DTASelect v1.8 /wfs/bfd/3/scott/cheeseman/sli15 /wfs/dbase/nci/yeast_orfs2 -o true Use criteria 1.8 Minimum +1 XCorr 2.5 Minimum +2 XCorr 3.5 Minimum +3 XCorr 0.08 Minimum DeltCN 1 Minimum Charge State 3 Maximum Charge State 0.0 Minimum Ion Proportion 1000 Maximum Sp Rank Include Modified peptide inclusion Any Tryptic status requirement Ignore Peptide validation handling XCorr Purge Duplicate Peptides by Protein false Include Only Loci with Unique Peptide true Remove Subset Proteins Ignore Locus validation handling 0 Minimum Modified Peptides per Locus 10 Minimum Redundancy for Low Coverage Loci 2 Minimum Peptides per Locus Locus Sequence Count Spectrum Count Sequence Coverage Length MolWt pI Validation Status Descriptive Name Unique FileName XCorr DeltCN M+H+ TotalIntensity SpRank IonProportion Redundancy Sequence pI ORFP:YLL024C 57 218 69.3% 639 69470 5.1 U SSA2, Chr XII from 95565-97484, reverse complement cheesemansli15-03.0922.0922.2 3.3406 0.2257 1214.91 5740.7 1 80.0% 3 R.VDIIANDQGNR.T 4.4570312 * cheesemansli15-04.1536.1536.2 2.5447 0.2716 1458.6 4580.9 1 70.8% 1 R.TTPSFVGFTDTER.L 4.4570312 * cheesemansli15-04.1526.1526.1 2.4542 0.3042 1255.82 4736.0 1 75.0% 1 T.PSFVGFTDTER.L 4.4570312 * cheesemansli15-04.1525.1525.2 3.1492 0.3736 1256.63 5566.9 1 80.0% 1 T.PSFVGFTDTER.L 4.4570312 * cheesemansli15-04.1335.1335.2 4.2143 0.4051 1593.32 7030.8 1 71.4% 3 K.NQAAMNPANTVFDAK.R 6.5625 * cheesemansli15-04.1325.1325.1 2.0031 0.2329 963.49 7254.9 1 68.8% 1 N.PANTVFDAK.R 6.5625 cheesemansli15-04.0864.0864.1 1.8188 0.1593 794.41 3601.4 2 66.7% 1 A.NTVFDAK.R 6.5625 * cheesemansli15-03.1058.1058.2 3.8915 0.2388 1395.54 6391.3 1 81.8% 5 R.NFNDPEVQGDMK.H 4.142578 cheesemansli15-05.2125.2125.2 4.072 0.4225 1731.92 3738.0 1 75.0% 36 K.LIDVDGKPQIQVEFK.G 4.716797 cheesemansli15-06.1830.1830.2 2.8323 0.3083 2145.08 5227.1 1 50.0% 1 K.LIDVDGKPQIQVEFKGETK.N 4.8945312 cheesemansli15-04.2499.2499.2 3.1891 0.2582 1551.67 4716.6 1 65.4% 4 K.NFTPEQISSMVLGK.M 6.5625 cheesemansli15-03.1584.1584.2 3.7201 0.3744 1896.27 5341.3 1 65.6% 16 K.VNDAVVTVPAYFNDSQR.Q 4.4570312 cheesemansli15-03.1661.1661.1 2.0808 0.1817 1098.73 4362.0 21 56.2% 1 V.PAYFNDSQR.Q 6.5625 cheesemansli15-04.1746.1746.2 3.5562 0.1586 1200.56 6369.9 1 81.8% 11 K.DAGTIAGLNVLR.I 6.5625 cheesemansli15-05.1521.1521.2 3.9693 0.4802 1788.98 5234.5 1 59.4% 10 R.IINEPTAAAIAYGLDKK.G 6.5625 * cheesemansli15-05.3458.3458.2 2.9195 0.3227 2312.64 9274.4 3 33.3% 1 F.DLGGGTFDVSLLSIEDGIFEVK.A 3.8554688 * cheesemansli15-04.2490.2490.2 2.7773 0.2036 1363.39 5222.8 1 77.3% 1 S.LLSIEDGIFEVK.A 4.142578 * cheesemansli15-03.1768.1768.1 2.0052 0.1844 1136.63 6117.8 1 72.2% 3 L.SIEDGIFEVK.A 4.142578 * cheesemansli15-03.1924.1924.2 3.2131 0.2411 1137.44 4161.5 1 77.8% 15 L.SIEDGIFEVK.A 4.142578 cheesemansli15-04.1449.1449.2 3.543 0.3717 1676.87 6418.5 1 60.0% 8 K.ATAGDTHLGGEDFDNR.L 4.4023438 cheesemansli15-06.1936.1936.1 2.4833 0.2165 1274.82 6558.6 3 61.1% 6 R.LVNHFIQEFK.R 7.328125 cheesemansli15-06.1940.1940.2 3.7289 0.35 1275.07 9144.2 1 83.3% 3 R.LVNHFIQEFK.R 7.328125 cheesemansli15-03.3183.3183.2 2.7893 0.3094 2598.25 8353.4 1 37.0% 1 R.TLSSSAQTSVEIDSLFEGIDFYTS.I 3.3359375 cheesemansli15-06.3397.3397.2 4.0154 0.551 2493.22 10936.2 1 40.5% 2 S.AQTSVEIDSLFEGIDFYTSITR.A 3.9648438 cheesemansli15-04.0624.0624.1 1.8444 0.1488 890.61 3249.2 24 57.1% 1 R.STLDPVEK.V 4.4570312 cheesemansli15-04.1455.1455.2 3.9953 0.0998 1460.09 7238.5 1 80.8% 2 K.SQVDEIVLVGGSTR.I 4.4570312 cheesemansli15-05.1351.1351.2 3.4929 0.4499 1553.29 8772.4 1 75.0% 15 K.LVTDYFNGKEPNR.S 6.5625 cheesemansli15-05.2634.2634.2 6.044 0.5817 2578.35 9621.6 1 48.0% 8 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemansli15-04.2839.2839.2 2.7651 0.2444 2264.15 7329.0 1 38.6% 1 N.PDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemansli15-04.1181.1181.2 3.8676 0.4418 1518.75 8170.6 1 66.7% 2 Y.GAAVQAAILTGDESSK.T 4.4570312 cheesemansli15-04.1074.1074.1 2.1143 0.2385 1389.78 6071.9 1 57.7% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemansli15-04.1065.1065.2 3.5763 0.3738 1390.08 6590.5 1 76.9% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemansli15-03.0864.0864.1 2.1569 0.4261 1092.7 5188.6 1 65.0% 1 Q.AAILTGDESSK.T 4.4570312 cheesemansli15-03.0685.0685.2 2.7009 0.3428 1180.63 7092.0 1 75.0% 1 A.ILTGDESSKTQ.D 4.4570312 cheesemansli15-04.3027.3027.2 2.5915 0.1403 2242.96 8513.8 10 32.5% 1 A.ILTGDESSKTQDLLLLDVAPL.S 3.9648438 cheesemansli15-02.3249.3249.2 3.1592 0.2776 1512.12 7468.1 1 69.2% 1 K.TQDLLLLDVAPLSL.G 3.5546875 cheesemansli15-02.3804.3804.2 3.512 0.4439 2329.81 8049.9 1 47.7% 1 K.TQDLLLLDVAPLSLGIETAGGVM.T 3.4726562 cheesemansli15-04.3617.3617.2 5.2235 0.4289 2556.19 4606.8 1 52.1% 9 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemansli15-04.1300.1300.1 2.4024 0.3165 1263.77 5822.6 1 54.2% 3 L.SLGIETAGGVMTK.L 6.5625 cheesemansli15-04.1274.1274.2 3.6756 0.4614 1264.76 8721.4 1 79.2% 2 L.SLGIETAGGVMTK.L 6.5625 cheesemansli15-04.2931.2931.2 4.7727 0.4228 2585.96 6689.5 1 47.7% 4 K.SEVFSTYADNQPGVLIQVFEGER.A 3.9648438 cheesemansli15-04.2537.2537.2 3.8563 0.4816 1937.54 5870.9 1 56.2% 1 T.YADNQPGVLIQVFEGER.A 4.142578 cheesemansli15-05.2203.2203.2 3.7043 0.3921 1772.59 7515.1 1 66.7% 9 Y.ADNQPGVLIQVFEGER.A 4.142578 cheesemansli15-03.0923.0923.1 1.9579 0.0958 773.28 6025.9 32 75.0% 1 K.DNNLLGK.F 6.5625 cheesemansli15-04.1532.1532.2 3.1751 0.2809 1184.58 4072.8 1 85.0% 3 K.FELSGIPPAPR.G 6.5625 cheesemansli15-04.1544.1544.1 1.8821 0.0939 1184.84 4615.7 14 50.0% 1 K.FELSGIPPAPR.G 6.5625 cheesemansli15-06.3077.3077.2 3.4166 0.3921 2534.14 8193.4 1 43.5% 2 R.GVPQIEVTFDVDSNGILNVSAVEK.G 3.9648438 