGDLNASNIDDDQR.Q	2
*	PARC_hx1_04_itms.15291.15291.2	5.571	0.4611	100.0%	1879.2722	1879.1536	1	8.163	75.0%	2	R.IANETEGIGSQIMMDLR.S	2
*	PARC_hx1_02_itms.09503.09503.1	2.1403	0.2527	100.0%	1414.55	1415.5425	1	4.929	59.1%	1	R.QTLFQADSYVDK.S	1
*	PARC_hx1_02_itms.09524.09524.2	3.4633	0.231	100.0%	1415.2122	1415.5425	1	5.394	77.3%	3	R.QTLFQADSYVDK.S	2

YOL039W

24.5%

106

10746

4.0

RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.08415.08415.2	3.7476	0.3533	100.0%	1399.1522	1399.587	1	6.357	69.2%	1	Y.LLLNAAGNTPDATK.I	2
*	PARC_hx1_02_itms.08402.08402.2	3.1137	0.2575	100.0%	1333.8722	1334.4229	5	5.58	68.2%	1	K.SVDELITEGNEK.L	2

YDR382W

23.6%

110

11050

4.1

RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.08165.08165.2	4.5659	0.3802	100.0%	1431.0322	1431.5425	1	8.302	76.9%	1	K.AVVESVGAEVDEAR.I	2
*	PARC_hx1_02_itms.10154.10154.2	3.2452	0.2223	100.0%	1274.4722	1274.4136	1	4.861	77.3%	1	K.GSLEEIIAEGQK.K	2

contaminant_KERATIN17

23.4%

590

62461

8.1

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.10059.10059.2	2.8088	0.3276	100.0%	1411.2722	1411.5547	2	6.851	61.5%	1	R.SFSTASAITPSVSR.T	2
	PARC_hx1_02_itms.11523.11523.2	1.9111	0.1538	97.1%	1398.7122	1398.6017	2	3.63	54.5%	1	K.TLNNKFASFIDK.V	2 2 2 2
	PARC_hx1_03_itms.10101.10101.2	3.5006	0.0935	100.0%	1203.6721	1204.3684	1	5.206	83.3%	3	K.WTLLQEQGTK.T	2 2
	PARC_hx1_04_itms.17747.17747.2	3.6776	0.3766	100.0%	1890.9521	1892.1216	1	6.986	67.9%	2	R.QNLEPLFEQYINNLR.R	2 2
	PARC_hx1_02_itms.07992.07992.1	1.7854	0.2974	100.0%	1016.52	1017.1271	1	4.878	75.0%	1	R.QLDSIVGER.G	1 1
	PARC_hx1_02_itms.07982.07982.2	1.697	0.1109	95.4%	1017.09216	1017.1271	9	4.456	75.0%	1	R.QLDSIVGER.G	2 2
*	PARC_hx1_02_itms.11490.11490.2	3.8893	0.0453	100.0%	1239.1522	1239.3856	3	5.608	83.3%	1	R.NMQDLVEDFK.N	2
*	PARC_hx1_02_itms.09969.09969.2	3.051	0.237	100.0%	1283.9122	1283.4822	2	5.561	70.0%	1	R.TTAENEFVMLK.K	2
	PARC_hx1_03_itms.14960.14960.3	3.6404	0.1737	100.0%	1959.2644	1961.1975	5	4.271	39.1%	1	S.MDNNRNLDLDSIIAEVK.A	3 3
	PARC_hx1_04_itms.16573.16573.1	3.0439	0.3354	100.0%	1329.53	1330.5211	6	6.025	59.1%	4	R.NLDLDSIIAEVK.A	1 1 1
	PARC_hx1_04_itms.16559.16559.2	4.5585	0.2401	100.0%	1330.4922	1330.5211	1	6.262	77.3%	4	R.NLDLDSIIAEVK.A	2 2 2
*	PARC_hx1_02_itms.06760.06760.2	1.8001	0.1877	98.3%	1095.8322	1094.1692	11	4.043	81.2%	1	K.AQYEEIANR.S	2
*	PARC_hx1_02_itms.07896.07896.2	3.0498	0.2734	100.0%	1243.0922	1243.3153	1	6.149	83.3%	1	R.TEAESWYQTK.Y	2
*	PARC_hx1_02_itms.09194.09194.1	2.3813	0.1775	100.0%	1143.51	1144.3104	3	4.22	66.7%	1	K.LAELEEALQK.A	1
*	PARC_hx1_02_itms.09230.09230.2	4.0858	0.2638	100.0%	1144.2322	1144.3104	1	5.098	88.9%	1	K.LAELEEALQK.A	2
	PARC_hx1_04_itms.14429.14429.2	4.0094	0.3816	100.0%	1264.0922	1264.4644	1	6.704	90.0%	13	K.LALDVEIATYR.K	2 2 2 2

Similarities: contaminant_KERATIN18(9:7)
contaminant_KERATIN22(4:12)
contaminant_KERATIN15(2:14)

U	YMR194W	2	2	22.0%	100	11124	11.6	RPL36A SGDID:S000004807, Chr XIII from 651144-651159,651623-651909, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Bp and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA"
U	YPL249C-A	2	2	22.0%	100	11135	11.6	RPL36B SGDID:S000006438, Chr XVI from 76239-76224,75985-75699, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl36Ap and has similarity to rat L36 ribosomal protein; binds to 5.8 S rRNA"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.08558.08558.2	2.4891	0.3022	100.0%	1134.4922	1135.2621	21	4.807	61.1%	1	R.EIAGLSPYER.R	2
	PARC_hx1_02_itms.08842.08842.2	4.4324	0.3876	100.0%	1347.2922	1347.5292	1	6.952	86.4%	1	K.VEEMNNIIAASR.R	2

YOR106W

18.4%

283

32498

7.0

VAM3 SGDID:S000005632, Chr XV from 519121-519972, Verified ORF, "Syntaxin-related protein required for vacuolar assembly; functions with Vam7p in vacuolar protein trafficking; member of the syntaxin family of proteins"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.06699.06699.2	3.9661	0.3423	100.0%	1593.0322	1593.65	1	6.096	65.4%	5	K.GNSQQEPQFSTNQK.T	2
*	PARC_hx1_04_itms.16163.16163.2	4.9346	0.4039	100.0%	1637.1921	1637.7869	1	7.425	80.8%	6	K.ELSNLIETFAEQSR.V	2
*	PARC_hx1_02_itms.09224.09224.2	3.577	0.2866	100.0%	1532.3522	1532.7002	5	4.865	70.8%	2	K.IETELIPNCTSVR.D	2
*	PARC_hx1_02_itms.08447.08447.1	2.0395	0.0912	98.5%	1266.53	1267.3782	41	3.899	55.0%	1	R.QDPESSYISIK.V	1
*	PARC_hx1_02_itms.08462.08462.2	2.4008	0.2215	100.0%	1267.2922	1267.3782	1	4.775	65.0%	1	R.QDPESSYISIK.V	2

contaminant_gi|7463016|pir||S77957

18.2%

269

27961

6.7

lysyl endopeptidase (EC 3.4.21.50) - Lysobacter enzymogenes

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.10067.10067.2	3.282	0.3821	100.0%	1491.5521	1491.5688	1	6.839	75.0%	1	V.VYWNYQNSTCR.A	2
*	PARC_hx1_03_itms.07728.07728.2	3.1942	0.3373	100.0%	1228.9722	1229.2604	1	6.201	93.8%	1	Y.WNYQNSTCR.A	2
*	PARC_hx1_04_itms.14829.14829.2	2.9117	0.2634	96.9%	1050.7322	1051.1924	1	5.165	92.9%	1	N.LFWAGWDR.R	2
*	PARC_hx1_02_itms.08006.08006.2	4.9247	0.472	100.0%	1749.4321	1749.8718	1	8.138	70.6%	1	S.GGVTEPGSSGSPIYSPEK.R	2
*	PARC_hx1_04_itms.09469.09469.2	2.6136	0.3627	97.1%	1692.2322	1692.82	1	6.073	56.2%	1	G.GVTEPGSSGSPIYSPEK.R	2
*	PARC_hx1_03_itms.07865.07865.1	2.3993	0.3895	100.0%	1051.54	1052.1753	1	6.644	60.0%	1	R.VLGQLHGGPSS.C	1
*	PARC_hx1_04_itms.09037.09037.2	3.9833	0.4659	100.0%	1211.6921	1212.3141	1	8.399	95.5%	2	R.VLGQLHGGPSSC.S	2