cheesemansli15-04.0511.0511.2 2.6884 0.1555 961.86 7060.8 4 85.7% 1 R.LSKEDIEK.M 4.716797 cheesemansli15-04.0439.0439.2 3.2049 0.2009 1425.34 8269.3 1 80.0% 1 K.FKEEDEKESQR.I 4.5664062 cheesemansli15-04.1709.1709.1 2.4347 0.0925 1265.97 5261.6 1 65.0% 1 K.NQLESIAYSLK.N 6.5625 cheesemansli15-04.1684.1684.2 3.3168 0.2248 1266.78 5642.8 1 80.0% 2 K.NQLESIAYSLK.N 6.5625 * cheesemansli15-06.1650.1650.2 4.7305 0.4748 2134.67 10111.2 1 55.3% 1 K.NTISEAGDKLEQADKDAVTK.K 4.5664062 * cheesemansli15-06.1652.1652.3 3.733 0.313 2135.08 5024.5 1 36.8% 1 K.NTISEAGDKLEQADKDAVTK.K 4.5664062 * cheesemansli15-05.1379.1379.2 2.7622 0.0956 1880.08 8909.2 2 46.9% 1 K.KAEETIAWLDSNTTATK.E 4.716797 * cheesemansli15-03.1601.1601.2 3.1567 0.4138 1754.17 7121.4 1 53.3% 2 K.AEETIAWLDSNTTATK.E 4.142578 * cheesemansli15-05.2254.2254.2 3.6547 0.1315 2364.19 8612.6 1 44.7% 1 K.EEFDDQLKELQEVANPIMSK.L 4.1152344 * cheesemansli15-04.1260.1260.2 2.9346 0.1337 1358.75 5204.4 1 77.3% 1 K.ELQEVANPIMSK.L 4.4570312 ORFP:YDL229W 42 108 62.6% 613 66602 5.4 U SSB1, Chr IV from 44066-45907 cheesemansli15-03.1124.1124.2 2.6454 0.291 1546.85 8082.9 1 61.5% 1 Y.ESSVEIIANEQGNR.V 4.142578 * cheesemansli15-04.1767.1767.2 2.5837 0.2476 1480.6 7229.4 1 66.7% 1 R.VTPSFVAFTPEER.L 4.4570312 * cheesemansli15-04.1749.1749.2 3.3735 0.1876 1280.15 6364.1 2 75.0% 1 T.PSFVAFTPEER.L 4.4570312 cheesemansli15-04.0578.0578.1 1.9434 0.198 883.74 3536.5 2 78.6% 1 K.NQAALNPR.N 10.0625 cheesemansli15-04.0864.0864.1 1.8188 0.1593 794.41 3601.4 2 66.7% 1 R.NTVFDAK.R 6.5625 cheesemansli15-03.0597.0597.2 2.5465 0.2461 967.79 4364.8 5 92.9% 1 R.FDDESVQK.D 4.142578 cheesemansli15-04.2425.2425.2 4.9734 0.5191 2161.24 5234.7 1 69.4% 10 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemansli15-04.2398.2398.3 5.0361 0.3998 2161.28 8904.0 1 48.6% 1 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemansli15-05.2195.2195.2 3.6943 0.3221 1552.57 7548.1 1 88.5% 3 K.TFSPQEISAMVLTK.M 6.5625 cheesemansli15-04.0518.0518.2 2.5859 0.0851 919.93 4922.6 33 85.7% 1 K.MKEIAEAK.I 6.5625 cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 cheesemansli15-03.1757.1757.2 3.6193 0.2125 1185.75 5481.6 1 86.4% 9 K.DAGAISGLNVLR.I 6.5625 cheesemansli15-04.2023.2023.2 5.1267 0.5019 1733.85 5298.0 1 76.5% 4 R.IINEPTAAAIAYGLGAGK.S 6.5625 cheesemansli15-06.2224.2224.2 4.687 0.4227 2419.44 9212.9 1 54.8% 6 K.STSGNTHLGGQDFDTNLLEHFK.A 5.5234375 cheesemansli15-03.1070.1070.1 2.0058 0.206 1062.64 5154.5 5 61.1% 1 K.TGLDISDDAR.A 4.142578 cheesemansli15-03.1062.1062.2 3.5911 0.2864 1063.23 5205.1 1 83.3% 4 K.TGLDISDDAR.A 4.142578 cheesemansli15-04.2627.2627.2 3.5018 0.4336 2249.73 7358.9 1 44.7% 1 Q.TTVEVDSLFDGEDFESSLTR.A 3.8007812 cheesemansli15-03.1501.1501.2 2.7518 0.3381 1403.15 8741.7 1 68.2% 1 L.FDGEDFESSLTR.A 3.9648438 cheesemansli15-06.1984.1984.2 3.8404 0.39 1395.76 5661.7 1 81.8% 1 R.ARFEDLNAALFK.S 6.5625 cheesemansli15-04.1876.1876.2 3.187 0.358 1167.67 4207.0 1 88.9% 1 R.FEDLNAALFK.S 4.4570312 cheesemansli15-04.1906.1906.1 2.0898 0.2248 1167.79 10049.8 1 72.2% 1 R.FEDLNAALFK.S 4.4570312 cheesemansli15-04.1460.1460.2 2.805 0.3004 1243.48 2963.4 2 80.0% 1 K.STLEPVEQVLK.D 4.4570312 cheesemansli15-04.1420.1420.2 4.4562 0.0828 1460.55 6695.7 1 80.8% 2 K.SQIDEVVLVGGSTR.I 4.4570312 cheesemansli15-05.2249.2249.3 4.6212 0.4661 2897.11 12850.8 1 29.5% 1 K.SINPDEAVAYGAAVQGAILTGQSTSDETK.D 3.9648438 cheesemansli15-04.0973.0973.2 4.2959 0.403 1707.96 8565.2 1 65.6% 1 A.AVQGAILTGQSTSDETK.D 4.4570312 cheesemansli15-04.2578.2578.2 2.7307 0.1016 2277.08 5275.7 223 33.3% 1 A.AVQGAILTGQSTSDETKDLLLL.D 4.142578 cheesemansli15-02.3249.3249.2 3.1592 0.2776 1512.12 7468.1 1 69.2% 1 E.TKDLLLLDVAPLSL.G 4.4570312 * cheesemansli15-05.2415.2415.2 3.6578 0.3786 1763.55 10005.9 1 53.1% 2 L.SLGVGMQGDMFGIVVPR.N 6.5625 * cheesemansli15-03.1552.1552.2 3.7915 0.4642 1855.31 6843.8 1 53.3% 11 C.ADNQTTVQFPVYQGER.V 4.4570312 cheesemansli15-04.2238.2238.1 2.3078 0.2246 1278.97 4476.4 1 75.0% 1 K.ENTLLGEFDLK.N 4.142578 cheesemansli15-04.2232.2232.2 2.5321 0.1964 1278.97 4970.4 1 80.0% 1 K.ENTLLGEFDLK.N 4.142578 cheesemansli15-02.3537.3537.2 3.188 0.4454 2260.73 7566.3 1 45.0% 1 K.NIPMMPAGEPVLEAIFEVDAN.G 3.3359375 cheesemansli15-05.3743.3743.2 4.072 0.4143 2668.83 3921.2 1 45.8% 7 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemansli15-04.0783.0783.2 2.9328 0.2048 1095.79 4081.8 3 81.2% 1 K.MVNQAEEFK.A 4.4570312 cheesemansli15-06.2733.2733.2 2.9879 0.3881 2452.21 6578.5 1 40.5% 2 R.QRLESYVASIEQTVTDPVLSSK.L 4.716797 cheesemansli15-04.2566.2566.2 5.1269 0.5221 2170.2 7062.4 1 52.6% 6 R.LESYVASIEQTVTDPVLSSK.L 4.142578 cheesemansli15-03.1533.1533.2 2.5117 0.3855 1675.0 8015.1 1 53.3% 1 Y.VASIEQTVTDPVLSSK.L 4.4570312 cheesemansli15-03.1392.1392.2 3.3852 0.4295 1504.57 5416.2 1 69.2% 5 A.SIEQTVTDPVLSSK.L 4.4570312 cheesemansli15-05.2890.2890.2 3.3959 0.2449 1373.56 10154.7 1 73.1% 3 K.SKIEAALSDALAAL.Q 4.4570312 cheesemansli15-06.3536.3536.2 3.1228 0.3012 2630.86 10654.1 1 39.6% 3 K.SKIEAALSDALAALQIEDPSADELR.K 4.1152344 cheesemansli15-04.3017.3017.2 5.7701 0.4847 2412.03 9392.8 1 50.0% 5 K.IEAALSDALAALQIEDPSADELR.K 3.8007812 cheesemansli15-06.2826.2826.2 4.1816 0.3716 2542.21 5641.4 1 39.1% 1 K.IEAALSDALAALQIEDPSADELRK.A 4.1152344 ORFP:YAL005C 48 187 62.3% 642 69768 5.1 U SSA1, Chr I from 139501-141429, reverse complement cheesemansli15-03.0922.0922.2 3.3406 0.2257 1214.91 5740.7 1 80.0% 3 R.VDIIANDQGNR.T 4.4570312 * cheesemansli15-04.1137.1137.2 3.4815 0.3711 1608.78 5552.9 1 64.3% 2 K.NQAAMNPSNTVFDAK.R 6.5625 cheesemansli15-04.0864.0864.1 1.8188 0.1593 794.41 3601.4 2 66.7% 1 S.NTVFDAK.R 6.5625 * cheesemansli15-03.1130.1130.2 3.6275 