contaminant_KERATIN12

17.6%

431

47974

5.0

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
*	PARC_hx1_02_itms.08073.08073.2	4.2408	0.3555	100.0%	1345.7322	1346.4772	1	7.131	81.8%	1	R.ALEEANTELEVK.I	2
	PARC_hx1_04_itms.09762.09762.2	2.0344	0.0974	98.3%	1036.5521	1037.1661	25	3.383	83.3%	1	K.IRDWYQR.Q	2 2 2
*	PARC_hx1_04_itms.15612.15612.2	4.0132	0.2529	100.0%	2068.9321	2069.366	1	5.751	61.1%	1	K.ILTATVDNANILLQIDNAR.L	2
	PARC_hx1_02_itms.09734.09734.2	3.731	0.1607	100.0%	1029.5721	1030.2096	1	5.48	93.8%	1	R.VLDELTLAR.A	2 2 2 2 2
	PARC_hx1_02_itms.09736.09736.1	2.0179	0.0782	98.6%	1029.75	1030.2096	6	4.111	68.8%	1	R.VLDELTLAR.A	1 1 1 1 1
	PARC_hx1_02_itms.06658.06658.2	3.8523	0.4354	100.0%	1362.3722	1362.4796	1	7.47	75.0%	2	R.EVATNSELVQSGK.S	2 2
	PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.R	2 2 2 2 2 2

YDR481C

15.9%

566

63004

5.6

PHO8 SGDID:S000002889, Chr IV from 1420240-1418540, reverse complement, Verified ORF, "Repressible alkaline phosphatase, a glycoprotein localized to the vacuole; regulated by levels of inorganic phosphate and by a system consisting of Pho4p, Pho9p, Pho80p, Pho81p and Pho85p; dephosphorylates phosphotyrosyl peptides"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.17534.17534.2	3.4276	0.3203	100.0%	2013.9922	2014.365	1	7.026	58.3%	1	K.NVIFFVTDGMGPASLSMAR.S	2
*	PARC_hx1_04_itms.14941.14941.2	4.9601	0.4613	100.0%	2043.2922	2044.189	1	10.494	62.5%	1	R.SSDSLVTDSAAGATAFACALK.S	2
*	PARC_hx1_02_itms.09888.09888.2	3.0303	0.3641	100.0%	1016.9322	1017.2316	1	6.283	83.3%	1	R.VVDLLMGGGR.S	2
*	PARC_hx1_02_itms.11545.11545.2	3.5668	0.3638	100.0%	1967.4922	1967.0587	1	6.381	53.1%	1	R.DLIDEAQSNGWQYVGDR.K	2
*	PARC_hx1_04_itms.05166.05166.2	3.9387	0.4453	100.0%	1645.3121	1645.7317	1	8.032	78.6%	1	R.IDHAGHQNDPASQVR.E	2
*	PARC_hx1_02_itms.08919.08919.2	3.2129	0.2746	100.0%	982.2322	982.14246	1	6.299	92.9%	1	K.LNDMVSFR.A	2

contaminant_KERATIN07

14.2%

473

50915

5.5

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
	PARC_hx1_02_itms.08000.08000.1	3.0102	0.2872	100.0%	1301.65	1302.4241	1	6.355	63.6%	2	R.ALEEANADLEVK.I	1 1 1 1
	PARC_hx1_02_itms.08004.08004.2	4.5595	0.325	100.0%	1305.2122	1302.4241	1	6.344	81.8%	4	R.ALEEANADLEVK.I	2 2 2 2
*	PARC_hx1_04_itms.14165.14165.3	5.6279	0.4815	100.0%	2064.2043	2065.3774	1	8.969	51.4%	1	K.IIAATIENAQPILQIDNAR.L	3
*	PARC_hx1_04_itms.14158.14158.2	5.6442	0.4198	100.0%	2065.6921	2065.3774	1	7.423	58.3%	5	K.IIAATIENAQPILQIDNAR.L	2
	PARC_hx1_02_itms.09734.09734.2	3.731	0.1607	100.0%	1029.5721	1030.2096	1	5.48	93.8%	1	R.VLDELTLAR.T	2 2 2 2 2
	PARC_hx1_02_itms.09736.09736.1	2.0179	0.0782	98.6%	1029.75	1030.2096	6	4.111	68.8%	1	R.VLDELTLAR.T	1 1 1 1 1
	PARC_hx1_02_itms.07731.07731.1	2.282	0.2071	100.0%	1220.53	1221.3068	8	4.415	55.0%	1	K.ASLENSLEETK.G	1 1 1
	PARC_hx1_02_itms.07755.07755.2	3.0742	0.2333	100.0%	1221.8922	1221.3068	1	5.351	75.0%	1	K.ASLENSLEETK.G	2 2 2
	PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.R	2 2 2 2 2 2

YKL196C

13.0%

200

22707

5.7

YKT6 SGDID:S000001679, Chr XI from 75539-74937, reverse complement, Verified ORF, "Vesicle membrane protein (v-SNARE) with acyltransferase activity; involved in trafficking to and within the Golgi, endocytic trafficking to the vacuole, and vacuolar fusion; membrane localization due to prenylation at the carboxy-terminus"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.09425.09425.2	3.649	0.3779	100.0%	1621.1322	1621.6978	1	6.817	57.7%	1	K.EEWADVTETNDALK.M	2
*	PARC_hx1_02_itms.07851.07851.2	1.927	0.0769	95.4%	1368.4122	1367.5164	117	3.092	50.0%	1	K.YQDPSQADAIMK.V	2

U	YBR031W	3	4	12.4%	362	39092	10.6	RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins"
U	YDR012W	3	4	12.4%	362	39062	10.6	RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins"

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx1_04_itms.17178.17178.2	3.9906	0.3842	100.0%	1880.9722	1882.2047	1	7.594	59.4%	1	K.IPEIPLVVSTDLESIQK.T	2
PARC_hx1_03_itms.10805.10805.2	3.7972	0.25	100.0%	1474.4722	1474.697	1	7.12	69.2%	2	R.GPLVVYAEDNGIVK.A	2
PARC_hx1_02_itms.08675.08675.2	4.7733	0.4849	100.0%	1507.2122	1507.6403	1	8.436	80.8%	1	K.LDQVWGSETVASSK.V	2

YLL024C

12.1%

639

69470

5.1

SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.10788.10788.2	4.1042	0.4447	100.0%	1592.1721	1592.7667	1	7.939	71.4%	1	K.NQAAMNPANTVFDAK.R	2
	PARC_hx1_02_itms.10712.10712.2	2.8807	0.3092	100.0%	1895.3322	1896.0667	1	5.836	46.9%	1	K.VNDAVVTVPAYFNDSQR.Q	2
	PARC_hx1_04_itms.13364.13364.2	3.8554	0.4255	100.0%	1661.1522	1660.9078	1	7.236	70.0%	1	R.IINEPTAAAIAYGLDK.K	2
	PARC_hx1_03_itms.10202.10202.2	4.158	0.0702	100.0%	1460.0322	1460.6273	1	6.695	69.2%	1	K.SQVDEIVLVGGSTR.I	2
	PARC_hx1_05_itms.13382.13382.2	4.564	0.3343	100.0%	1619.4922	1619.7258	1	7.282	67.9%	1	K.NTISEAGDKLEQADK.D	2

YMR200W

12.1%

256

28908

5.6

ROT1 SGDID:S000004813, Chr XIII from 664751-665521, Verified ORF, "Protein that may be involved in cell wall function; mutations in rot1 cause cell wall defects, suppress tor2 mutations, and are synthetically lethal with rot2 mutations"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.08913.08913.2	3.8533	0.3929	100.0%	1602.6322	1603.6392	1	6.7	61.5%	1	C.EDESNSIYGTWSSK.S	2
*	PARC_hx1_02_itms.09118.09118.2	3.2137	0.2669	100.0%	1961.4521	1962.0027	1	5.942	56.2%	1	R.QLFSDPCNDDGVSTYSR.Y	2

contaminant_KERATIN10

11.8%

400

44106

5.1

no description

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx1_02_itms.07521.07521.1	2.1267	0.0998	98.1%	809.4	809.93774	69	4.326	75.0%	2	R.LASYLDK.V	1 1 1 1 1 1 1
PARC_hx1_02_itms.09429.09429.2	2.6813	0.2812	100.0%	1205.0521	1205.3716	1	5.269	75.0%	1	R.MSVEADINGLR.R	2 2
PARC_hx1_02_itms.09734.09734.2	3.731	0.1607	100.0%	1029.5721	1030.2096	1	5.48	93.8%	1	R.VLDELTLAR.T	2 2 2 2 2
PARC_hx1_02_itms.09736.09736.1	2.0179	0.0782	98.6%	1029.75	1030.2096	6	4.111	68.8%	1	R.VLDELTLAR.T	1 1 1 1 1
PARC_hx1_02_itms.10613.10613.1	1.6422	0.178	98.4%	1276.49	1277.4755	59	4.253	45.0%	1	R.TDLEMQIEGLK.E	1 1
PARC_hx1_02_itms.10627.10627.2	3.667	0.1639	100.0%	1280.0521	1277.4755	1	4.426	85.0%	2	R.TDLEMQIEGLK.E	2 2
PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.S	2 2 2 2 2 2