0.3174 1408.59 6751.6 1 77.3% 4 R.NFNDPEVQADMK.H 4.142578 cheesemansli15-05.2125.2125.2 4.072 0.4225 1731.92 3738.0 1 75.0% 36 K.LIDVDGKPQIQVEFK.G 4.716797 cheesemansli15-06.1830.1830.2 2.8323 0.3083 2145.08 5227.1 1 50.0% 1 K.LIDVDGKPQIQVEFKGETK.N 4.8945312 cheesemansli15-04.2499.2499.2 3.1891 0.2582 1551.67 4716.6 1 65.4% 4 K.NFTPEQISSMVLGK.M 6.5625 cheesemansli15-03.1584.1584.2 3.7201 0.3744 1896.27 5341.3 1 65.6% 16 K.VNDAVVTVPAYFNDSQR.Q 4.4570312 cheesemansli15-03.1661.1661.1 2.0808 0.1817 1098.73 4362.0 21 56.2% 1 V.PAYFNDSQR.Q 6.5625 cheesemansli15-04.1746.1746.2 3.5562 0.1586 1200.56 6369.9 1 81.8% 11 K.DAGTIAGLNVLR.I 6.5625 cheesemansli15-05.1521.1521.2 3.9693 0.4802 1788.98 5234.5 1 59.4% 10 R.IINEPTAAAIAYGLDKK.G 6.5625 cheesemansli15-04.1449.1449.2 3.543 0.3717 1676.87 6418.5 1 60.0% 8 K.ATAGDTHLGGEDFDNR.L 4.4023438 cheesemansli15-06.1936.1936.1 2.4833 0.2165 1274.82 6558.6 3 61.1% 6 R.LVNHFIQEFK.R 7.328125 cheesemansli15-06.1940.1940.2 3.7289 0.35 1275.07 9144.2 1 83.3% 3 R.LVNHFIQEFK.R 7.328125 cheesemansli15-03.3183.3183.2 2.7893 0.3094 2598.25 8353.4 1 37.0% 1 R.TLSSSAQTSVEIDSLFEGIDFYTS.I 3.3359375 cheesemansli15-06.3397.3397.2 4.0154 0.551 2493.22 10936.2 1 40.5% 2 S.AQTSVEIDSLFEGIDFYTSITR.A 3.9648438 cheesemansli15-04.0624.0624.1 1.8444 0.1488 890.61 3249.2 24 57.1% 1 R.STLDPVEK.V 4.4570312 cheesemansli15-04.1455.1455.2 3.9953 0.0998 1460.09 7238.5 1 80.8% 2 K.SQVDEIVLVGGSTR.I 4.4570312 cheesemansli15-05.1351.1351.2 3.4929 0.4499 1553.29 8772.4 1 75.0% 15 K.LVTDYFNGKEPNR.S 6.5625 cheesemansli15-05.2634.2634.2 6.044 0.5817 2578.35 9621.6 1 48.0% 8 R.SINPDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemansli15-04.2839.2839.2 2.7651 0.2444 2264.15 7329.0 1 38.6% 1 N.PDEAVAYGAAVQAAILTGDESSK.T 3.9648438 cheesemansli15-04.1181.1181.2 3.8676 0.4418 1518.75 8170.6 1 66.7% 2 Y.GAAVQAAILTGDESSK.T 4.4570312 cheesemansli15-04.1074.1074.1 2.1143 0.2385 1389.78 6071.9 1 57.7% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemansli15-04.1065.1065.2 3.5763 0.3738 1390.08 6590.5 1 76.9% 1 A.AVQAAILTGDESSK.T 4.4570312 cheesemansli15-03.0864.0864.1 2.1569 0.4261 1092.7 5188.6 1 65.0% 1 Q.AAILTGDESSK.T 4.4570312 cheesemansli15-03.0685.0685.2 2.7009 0.3428 1180.63 7092.0 1 75.0% 1 A.ILTGDESSKTQ.D 4.4570312 cheesemansli15-04.3027.3027.2 2.5915 0.1403 2242.96 8513.8 10 32.5% 1 A.ILTGDESSKTQDLLLLDVAPL.S 3.9648438 cheesemansli15-02.3249.3249.2 3.1592 0.2776 1512.12 7468.1 1 69.2% 1 K.TQDLLLLDVAPLSL.G 3.5546875 cheesemansli15-02.3804.3804.2 3.512 0.4439 2329.81 8049.9 1 47.7% 1 K.TQDLLLLDVAPLSLGIETAGGVM.T 3.4726562 cheesemansli15-04.3617.3617.2 5.2235 0.4289 2556.19 4606.8 1 52.1% 9 K.TQDLLLLDVAPLSLGIETAGGVMTK.L 4.142578 cheesemansli15-04.1300.1300.1 2.4024 0.3165 1263.77 5822.6 1 54.2% 3 L.SLGIETAGGVMTK.L 6.5625 cheesemansli15-04.1274.1274.2 3.6756 0.4614 1264.76 8721.4 1 79.2% 2 L.SLGIETAGGVMTK.L 6.5625 cheesemansli15-04.2537.2537.2 3.8563 0.4816 1937.54 5870.9 1 56.2% 1 T.YADNQPGVLIQVFEGER.A 4.142578 cheesemansli15-05.2203.2203.2 3.7043 0.3921 1772.59 7515.1 1 66.7% 9 Y.ADNQPGVLIQVFEGER.A 4.142578 cheesemansli15-03.0923.0923.1 1.9579 0.0958 773.28 6025.9 32 75.0% 1 K.DNNLLGK.F 6.5625 cheesemansli15-04.1532.1532.2 3.1751 0.2809 1184.58 4072.8 1 85.0% 3 K.FELSGIPPAPR.G 6.5625 cheesemansli15-04.1544.1544.1 1.8821 0.0939 1184.84 4615.7 14 50.0% 1 K.FELSGIPPAPR.G 6.5625 cheesemansli15-06.3077.3077.2 3.4166 0.3921 2534.14 8193.4 1 43.5% 2 R.GVPQIEVTFDVDSNGILNVSAVEK.G 3.9648438 cheesemansli15-04.0511.0511.2 2.6884 0.1555 961.86 7060.8 4 85.7% 1 R.LSKEDIEK.M 4.716797 cheesemansli15-04.0439.0439.2 3.2049 0.2009 1425.34 8269.3 1 80.0% 1 K.FKEEDEKESQR.I 4.5664062 cheesemansli15-04.1709.1709.1 2.4347 0.0925 1265.97 5261.6 1 65.0% 1 K.NQLESIAYSLK.N 6.5625 cheesemansli15-04.1684.1684.2 3.3168 0.2248 1266.78 5642.8 1 80.0% 2 K.NQLESIAYSLK.N 6.5625 * cheesemansli15-06.1636.1636.3 4.5536 0.3627 2164.11 5230.0 1 42.1% 1 K.NTISEAGDKLEQADKDTVTK.K 4.5664062 * cheesemansli15-06.1632.1632.2 4.8399 0.4765 2164.55 9012.6 1 52.6% 1 K.NTISEAGDKLEQADKDTVTK.K 4.5664062 * cheesemansli15-06.1890.1890.2 3.628 0.3021 2646.26 7492.5 1 38.6% 1 K.KAEETISWLDSNTTASKEEFDDK.L 4.279297 * cheesemansli15-06.1886.1886.3 5.2303 0.4093 2647.2 10433.6 1 38.6% 1 K.KAEETISWLDSNTTASKEEFDDK.L 4.279297 * cheesemansli15-03.1446.1446.2 2.9773 0.4114 1753.93 6512.3 1 60.0% 1 K.AEETISWLDSNTTASK.E 4.142578 * cheesemansli15-04.1467.1467.2 2.7495 0.1313 1358.76 4492.8 1 68.2% 1 K.ELQDIANPIMSK.L 4.4570312 ORFP:YNL209W 41 100 61.0% 613 66595 5.5 U SSB2, Chr XIV from 252058-253899 cheesemansli15-03.1124.1124.2 2.6454 0.291 1546.85 8082.9 1 61.5% 1 Y.ESSVEIIANEQGNR.V 4.142578 * cheesemansli15-04.1691.1691.2 2.6186 0.2635 1479.72 7060.0 1 70.8% 1 R.VTPSFVAFTPQER.L 6.5625 cheesemansli15-04.0578.0578.1 1.9434 0.198 883.74 3536.5 2 78.6% 1 K.NQAALNPR.N 10.0625 cheesemansli15-04.0864.0864.1 1.8188 0.1593 794.41 3601.4 2 66.7% 1 R.NTVFDAK.R 6.5625 cheesemansli15-03.0597.0597.2 2.5465 0.2461 967.79 4364.8 5 92.9% 1 R.FDDESVQK.D 4.142578 cheesemansli15-04.2425.2425.2 4.9734 0.5191 2161.24 5234.7 1 69.4% 10 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemansli15-04.2398.2398.3 5.0361 0.3998 2161.28 8904.0 1 48.6% 1 K.VIDVDGNPVIEVQYLEETK.T 3.8554688 cheesemansli15-05.2195.2195.2 3.6943 0.3221 1552.57 7548.1 1 88.5% 3 K.TFSPQEISAMVLTK.M 6.5625 cheesemansli15-04.0518.0518.2 2.5859 0.0851 919.93 4922.6 33 85.7% 1 K.MKEIAEAK.I 6.5625 cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 cheesemansli15-03.1757.1757.2 3.6193 0.2125 1185.75 5481.6 1 86.4% 9 K.DAGAISGLNVLR.I 6.5625 cheesemansli15-04.2023.2023.2 5.1267 0.5019 1733.85 5298.0 1 76.5% 4 