YAL038W

11.6%

500

54545

7.7

CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.09221.09221.2	2.7005	0.2195	100.0%	1228.1522	1228.391	2	5.559	70.0%	1	K.TNNPETLVALR.K	2
*	PARC_hx1_04_itms.14305.14305.2	3.0063	0.358	100.0%	1726.5721	1725.9365	1	6.097	46.9%	1	K.GVNLPGTDVDLPALSEK.D	2
*	PARC_hx1_04_itms.15361.15361.2	2.5956	0.1838	99.0%	1749.0521	1750.0453	4	3.887	50.0%	1	R.GDLGIEIPAPEVLAVQK.K	2
*	PARC_hx1_02_itms.09125.09125.2	2.6047	0.4153	100.0%	1518.4122	1519.5646	3	7.47	50.0%	1	K.EPVSDWTDDVEAR.I	2

U	YBR181C	2	2	11.4%	236	26996	10.4	RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein"
U	YPL090C	2	2	11.4%	236	26996	10.4	RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.08735.08735.2	4.2846	0.4425	100.0%	1593.2922	1593.6874	1	8.797	75.0%	1	R.IGQEVDGEAVGDEFK.G	2
	PARC_hx1_02_itms.09918.09918.2	2.449	0.203	100.0%	1280.4521	1278.4479	9	4.323	63.6%	1	R.EAAAEYAQLLAK.R	2

contaminant_KERATIN15

9.9%

629

64511

6.5

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.11523.11523.2	1.9111	0.1538	97.1%	1398.7122	1398.6017	2	3.63	54.5%	1	K.TLNNKFASFIDK.V	2 2 2 2
	PARC_hx1_02_itms.08343.08343.2	4.9059	0.1302	100.0%	1479.4922	1477.7007	1	5.757	86.4%	6	R.FLEQQNKVLETK.W	2 2
*	PARC_hx1_04_itms.16637.16637.2	5.1559	0.3406	100.0%	1302.8722	1303.4521	1	7.046	79.2%	10	R.SLDLDSIIAEVGA.Q	2
*	PARC_hx1_04_itms.16520.16520.1	3.2983	0.3082	100.0%	1304.62	1303.4521	1	5.679	58.3%	3	R.SLDLDSIIAEVGA.Q	1
*	PARC_hx1_04_itms.16637.16637.3	3.2982	0.242	100.0%	1953.8043	1952.1223	4	5.606	32.4%	3	R.SLDLDSIIAEVGAQYEDI.A	2
	PARC_hx1_02_itms.09074.09074.2	3.1631	0.2567	100.0%	1140.1721	1140.2965	2	5.732	81.2%	1	R.DYQELMNVK.L	2 2
	PARC_hx1_02_itms.09062.09062.1	3.0213	0.1963	100.0%	1140.47	1140.2965	3	4.994	75.0%	1	R.DYQELMNVK.L	1 1
	PARC_hx1_04_itms.14429.14429.2	4.0094	0.3816	100.0%	1264.0922	1264.4644	1	6.704	90.0%	13	K.LALDVEIATYR.K	2 2 2 2

Similarities: contaminant_KERATIN18(2:6)
contaminant_KERATIN22(4:4)
contaminant_KERATIN17(2:6)
contaminant_KERATIN16(1:7)

U	YHL033C	2	3	9.0%	256	28125	10.0	RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits"
U	YLL045C	2	3	9.0%	256	28112	10.0	RPL8B SGDID:S000003968, Chr XII from 48628-47858, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.08993.08993.2	4.6897	0.4272	100.0%	1118.0721	1118.2755	1	8.137	95.0%	2	K.TSAVAALTEVR.A	2
	PARC_hx1_02_itms.09072.09072.2	3.543	0.2625	100.0%	1295.3722	1294.4473	1	6.369	77.3%	1	K.LVSTIDANFADK.Y	2