R.IINEPTAAAIAYGLGAGK.S 6.5625 cheesemansli15-06.2224.2224.2 4.687 0.4227 2419.44 9212.9 1 54.8% 6 K.STSGNTHLGGQDFDTNLLEHFK.A 5.5234375 cheesemansli15-03.1070.1070.1 2.0058 0.206 1062.64 5154.5 5 61.1% 1 K.TGLDISDDAR.A 4.142578 cheesemansli15-03.1062.1062.2 3.5911 0.2864 1063.23 5205.1 1 83.3% 4 K.TGLDISDDAR.A 4.142578 cheesemansli15-04.2627.2627.2 3.5018 0.4336 2249.73 7358.9 1 44.7% 1 Q.TTVEVDSLFDGEDFESSLTR.A 3.8007812 cheesemansli15-03.1501.1501.2 2.7518 0.3381 1403.15 8741.7 1 68.2% 1 L.FDGEDFESSLTR.A 3.9648438 cheesemansli15-06.1984.1984.2 3.8404 0.39 1395.76 5661.7 1 81.8% 1 R.ARFEDLNAALFK.S 6.5625 cheesemansli15-04.1876.1876.2 3.187 0.358 1167.67 4207.0 1 88.9% 1 R.FEDLNAALFK.S 4.4570312 cheesemansli15-04.1906.1906.1 2.0898 0.2248 1167.79 10049.8 1 72.2% 1 R.FEDLNAALFK.S 4.4570312 cheesemansli15-04.1460.1460.2 2.805 0.3004 1243.48 2963.4 2 80.0% 1 K.STLEPVEQVLK.D 4.4570312 cheesemansli15-04.1420.1420.2 4.4562 0.0828 1460.55 6695.7 1 80.8% 2 K.SQIDEVVLVGGSTR.I 4.4570312 cheesemansli15-05.2249.2249.3 4.6212 0.4661 2897.11 12850.8 1 29.5% 1 K.SINPDEAVAYGAAVQGAILTGQSTSDETK.D 3.9648438 cheesemansli15-04.0973.0973.2 4.2959 0.403 1707.96 8565.2 1 65.6% 1 A.AVQGAILTGQSTSDETK.D 4.4570312 cheesemansli15-04.2578.2578.2 2.7307 0.1016 2277.08 5275.7 223 33.3% 1 A.AVQGAILTGQSTSDETKDLLLL.D 4.142578 cheesemansli15-02.3249.3249.2 3.1592 0.2776 1512.12 7468.1 1 69.2% 1 E.TKDLLLLDVAPLSL.G 4.4570312 * cheesemansli15-04.1744.1744.2 4.5245 0.4668 2419.05 7489.6 1 52.5% 2 R.TFTTVSDNQTTVQFPVYQGER.V 4.4570312 * cheesemansli15-03.1453.1453.2 4.0315 0.4702 1869.8 7064.3 1 56.7% 4 V.SDNQTTVQFPVYQGER.V 4.4570312 cheesemansli15-04.2238.2238.1 2.3078 0.2246 1278.97 4476.4 1 75.0% 1 K.ENTLLGEFDLK.N 4.142578 cheesemansli15-04.2232.2232.2 2.5321 0.1964 1278.97 4970.4 1 80.0% 1 K.ENTLLGEFDLK.N 4.142578 cheesemansli15-02.3537.3537.2 3.188 0.4454 2260.73 7566.3 1 45.0% 1 K.NIPMMPAGEPVLEAIFEVDAN.G 3.3359375 cheesemansli15-05.3743.3743.2 4.072 0.4143 2668.83 3921.2 1 45.8% 7 K.NIPMMPAGEPVLEAIFEVDANGILK.V 3.9648438 cheesemansli15-04.0783.0783.2 2.9328 0.2048 1095.79 4081.8 3 81.2% 1 K.MVNQAEEFK.A 4.4570312 cheesemansli15-06.2733.2733.2 2.9879 0.3881 2452.21 6578.5 1 40.5% 2 R.QRLESYVASIEQTVTDPVLSSK.L 4.716797 cheesemansli15-04.2566.2566.2 5.1269 0.5221 2170.2 7062.4 1 52.6% 6 R.LESYVASIEQTVTDPVLSSK.L 4.142578 cheesemansli15-03.1533.1533.2 2.5117 0.3855 1675.0 8015.1 1 53.3% 1 Y.VASIEQTVTDPVLSSK.L 4.4570312 cheesemansli15-03.1392.1392.2 3.3852 0.4295 1504.57 5416.2 1 69.2% 5 A.SIEQTVTDPVLSSK.L 4.4570312 cheesemansli15-05.2890.2890.2 3.3959 0.2449 1373.56 10154.7 1 73.1% 3 K.SKIEAALSDALAAL.Q 4.4570312 cheesemansli15-06.3536.3536.2 3.1228 0.3012 2630.86 10654.1 1 39.6% 3 K.SKIEAALSDALAALQIEDPSADELR.K 4.1152344 cheesemansli15-04.3017.3017.2 5.7701 0.4847 2412.03 9392.8 1 50.0% 5 K.IEAALSDALAALQIEDPSADELR.K 3.8007812 cheesemansli15-06.2826.2826.2 4.1816 0.3716 2542.21 5641.4 1 39.1% 1 K.IEAALSDALAALQIEDPSADELRK.A 4.1152344 ORFP:YBR156C 64 446 45.8% 698 79186 9.9 U SLI15, Chr II from 551062-553158, reverse complement * cheesemansli15-02.0275.0275.2 4.0641 0.2616 1360.42 8793.2 1 81.8% 1 R.SIIETLDDLNNL.T 3.4726562 * cheesemansli15-04.2665.2665.2 3.2446 0.2032 1886.88 8848.7 1 65.6% 2 R.SIIETLDDLNNLTTDAH.S 3.9648438 * cheesemansli15-04.2646.2646.2 3.49 0.1895 2103.04 9521.0 1 58.3% 1 R.SIIETLDDLNNLTTDAHSE.I 3.8554688 * cheesemansli15-05.3401.3401.3 4.6817 0.4035 2614.33 5749.1 1 34.1% 14 R.SIIETLDDLNNLTTDAHSEINQR.L 4.251953 * cheesemansli15-05.2874.2874.2 5.0141 0.4712 2614.36 9553.0 1 43.2% 49 R.SIIETLDDLNNLTTDAHSEINQR.L 4.251953 * cheesemansli15-06.2717.2717.2 2.8514 0.3396 2300.56 8444.0 1 39.5% 1 I.ETLDDLNNLTTDAHSEINQR.L 4.251953 * cheesemansli15-06.2725.2725.2 3.0552 0.3952 2170.71 10453.1 1 47.2% 1 E.TLDDLNNLTTDAHSEINQR.L 4.4023438 * cheesemansli15-06.2714.2714.2 3.0365 0.4151 2071.0 9546.8 1 47.1% 1 T.LDDLNNLTTDAHSEINQR.L 4.4023438 * cheesemansli15-04.1496.1496.2 3.4979 0.3545 1183.46 4643.9 1 93.8% 2 R.LYESSEWLR.N 4.4570312 * cheesemansli15-04.1246.1246.1 1.8267 0.1348 865.56 3929.3 1 83.3% 1 K.MDVEFPK.M 4.4570312 * cheesemansli15-05.0286.0286.2 3.9915 0.3935 1785.95 8066.7 1 73.3% 10 K.MKGEYELSNSQNDAAK.D 4.716797 * cheesemansli15-03.0793.0793.2 4.5505 0.4364 1529.5 9363.1 1 73.1% 3 K.GEYELSNSQNDAAK.D 4.142578 * cheesemansli15-05.1962.1962.2 2.734 0.1193 962.46 8798.6 1 92.9% 1 R.FSIHDTNK.S 7.328125 * cheesemansli15-04.0994.0994.1 2.4231 0.2006 1070.63 5367.4 1 72.2% 1 K.SPVEPLNSVK.V 6.5625 * cheesemansli15-06.1584.1584.1 2.1188 0.1317 1236.83 3862.6 25 55.6% 2 K.RFDNQTWAAK.E 9.078125 * cheesemansli15-06.1585.1585.2 3.3078 0.3127 1237.7 8226.0 1 77.8% 1 K.RFDNQTWAAK.E 9.078125 * cheesemansli15-04.2682.2682.2 2.8301 0.2826 2478.12 8949.3 1 40.0% 1 R.FDNQTWAAKEEMENEPILQAL.K 3.8554688 * cheesemansli15-03.1987.1987.2 4.3134 0.3278 1545.53 4787.4 1 79.2% 15 K.EEMENEPILQALK.K 3.9648438 * cheesemansli15-03.1853.1853.1 2.0764 0.0909 1154.74 6017.2 57 55.6% 1 M.ENEPILQALK.K 4.4570312 * cheesemansli15-05.2323.2323.2 3.2045 0.3021 1829.85 6448.6 1 50.0% 6 R.SNMFVPLPNKDPLIIQ.H 6.5625 * cheesemansli15-06.1536.1536.1 1.9243 0.177 1086.86 3923.1 1 66.7% 1 K.KSTINSPAIR.A 10.9921875 * cheesemansli15-03.0504.0504.2 3.0183 0.3566 1180.47 7375.0 1 77.3% 1 R.AVENSDTAGSTK.A 4.4570312 * cheesemansli15-04.1241.1241.2 3.3128 0.3952 1473.9 7560.1 1 69.2% 1 K.YSSSSIDLTGSPMK.K 6.5625 * cheesemansli15-05.0304.0304.2 2.9196 0.3882 1601.36 6748.4 1 50.0% 2 K.YSSSSIDLTGSPMKK.V 8.640625 * cheesemansli15-04.1180.1180.1 1.8348 0.1042 1048.62 4443.9 2 61.1% 1 S.SIDLTGSPMK.K 6.5625 * cheesemansli15-04.1186.1186.2 2.7099 0.1181 1049.47 6147.4 2 83.3% 1 S.SIDLTGSPMK.K 6.5625 * cheesemansli15-03.1328.1328.2 4.3917 0.3267 1581.64 9659.9 1 73.1% 12 K.SINSTDTDMQEALR.D 4.142578 * cheesemansli15-03.1179.1179.2 2.5041 0.2833 1381.5 7173.3 1 63.6% 1 I.NSTDTDMQEALR.D 4.142578 * cheesemansli15-06.1600.1600.1 2.079 0.1869 1013.7 6318.5 7 62.5% 1 K.KLAIIAEQK.K 8.8046875 * cheesemansli15-04.1034.1034.2 2.5225 0.1232 886.49 4499.9 1 92.9% 1 K.LAIIAEQK.K 6.5625 * cheesemansli15-04.0925.0925.1 1.8053 0.1898 1026.76 2751.7 10 64.3% 1 K.NYYQSPVR.G 8.8046875 * cheesemansli15-04.0894.0894.2 2.554 0.3951 1027.71 5194.2 1 92.9% 1 K.NYYQSPVR.G 8.8046875 * cheesemansli15-06.0443.0443.1 1.9665 0.223 1154.79 4643.4 1 61.1% 1 K.NLTTSQTPHR.L 10.0625 * cheesemansli15-06.0446.0446.2 3.161 0.4 1155.6 7498.4 1 72.2% 20 K.NLTTSQTPHR.L 10.0625 * cheesemansli15-06.1836.1836.2 4.142 0.4402 1656.03 7291.3 1 82.1% 5 R.KLSPNIADISKPESR.K 8.8046875 * cheesemansli15-05.1534.1534.2 3.5543 0.3804 1527.27 6845.4 1 61.5% 29 K.LSPNIADISKPESR.K 6.5625 * cheesemansli15-05.0363.0363.1 1.8139 0.0909 1115.71 4022.4 5 55.6% 1 N.IADISKPESR.K 6.5625 * cheesemansli15-04.1669.1669.2 2.8981 0.2372 1115.85 7368.3 2 83.3% 5 N.IADISKPESR.K 6.5625 * cheesemansli15-04.1655.1655.2 3.0663 0.1971 1567.91 3605.2 1 69.2% 2 R.LTNLQLLPPAEAER.D 4.4570312 * cheesemansli15-05.0298.0298.2 3.6511 0.1775 2037.17 3852.9 2 47.1% 40 R.LTNLQLLPPAEAERDDLK.K 4.4023438 * cheesemansli15-05.0067.0067.3 3.5082 0.216 2037.4 7395.0 2 36.8% 1 R.LTNLQLLPPAEAERDDLK.K 4.4023438 * cheesemansli15-06.1882.1882.2 3.329 0.3191 2164.94 4384.5 2 44.4% 4 R.LTNLQLLPPAEAERDDLKK.K 4.8945312 * cheesemansli15-05.0538.0538.2 2.5989 0.0981 1101.36 7991.4 2 81.2% 1 R.MSHLEQDLK.K 5.6328125 * cheesemansli15-06.1484.1484.2 3.5721 0.1233 1232.04 9239.3 2 77.8% 2 R.MSHLEQDLKK.Q 7.328125 * cheesemansli15-05.0642.0642.1 2.4358 0.3217 1217.87 4982.2 1 66.7% 4 K.KQTSFSNDYK.D 8.640625 * cheesemansli15-05.0814.0814.2 2.8271 0.2756 1219.68 7070.1 1 77.8% 2 K.KQTSFSNDYK.D 8.640625 * cheesemansli15-06.1876.1876.2 3.6886 0.3691 1527.53 4111.6 1 79.2% 6 R.LKESLAPFDNHVR.D 7.328125 * cheesemansli15-05.3093.3093.2 5.0207 0.4683 2103.74 8669.5 1 63.9% 61 K.NTAFSTDNILATINTVDHR.E 5.6328125 * cheesemansli15-05.2305.2305.3 3.6427 0.2394 2104.73 4219.9 1 36.1% 1 K.NTAFSTDNILATINTVDHR.E 5.6328125 * cheesemansli15-05.0294.0294.2 2.7191 0.308 1672.07 9936.6 1 42.9% 2 F.STDNILATINTVDHR.E 5.6328125 * cheesemansli15-06.1662.1662.2 2.6521 0.1758 1693.88 8389.3 1 53.6% 1 I.NTVDHREIIGNVTPK.I 7.328125 * cheesemansli15-04.1419.1419.1 2.3336 0.1456 1246.96 4371.5 1 66.7% 3 K.SPYLQEQLIR.Q 6.5625 * cheesemansli15-04.1447.1447.2 3.8864 0.0921 1247.59 5907.6 1 88.9% 2 K.SPYLQEQLIR.Q 6.5625 * cheesemansli15-05.2881.2881.3 3.8649 0.2105 3752.56 5533.2 1 19.4% 3 L.QEQLIRQQDINPQTIFGPIPPLHTDEIFPNPR.L 4.8945312 * cheesemansli15-04.2481.2481.2 2.6373 0.2254 2262.11 6317.1 1 36.8% 1 R.QQDINPQTIFGPIPPLHTDE.I 4.142578 * cheesemansli15-05.4061.4061.3 4.7401 0.4333 2986.15 7142.7 1 33.0% 50 R.QQDINPQTIFGPIPPLHTDEIFPNPR.L 4.716797 * cheesemansli15-04.3139.3139.2 4.7802 0.5176 2502.56 4675.5 1 59.5% 9 I.NPQTIFGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-04.3114.3114.2 4.8188 0.5512 2387.62 4327.4 1 57.5% 19 N.PQTIFGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-04.3046.3046.3 4.4024 0.4226 2388.59 5226.2 1 37.5% 2 N.PQTIFGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-06.2957.2957.2 4.2243 0.4556 2162.47 4951.8 1 66.7% 9 Q.TIFGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-04.3070.3070.2 4.1532 0.4513 2061.2 5509.8 1 61.8% 3 T.IFGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-04.3091.3091.2 3.3532 0.4413 1948.97 5082.9 1 59.4% 7 I.FGPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-04.3062.3062.2 3.6674 0.5637 1803.19 3997.5 1 56.7% 3 F.GPIPPLHTDEIFPNPR.L 5.6328125 * cheesemansli15-06.2978.2978.2 4.4026 0.4826 1533.89 8799.7 1 79.2% 9 I.PPLHTDEIFPNPR.L 5.6328125 ORFP:YJR089W 45 164 43.8% 954 108667 6.5 U BIR1, Chr X from 587410-590274 * cheesemansli15-04.2581.2581.2 3.8718 0.3923 1411.72 6148.6 1 72.7% 5 K.LGFYFDPVIDPK.T 4.4570312 * cheesemansli15-04.2914.2914.2 4.241 0.3989 1291.22 7219.9 1 85.0% 2 K.DVLETLSNIMR.Q 4.4570312 * cheesemansli15-04.1552.1552.2 4.0509 0.4626 1696.73 5217.9 1 84.6% 13 K.YFSNPDDENVINLR.K 4.142578 * cheesemansli15-06.2104.2104.2 4.2514 0.4014 2569.32 7210.3 1 47.6% 4 K.FTFQDNWPHSGSQNEHPLGIEK.M 5.5234375 * cheesemansli15-06.2036.2036.3 4.056 0.4493 2569.79 8100.2 1 39.3% 2 K.FTFQDNWPHSGSQNEHPLGIEK.M 5.5234375 * cheesemansli15-03.1231.1231.2 3.7828 0.3995 1617.48 6897.6 1 78.6% 4 R.YDSSIEGLGDPSMDK.T 3.9648438 * cheesemansli15-04.2098.2098.2 3.4885 0.344 1760.68 6283.1 1 64.3% 2 K.QLLQGWSINDDPMSR.H 4.4570312 * cheesemansli15-03.0517.0517.1 1.8418 0.0979 1147.65 6725.2 11 50.0% 1 R.IKNDNDSITK.N 6.5625 * cheesemansli15-03.0521.0521.2 3.1358 0.2926 1147.91 4068.3 1 88.9% 1 R.IKNDNDSITK.N 6.5625 * cheesemansli15-05.2234.2234.3 4.5477 0.3411 2340.02 9895.6 1 33.3% 7 K.TDISVIQHNISVLDGAQGENVK.R 4.716797 * cheesemansli15-05.1818.1818.2 5.0402 0.517 2340.07 7924.7 1 59.5% 12 K.TDISVIQHNISVLDGAQGENVK.R 4.716797 * cheesemansli15-06.2081.2081.3 5.141 0.4014 2495.47 8266.9 1 34.1% 1 K.TDISVIQHNISVLDGAQGENVKR.N 5.796875 * cheesemansli15-06.2101.2101.2 4.0621 0.3651 2497.36 6615.6 1 56.8% 3 K.TDISVIQHNISVLDGAQGENVKR.N 5.796875 * cheesemansli15-03.1190.1190.2 4.871 0.5029 2149.8 9779.4 1 61.1% 6 K.EQINMENGSTTLEEGNINR.D 3.9648438 * cheesemansli15-06.1656.1656.2 3.0407 0.3136 1555.74 8232.7 1 61.5% 1 K.RPNVQLTQSSSPIK.K 10.9921875 * cheesemansli15-06.2648.2648.2 3.5743 0.2206 1401.76 5535.6 1 72.7% 1 K.DLVIDFTSHIIK.N 5.6328125 * cheesemansli15-03.0931.0931.2 2.6243 0.0819 1219.6 