YLR058C

8.7%

469

52219

7.4

SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, involved in one-carbon metabolism"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.15198.15198.2	3.7049	0.3699	100.0%	1667.5122	1667.8584	1	7.602	65.4%	1	K.ISAVSTYFESFPYR.V	2
*	PARC_hx1_02_itms.10466.10466.2	3.4808	0.3787	100.0%	1710.1122	1707.8749	1	7.541	71.4%	1	R.VNPETGIIDYDTLEK.N	2
*	PARC_hx1_02_itms.09615.09615.2	4.4405	0.4101	100.0%	1363.3722	1363.4668	1	7.197	86.4%	1	K.VDEGSDVLNTWK.K	2

YML123C

8.0%

587

64382

6.4

PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.14985.14985.2	3.4315	0.3773	100.0%	1936.7322	1936.1284	1	6.062	53.1%	1	R.LALESIDDEGFGWQQVK.T	2
*	PARC_hx1_02_itms.07815.07815.2	5.5518	0.4883	100.0%	1473.0721	1473.5798	1	8.154	84.6%	1	K.LELAAAAQEQDGEK.K	2
*	PARC_hx1_02_itms.07575.07575.2	3.6736	0.4224	100.0%	1756.6122	1756.7802	1	7.33	53.3%	1	K.NNDIESSSPSQLQHEA.-	2

YOR270C

7.3%

840

95529

5.5

VPH1 SGDID:S000005796, Chr XV from 830571-828049, reverse complement, Verified ORF, "Subunit of vacuolar-ATPase V0 domain, one of two isoforms (Vph1p and Stv1p); Vph1p is located in V-ATPase complexes of the vacuole while Stv1p is located in V-ATPase complexes of the Golgi and endosomes"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.09500.09500.2	5.6124	0.3566	100.0%	1761.2522	1761.985	1	6.657	85.7%	1	R.LIQMEDATDQIEVQK.N	2
*	PARC_hx1_02_itms.08896.08896.2	3.7435	0.3146	100.0%	1419.5922	1420.6024	1	6.308	72.7%	1	K.TVEIEQPVYDVK.T	2
*	PARC_hx1_02_itms.09886.09886.2	5.2814	0.5673	100.0%	2068.3523	2069.146	1	9.882	63.9%	1	K.IAESLDANLYDVDSSNEGR.S	2
*	PARC_hx1_04_itms.15028.15028.2	4.0461	0.4426	100.0%	1628.9321	1628.8169	1	7.912	60.7%	1	K.TTSTTLESELYAIAK.E	2

contaminant_KERATIN04

7.0%

458

49644

4.9

no description

Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
PARC_hx1_02_itms.08000.08000.1	3.0102	0.2872	100.0%	1301.65	1302.4241	1	6.355	63.6%	2	R.ALEEANADLEVK.I	1 1 1 1
PARC_hx1_02_itms.08004.08004.2	4.5595	0.325	100.0%	1305.2122	1302.4241	1	6.344	81.8%	4	R.ALEEANADLEVK.I	2 2 2 2
PARC_hx1_02_itms.08522.08522.2	3.486	0.1704	100.0%	1202.0922	1202.3097	1	5.643	90.0%	2	R.QSVEADINGLR.R	2 2
PARC_hx1_02_itms.07630.07630.2	3.1343	0.2168	100.0%	1123.0521	1123.2511	1	5.419	87.5%	1	R.LEQEIATYR.S	2 2 2 2 2 2

YER178W

6.4%

420

46343

8.1

PDA1 SGDID:S000000980, Chr V from 546812-548074, Verified ORF, "E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex, catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA, regulated by glucose"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.09051.09051.2	2.6016	0.1747	100.0%	1068.0721	1068.2151	2	4.315	87.5%	1	K.LDSIITSYR.C	2
*	PARC_hx1_02_itms.08826.08826.2	2.7449	0.2237	100.0%	1943.1721	1943.1174	1	5.476	50.0%	1	K.YVDEQVELADAAPPPEAK.L	2

U	YJL034W	2	2	4.5%	682	74468	4.9	KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p"
U	contaminant_GR78_YEAST	2	2	4.5%	682	74468	4.9	owl\|P16474\| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN...

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_04_itms.17651.17651.2	4.9797	0.4893	100.0%	2023.5122	2024.2323	1	8.642	70.6%	1	R.IEIDSFVDGIDLSETLTR.A	2
	PARC_hx1_02_itms.09986.09986.2	3.3397	0.3837	100.0%	1346.2922	1346.4802	1	6.564	66.7%	1	K.DVDDIVLVGGSTR.I	2

YJL012C

4.2%

721

83155

6.8

VTC4 SGDID:S000003549, Chr X from 413314-411149, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_02_itms.06862.06862.2	2.4613	0.2667	100.0%	1355.7922	1353.4777	1	4.943	60.0%	1	K.EVQEQVQHTVR.L	2
*	PARC_hx1_02_itms.09105.09105.2	2.1995	0.1421	98.9%	1071.1721	1071.2181	1	4.197	81.2%	1	K.YTVDQVFAK.M	2
*	PARC_hx1_02_itms.08951.08951.2	2.6756	0.1723	100.0%	1076.7922	1076.1973	1	5.371	83.3%	1	R.TAFQLPGDAR.V	2

YOR127W

4.0%

1007

112831

6.4

RGA1 SGDID:S000005653, Chr XV from 561170-564193, Verified ORF, "GTPase-activating protein for the polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_01_itms.10313.10313.2	2.7307	0.0291	97.0%	2601.872	2603.108	111	3.21	28.6%	1	K.GRKISRSLSRRSKDLMINLKSR.A	2
*	PARC_hx1_04_itms.17381.17381.2	3.5407	0.2466	97.1%	2204.632	2206.2407	1	5.208	47.1%	1	N.SDNFEEQKETLYENSESR.N	2

contaminant_KERATIN16

3.9%

534

57265

6.6

no description

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
	PARC_hx1_02_itms.08343.08343.2	4.9059	0.1302	100.0%	1479.4922	1477.7007	1	5.757	86.4%	6	Q.FLEQQNKVLETK.W	2 2
	PARC_hx1_02_itms.06951.06951.2	2.8576	0.2444	100.0%	1107.7322	1108.196	1	5.256	81.2%	3	R.AQYEEIAQR.S	2 2 2

Similarities: contaminant_KERATIN18(1:1)
contaminant_KERATIN22(1:1)
contaminant_KERATIN15(1:1)

YDL077C

3.3%

1049

122881

7.1

VAM6 SGDID:S000002235, Chr IV from 320120-316971, reverse complement, Verified ORF, "Vacuolar protein that plays a critical role in the tethering steps of vacuolar membrane fusion by facilitating guanine nucleotide exchange on small guanosine triphosphatase Ypt7p"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.15013.15013.2	2.9999	0.2116	100.0%	1549.5322	1549.81	1	4.68	66.7%	1	K.LFQVYPDLLQNAK.N	2
*	PARC_hx1_04_itms.14516.14516.2	2.3742	0.3111	100.0%	2416.7322	2417.6782	1	4.806	35.7%	1	K.LLNDAIESGSDQLPTNQLNFVK.Y	2

YDR135C

3.0%

1515

171120

8.4

YCF1 SGDID:S000002542, Chr IV from 727546-722999, reverse complement, Verified ORF, "Vacuolar glutathione S-conjugate transporter of the ATP-binding cassette family, has a role in detoxifying metals such as cadmium, mercury, and arsenite; also transports unconjugated bilirubin; similar to human cystic fibrosis protein CFTR"

	Filename	XCorr	DeltCN	Conf%	ObsM+H+	CalcM+H+	SpR	ZScore	Ion%	#	Sequence
*	PARC_hx1_04_itms.15949.15949.2	3.2503	0.2045	100.0%	2071.7122	2072.2817	1	4.754	56.2%	1	R.LFTFFTNEELQPDSVQR.L	2
*	PARC_hx1_04_itms.14339.14339.2	3.4394	0.4733	100.0%	1468.3121	1468.7106	1	7.749	66.7%	1	R.APMTFFETTPIGR.I	2
*	PARC_hx1_02_itms.10348.10348.2	4.055	0.3414	100.0%	1619.9521	1620.7563	1	6.021	60.7%	1	K.VAEFDSPGQLLSDNK.S	2

	Proteins	Peptide IDs	Spectra
Unfiltered	7152	15504	17035
Filtered	40	258	537
Forward matches	40	258	537
Decoy matches	0	0	0
Forward FP rate	0.0%	0.0%	0.0%

/data/6/jamest/xu/aug07/hx1/parc