7757.0 2 75.0% 1 K.GIDSDNDNVIR.E 4.142578 * cheesemansli15-03.0530.0530.1 1.8849 0.0893 1208.59 4327.4 1 65.0% 1 R.EDDTGINTDTK.G 3.9648438 * cheesemansli15-04.1737.1737.2 4.0192 0.371 1745.68 9132.3 1 64.3% 3 K.FSVNSEEDLNFSEVK.L 3.9648438 * cheesemansli15-03.1150.1150.1 1.8755 0.1091 1018.63 2791.3 1 68.8% 1 R.DSSTNILIR.T 6.5625 * cheesemansli15-03.1178.1178.2 3.0381 0.2378 1019.48 6859.1 3 81.2% 2 R.DSSTNILIR.T 6.5625 * cheesemansli15-03.1321.1321.2 4.2979 0.313 1488.6 8613.6 1 83.3% 9 R.TQIVDQNLGDIDR.D 4.142578 * cheesemansli15-06.1698.1698.2 3.7738 0.3256 2793.38 8988.3 1 36.0% 1 R.TQIVDQNLGDIDRDKVPNGGSPEVPK.T 4.5664062 * cheesemansli15-06.1728.1728.3 4.6177 0.3413 2793.39 8391.6 1 31.0% 2 R.TQIVDQNLGDIDRDKVPNGGSPEVPK.T 4.5664062 * cheesemansli15-03.0950.0950.2 3.5021 0.1411 1305.17 8280.1 1 66.7% 3 K.SGDNSSNITAIPK.E 6.5625 * cheesemansli15-04.2094.2094.2 4.2664 0.3862 2578.75 8832.9 1 45.5% 1 K.NETPNNEMLLFETGTPIASQENK.S 3.9648438 * cheesemansli15-03.1854.1854.2 3.0275 0.2868 1558.74 3827.8 1 65.4% 4 K.ELDIPIDSSTVEIK.K 3.9648438 * cheesemansli15-06.0244.0244.2 3.0797 0.4707 1568.96 3619.3 1 57.7% 8 K.VIKPEFEPVPSVAR.N 6.5625 * cheesemansli15-04.0971.0971.2 3.2789 0.4155 1181.01 4853.1 1 90.0% 2 R.NLVSGTSSYPR.N 9.078125 * cheesemansli15-03.0513.0513.2 2.8551 0.378 1282.41 8738.7 1 77.3% 1 R.KETSTSLADNSK.K 6.5625 * cheesemansli15-06.1901.1901.2 3.9114 0.1269 2384.34 11069.0 1 47.5% 2 K.KGSSFNEGNNEKEPNAAEWFK.I 4.8945312 * cheesemansli15-06.1964.1964.1 1.9518 0.153 1049.69 4548.9 15 71.4% 2 K.NYFHDLLK.Y 7.328125 * cheesemansli15-06.1973.1973.2 2.6588 0.1613 1050.15 5034.7 1 92.9% 1 K.NYFHDLLK.Y 7.328125 * cheesemansli15-03.0876.0876.2 3.9161 0.2884 1466.66 6601.5 2 70.8% 2 K.YINNNDATLANDK.D 4.4570312 * cheesemansli15-05.1842.1842.2 4.6267 0.4485 2440.12 8873.1 1 35.7% 22 K.YINNNDATLANDKDGDLAFLIK.Q 4.4023438 * cheesemansli15-05.0258.0258.3 3.5004 0.2699 2440.45 3810.2 1 33.3% 1 K.YINNNDATLANDKDGDLAFLIK.Q 4.4023438 * cheesemansli15-03.2099.2099.1 1.8882 0.1035 991.73 7344.3 2 68.8% 1 K.DGDLAFLIK.Q 4.4570312 * cheesemansli15-03.1953.1953.2 2.7335 0.2971 991.9 9131.1 3 81.2% 2 K.DGDLAFLIK.Q 4.4570312 * cheesemansli15-04.3087.3087.2 4.0274 0.5006 2181.7 9648.8 1 64.7% 8 K.QMPAEELDMTFNNWVNLK.V 4.142578 * cheesemansli15-02.3485.3485.2 3.3447 0.3674 2707.5 7482.9 1 45.5% 2 R.DYYTATNFIETLEDDNQLIDIAK.K 3.8007812 * cheesemansli15-04.3005.3005.2 3.1844 0.4105 2264.73 8027.1 1 44.7% 1 Y.TATNFIETLEDDNQLIDIAK.K 3.8554688 * cheesemansli15-04.2961.2961.2 5.5458 0.4146 2093.18 7755.9 1 70.6% 5 A.TNFIETLEDDNQLIDIAK.K 3.8554688 * cheesemansli15-04.2858.2858.2 5.561 0.4231 1994.79 8499.9 1 75.0% 8 T.NFIETLEDDNQLIDIAK.K 3.8554688 * cheesemansli15-03.1800.1800.2 2.8693 0.3406 1731.05 7997.2 1 64.3% 1 F.IETLEDDNQLIDIAK.K 3.8554688 * cheesemansli15-03.1268.1268.2 2.7864 0.1485 1273.95 7565.2 1 80.0% 2 L.EDDNQLIDIAK.K 3.9648438 ORFP:YJR045C 19 29 37.9% 654 70628 5.6 U SSC1, Chr X from 519330-521294, reverse complement * cheesemansli15-04.2637.2637.2 5.3162 0.518 2262.19 7947.3 1 54.5% 5 K.VQGSVIGIDLGTTNSAVAIMEGK.V 4.4570312 * cheesemansli15-04.1518.1518.2 2.7644 0.3049 1532.76 4316.4 1 57.7% 1 R.QAVVNPENTLFATK.R 6.5625 cheesemansli15-03.0726.0726.2 2.8615 0.3004 994.41 4000.4 1 92.9% 1 R.FEDAEVQR.D 4.142578 cheesemansli15-05.0536.0536.2 2.7531 0.3609 1242.54 5344.0 1 85.0% 1 K.HSNGDAWVEAR.G 5.6328125 * cheesemansli15-04.1915.1915.2 3.7887 0.4472 1680.34 6131.6 1 73.3% 2 R.GQTYSPAQIGGFVLNK.M 8.8046875 cheesemansli15-03.1661.1661.1 2.0808 0.1817 1098.73 4362.0 21 56.2% 1 V.PAYFNDSQR.Q 6.5625 * cheesemansli15-04.1748.1748.2 3.1361 0.3428 1646.71 6722.6 1 70.0% 1 R.VVNEPTAAALAYGLEK.S 4.4570312 cheesemansli15-03.1712.1712.2 3.3681 0.3919 1742.7 9707.2 1 53.3% 3 K.STNGDTHLGGEDFDIY.L 3.9648438 * cheesemansli15-05.1990.1990.2 2.7971 0.2792 2125.1 9435.8 1 41.7% 1 K.STNGDTHLGGEDFDIYLLR.E 4.4023438 * cheesemansli15-03.0998.0998.2 2.5627 0.1775 1264.65 6296.6 1 70.0% 1 K.TETGIDLENDR.M 3.9648438 * cheesemansli15-04.2757.2757.2 4.0228 0.4018 2007.92 8089.4 1 57.9% 2 K.DAGLSTSDISEVLLVGGMSR.M 4.142578 * cheesemansli15-04.2746.2746.3 3.5385 0.3728 2008.64 6293.3 1 32.9% 1 K.DAGLSTSDISEVLLVGGMSR.M 4.142578 * cheesemansli15-04.3625.3625.2 3.6468 0.4258 1876.66 11248.6 1 58.8% 2 L.DVTPLSLGIETLGGVFTR.L 4.4570312 * cheesemansli15-04.2502.2502.2 3.9036 0.4571 2712.42 7730.4 1 40.0% 1 K.DSSITVAGSSGLSENEIEQMVNDAEK.F 3.8007812 * cheesemansli15-03.0967.0967.2 3.1298 0.2751 1419.74 7286.9 1 66.7% 1 K.ADQLANDTENSLK.E 4.142578 * cheesemansli15-03.0927.0927.2 3.3482 0.3388 1402.45 4105.2 3 66.7% 2 R.VQGGEEVNAEELK.T 3.9648438 * cheesemansli15-03.0948.0948.1 2.3726 0.1592 1174.7 9733.2 7 60.0% 1 Q.GGEEVNAEELK.T 3.9648438 * cheesemansli15-03.0762.0762.2 2.8201 0.2399 1154.57 6907.6 8 72.2% 1 K.TEELQTSSMK.L 4.4570312 * cheesemansli15-03.0496.0496.2 4.9129 0.4753 2251.87 8605.4 1 50.0% 1 K.NDSNNNNNNNGNNAESGETKQ.- 4.142578 ORFP:YGL123W 5 6 33.1% 254 27450 10.4 U RPS2, Chr VII from 277618-278382 * cheesemansli15-06.3338.3338.2 2.5753 0.2131 1742.13 9737.8 2 42.9% 1 K.ITTIEEIFLHSLPVK.E 5.6328125 * cheesemansli15-06.1864.1864.2 3.2013 0.4175 1730.67 5777.0 1 63.3% 1 R.GYWGTNLGQPHSLATK.T 8.8046875 * cheesemansli15-04.1883.1883.2 4.652 0.5043 1837.15 6572.0 1 62.5% 1 K.LLQLAGVEDVYTQSNGK.T 4.4570312 * cheesemansli15-05.3313.3313.3 5.2685 0.461 3906.84 7181.5 1 24.3% 2 F.VAIGNTYGFLTPNLWAEQPLPVSPLDIYSDEASAQK.K 3.9648438 * cheesemansli15-04.2706.2706.2 3.6175 0.3972 2559.57 4431.1 1 40.9% 1 N.LWAEQPLPVSPLDIYSDEASAQK.K 3.9648438 KERATIN03 18 42 32.7% 593 59519 5.2 U no description * cheesemansli15-04.1522.1522.2 4.2866 0.5369 1709.42 8335.6 1 55.6% 3 K.GSLGGGFSSGGFSGGSFSR.G 10.0625 * cheesemansli15-03.1000.1000.2 3.83 0.3878 1382.6 8945.8 1 77.3% 3 R.ALEESNYELEGK.I 3.9648438 * cheesemansli15-06.0414.0414.2 2.5053 0.4783 1119.25 8337.0 1 83.3% 1 K.HGNSHQGEPR.D 7.4101562 * cheesemansli15-06.2704.2704.2 5.0681 0.4542 2368.77 11339.7 1 55.0% 4 K.NQILNLTTDNANILLQIDNAR.L 4.4570312 * cheesemansli15-06.2709.2709.3 5.4237 0.3613 2368.97 8193.9 1 46.2% 3 K.NQILNLTTDNANILLQIDNAR.L 4.4570312 * cheesemansli15-04.2135.2135.2 2.5634 0.3248 1899.66 11798.1 1 50.0% 1 L.NLTTDNANILLQIDNAR.L 4.4570312 * cheesemansli15-04.1807.1807.2 3.0249 0.2235 1673.78 8784.6 2 53.6% 1 L.TTDNANILLQIDNAR.L 4.4570312 * cheesemansli15-04.1380.1380.2 3.212 0.2073 1032.04 3219.4 2 87.5% 1 R.VLDELTLTK.A 4.4570312 * cheesemansli15-06.3545.3545.2 2.99 0.3283 2098.04 8618.6 1 58.8% 1 K.ADLEMQIESLTEELAYLK.K 3.8554688 * cheesemansli15-05.2846.2846.3 3.5382 0.2869 2873.77 6516.5 1 26.9% 1 R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S 4.142578 * cheesemansli15-05.2550.2550.2 2.7388 0.2509 1613.91 4729.1 1 60.7% 2 N.AAPGVDLTQLLNNMR.S 6.5625 * cheesemansli15-03.1380.1380.2 3.0841 0.1357 1110.29 5306.4 1 87.5% 3 K.DAEAWFNEK.S 4.142578 * cheesemansli15-03.1413.1413.1 1.8684 0.1944 1110.56 6745.9 2 62.5% 2 K.DAEAWFNEK.S 4.142578 * cheesemansli15-03.1512.1512.2 4.432 0.4123 1999.69 5659.2 1 68.8% 9 K.ELTTEIDNNIEQISSYK.S 3.9648438 * cheesemansli15-04.2773.2773.2 3.5766 0.3824 1798.75 10567.2 1 60.0% 4 R.NVQALEIELQSQLALK.Q 4.4570312 * cheesemansli15-04.1237.1237.2 3.2623 0.4571 1391.85 5667.8 1 66.7% 1 K.QSLEASLAETEGR.Y 4.142578 * cheesemansli15-04.2018.2018.2 2.5958 0.2206 1629.5 6756.7 2 61.5% 1 Q.AQISALEEQLQQIR.A 4.4570312 * cheesemansli15-04.0934.0934.2 2.8625 0.1762 1165.8 7580.8 7 81.2% 1 R.LENEIQTYR.S 4.4570312 ORFP:YPL209C 9 33 32.4% 367 42946 9.7 U IPL1, Chr XVI from 156489-157592, reverse complement * cheesemansli15-04.1166.1166.1 2.1218 0.164 958.61 5335.8 1 71.4% 1 K.FLDMESSK.I 4.4570312 * cheesemansli15-06.1558.1558.1 2.1668 0.1288 1126.65 3499.4 2 66.7% 1 Q.TSLNHPNLTK.S 9.078125 * cheesemansli15-06.3228.3228.2 2.9209 0.3625 1866.06 10454.6 1 64.3% 1 R.VYLLMEYLVNGEMYK.L 4.4570312 * cheesemansli15-06.3758.3758.2 2.6368 0.1933 2351.12 8300.3 1 37.5% 1 R.LHGPFNDILASDYIYQIANAL.D 4.4570312 * cheesemansli15-04.2653.2653.2 2.7331 0.3423 1258.9 7287.4 1 80.0% 1 R.DIKPENILIGF.N 4.4570312 * cheesemansli15-05.3261.3261.2 3.8877 0.2609 1828.43 5729.6 1 63.3% 17 R.DIKPENILIGFNNVIK.L 6.5625 * cheesemansli15-04.2461.2461.2 3.3476 0.3133 1759.33 5187.3 1 67.9% 7 K.LTDFGWSIINPPENR.R 4.4570312 * cheesemansli15-06.3256.3256.2 2.5025 0.2869 2079.24 5977.7 1 52.8% 1 L.GVLAFELLTGAPPFEEEMK.D 3.9648438 * cheesemansli15-04.2002.2002.2 3.9849 0.3307 1673.88 5116.3 1 67.9% 3 K.MPSNISQDAQDLILK.L 4.4570312 KERATIN13 17 31 29.2% 643 65494 6.6 U no description * cheesemansli15-04.2310.2310.2 4.4851 0.3477 1966.97 4875.8 1 62.5% 2 N.QSLLQPLNVEIDPEIQK.V 4.142578 * cheesemansli15-04.1884.1884.1 2.5721 0.1913 1384.68 5924.1 2 59.1% 1 K.SLNNQFASFIDK.V 6.5625 * cheesemansli15-04.1878.1878.2 3.475 0.3495 1384.83 7265.0 1 77.3% 2 K.SLNNQFASFIDK.V 6.5625 cheesemansli15-04.1142.1142.2 4.4716 0.1702 1476.41 10615.0 1 90.9% 2 R.FLEQQNQVLQTK.W 6.5625 * cheesemansli15-04.1808.1808.2 3.5945 0.3721 1476.6 8065.6 1 77.3% 1 K.WELLQQVDTSTR.T 4.4570312 * cheesemansli15-04.1210.1210.2 2.7336 0.1768 1266.47 7461.5 1 75.0% 1 R.TNAENEFVTIK.K 4.4570312 * cheesemansli15-03.0828.0828.1 1.963 0.1844 999.64 5068.4 5 62.5% 1 K.DVDGAYMTK.V 4.4570312 * cheesemansli15-04.1629.1629.2 4.1412 0.467 1964.29 7340.5 1 68.8% 1 M.QTQISETNVILSMDNNR.Q 4.4570312 * cheesemansli15-03.0861.0861.2 2.9595 0.3214 1127.07 7200.2 1 83.3% 2 K.AEAESLYQSK.Y 4.4570312 * cheesemansli15-04.1164.1164.2 3.479 0.2673 1180.69 7507.6 1 94.4% 1 K.YEELQITAGR.H 4.4570312 * cheesemansli15-04.1280.1280.2 3.5853 0.4141 1718.41 8176.1 1 75.0% 1 K.QISNLQQSISDAEQR.G 4.4570312 * cheesemansli15-03.1525.1525.2 4.6623 0.2989 1358.53 7453.4 1 90.9% 10 K.LNDLEDALQQAK.E 4.142578 * cheesemansli15-03.1545.1545.1 2.4209 0.2927 1359.27 6185.6 1 54.5% 1 K.LNDLEDALQQAK.E 4.142578 * cheesemansli15-03.1119.1119.2 2.5836 0.2289 1142.04 7556.3 1 81.2% 2 R.DYQELMNTK.L 4.4570312 * cheesemansli15-03.1115.1115.1 2.5551 0.1201 1142.71 5043.0 2 75.0% 1 R.DYQELMNTK.L 4.4570312 * cheesemansli15-05.1997.1997.2 3.5332 0.2689 1278.74 8154.7 1 85.0% 1 K.LALDLEIATYR.T 4.4570312 * cheesemansli15-04.0746.0746.2 4.6851 0.2934 2385.69 7441.2 1 31.7% 1 R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G 8.640625 KERATIN02 12 28 29.1% 622 61987 5.2 U no description * cheesemansli15-04.0574.0574.2 2.8336 0.3752 1236.4 7703.4 1 62.5% 1 R.FSSSSGYGGGSSR.V 9.078125 * cheesemansli15-05.1771.1771.2 3.4675 0.4556 2706.01 9523.8 1 33.9% 2 R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G 8.8046875 * cheesemansli15-05.0900.0900.2 3.061 0.3903 952.46 4456.8 1 70.0% 1 S.SLGGGFGGGSR.G 10.0625 * cheesemansli15-03.1098.1098.2 4.8495 0.4325 1587.63 8995.8 1 80.8% 4 K.VQALEEANNDLENK.I 3.9648438 * cheesemansli15-04.2942.2942.2 3.5501 0.3561 2291.09 12326.6 1 44.4% 3 K.NYSPYYNTIDDLKDQIVDL.T 3.9648438 * cheesemansli15-06.2790.2790.2 2.8245 0.2174 2281.86 11768.5 5 34.2% 1 Y.YNTIDDLKDQIVDLTVGNNK.T 4.4023438 * cheesemansli15-03.1148.1148.2 2.9683 0.3292 1159.12 4668.0 1 90.0% 1 R.QGVDADINGLR.Q 4.4570312 * cheesemansli15-04.2638.2638.2 3.3151 0.3756 2350.75 11548.3 1 39.5% 1 K.DIENQYETQITQIEHEVSSS.G 3.8554688 * cheesemansli15-04.4655.4655.3 4.399 0.3934 3267.91 7635.8 1 24.1% 10 K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E 4.1152344 * cheesemansli15-06.2482.2482.2 3.1381 0.3675 1839.18 9920.7 1 66.7% 1 R.HGVQELEIELQSQLSK.K 4.716797 * cheesemansli15-03.0853.0853.2 3.4761 0.4165 1510.97 7373.1 1 60.7% 2 L.LEGGQEDFESSGAGK.I 3.9648438 * cheesemansli15-06.1454.1454.2 4.1993 0.2234 2093.23 10789.0 1 44.0% 1 R.GSRGGSGGSYGGGGSGGGYGGGSGSR.G 10.0078125 NRL_1MCOH 13 82 26.9% 428 46852 8.9 U owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain H... * cheesemansli15-05.1437.1437.2 2.7098 0.2703 1187.71 3701.3 1 63.6% 2 K.GPSVFPLAPSSK.S 9.078125 * cheesemansli15-05.1410.1410.1 2.6973 0.3316 1188.82 5756.3 1 63.6% 4 K.GPSVFPLAPSSK.S 9.078125 * cheesemansli15-03.2253.2253.2 2.7354 0.3381 2264.98 7767.9 1 40.0% 1 K.DYFPQPVTVSWNSGALTSGVH.T 5.359375 * cheesemansli15-05.3386.3386.3 3.5183 0.4084 3729.35 8543.6 1 19.1% 1 K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSL.S 5.359375 * cheesemansli15-04.3441.3441.3 5.2769 0.501 3818.16 10028.1 1 23.6% 4 K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS.S 5.359375 * cheesemansli15-06.2962.2962.2 4.0016 0.4388 2594.98 8229.7 1 29.2% 1 S.WNSGALTSGVHTFPAVLQSSGLYSL.S 7.328125 * cheesemansli15-06.2837.2837.2 3.5009 0.4326 2680.48 8737.2 1 32.0% 1 S.WNSGALTSGVHTFPAVLQSSGLYSLS.S 7.328125 * cheesemansli15-05.2439.2439.2 2.916 0.3114 2383.13 10347.9 2 30.4% 1 N.SGALTSGVHTFPAVLQSSGLYSLS.S 7.328125 * cheesemansli15-06.1885.1885.2 3.4867 0.3443 1679.01 8016.7 1 69.2% 29 K.FNWYVDGVQVHNAK.T 7.328125 * cheesemansli15-06.2920.2920.2 4.6412 0.4805 1809.62 9109.0 1 73.3% 21 R.VVSVLTVLHQNWLDGK.E 7.328125 * cheesemansli15-04.2226.2226.2 5.0528 0.4231 2545.54 9025.6 1 52.4% 12 K.GFYPSDIAVEWESNGQPENNYK.T 3.9648438 * cheesemansli15-03.1294.1294.2 5.0271 0.4657 1995.02 5898.5 1 65.6% 4 S.DIAVEWESNGQPENNYK.T 3.9648438 * cheesemansli15-04.2296.2296.2 4.1262 0.4246 1673.17 9306.4 1 75.0% 1 T.PPVLDSDGSFFLYSK.L 4.4570312 ORFP:YNL178W 4 7 26.7% 240 26503 9.4 U RPS3, Chr XIV from 302677-303399 * cheesemansli15-03.1127.1127.2 3.498 0.4355 1438.73 9026.3 1 75.0% 1 R.ELAEEGYSGVEVR.V 3.9648438 * cheesemansli15-06.2634.2634.2 3.1796 0.273 2425.33 8627.2 1 40.5% 2 K.FADGFLIHSGQPVNDFIDTATR.H 4.716797 * cheesemansli15-04.1773.1773.2 2.9016 0.2838 1267.62 4046.5 1 72.7% 1 K.ALPDAVTIIEPK.E 4.4570312 * cheesemansli15-03.1039.1039.2 2.7342 0.2184 1906.35 4568.9 1 59.4% 3 K.DYRPAEETEAQAEPVEA.- 3.8007812 gi|67568|pir||ELPG 16 28 25.6% 266 28821 8.1 U pancreatic elastase (EC 3.4.21.36) I precursor - pig * cheesemansli15-05.1593.1593.2 2.9576 0.4088 1479.48 5096.9 1 77.3% 2 R.NSWPSQISLQYR.S 9.078125 * cheesemansli15-04.1688.1688.1 1.9556 0.1742 1091.81 4789.8 18 62.5% 1 W.PSQISLQYR.S 9.078125 * cheesemansli15-04.0951.0951.2 3.7289 0.4976 1807.82 10780.5 1 60.0% 1 H.NLNQNDGTEQYVGVQK.I 4.4570312 * cheesemansli15-03.0818.0818.2 2.8154 0.2002 1225.4 6629.0 1 75.0% 1 N.DGTEQYVGVQK.I 4.4570312 * cheesemansli15-06.2040.2040.1 1.8882 0.1858 1269.23 3962.2 1 55.6% 1 G.VQKIVVHPYW.N 8.8046875 * cheesemansli15-06.2082.2082.2 2.6398 0.277 1269.32 7175.2 1 72.2% 2 G.VQKIVVHPYW.N 8.8046875 * cheesemansli15-06.1949.1949.2 3.8197 0.4429 1886.11 9732.2 1 56.7% 3 G.VQKIVVHPYWNTDDVA.A 5.6328125 * cheesemansli15-04.2251.2251.2 3.1441 0.2553 2121.98 9370.2 1 47.2% 3 K.IVVHPYWNTDDVAAGYDIA.L 4.142578 * cheesemansli15-06.2974.2974.2 2.6892 0.2261 2346.81 9219.5 1 40.0% 2 K.IVVHPYWNTDDVAAGYDIALL.R 4.142578 * cheesemansli15-06.2496.2496.2 3.9022 0.4188 2503.13 11306.7 1 40.5% 4 K.IVVHPYWNTDDVAAGYDIALLR.L 4.716797 * cheesemansli15-05.2161.2161.2 3.7996 0.4189 1959.28 7302.2 1 67.6% 2 R.LAQSVTLNSYVQLGVLPR.A 9.078125 * cheesemansli15-05.1835.1835.2 3.0788 0.1445 1460.75 8289.7 1 58.3% 1 V.TLNSYVQLGVLPR.A 9.078125 * cheesemansli15-05.1713.1713.2 2.8865 0.3237 1358.89 10749.8 2 59.1% 1 T.LNSYVQLGVLPR.A 9.078125 * cheesemansli15-04.1602.1602.2 3.5761 0.3809 1247.45 8918.0 1 85.0% 1 L.NSYVQLGVLPR.A 9.078125 * cheesemansli15-04.1601.1601.2 3.7114 0.4437 1131.87 7162.8 1 88.9% 2 N.SYVQLGVLPR.A 9.078125 * cheesemansli15-05.1246.1246.2 2.5543 0.177 882.62 4252.0 9 85.7% 1 Y.VQLGVLPR.A 10.0625 KERATIN22 12 18 21.1% 645 65865 8.0 U no description * cheesemansli15-05.1723.1723.2 3.2308 0.4208 1839.4 7348.7 1 50.0% 1 K.SISISVAGGGGGFGAAGGFGGR.G 10.0625 * cheesemansli15-05.1115.1115.2 3.6649 0.5205 1352.01 6437.3 1 71.9% 1 S.VAGGGGGFGAAGGFGGR.G 10.0625 * cheesemansli15-05.1995.1995.3 3.7044 0.3607 2833.23 11116.0 1 30.0% 1 R.GGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F 10.0625 * cheesemansli15-05.1786.1786.2 3.8821 0.3776 2400.15 10090.9 1 43.1% 1 G.GSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F 10.0625 * cheesemansli15-05.1783.1783.3 4.5308 0.389 2401.84 8837.4 1 43.1% 1 G.GSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F 10.0625 cheesemansli15-04.1142.1142.2 4.4716 0.1702 1476.41 10615.0 1 90.9% 2 R.FLEQQNQVLQTK.W 6.5625 * cheesemansli15-04.1996.1996.2 4.0801 0.44 2130.88 7552.5 1 52.9% 1 R.TSQNSELNNMQDLVEDYK.K 3.9648438 * cheesemansli15-04.2606.2606.2 4.2314 0.3263 1463.29 6123.6 1 81.8% 4 K.VDLLNQEIEFLK.V 4.142578 cheesemansli15-05.2487.2487.1 2.4368 0.104 1329.66 5950.3 58 50.0% 1 R.NLDLDSIIAEVK.A 4.142578 cheesemansli15-04.2650.2650.2 4.2365 0.3755 1330.5 5798.6 1 86.4% 2 R.NLDLDSIIAEVK.A 4.142578 * cheesemansli15-03.1180.1180.2 3.6383 0.3099 1330.58 6011.9 1 81.8% 2 K.NVQDAIADAEQR.G 4.142578 * cheesemansli15-04.1589.1589.2 4.3227 0.3178 1372.6 7415.8 1 77.3% 1 K.LNDLEEALQQAK.E 4.142578 ORFP:YBL075C 12 53 18.0% 649 70547 5.2 U SSA3, Chr II from 84494-86443, reverse complement cheesemansli15-04.0864.0864.1 1.8188 0.1593 794.41 3601.4 2 66.7% 1 H.NTVFDAK.R 6.5625 cheesemansli15-03.1584.1584.2 3.7201 0.3744 1896.27 5341.3 1 65.6% 16 T.VNDAVVTVPAYFNDSQR.Q 4.4570312 cheesemansli15-03.1661.1661.1 2.0808 0.1817 1098.73 4362.0 21 56.2% 1 V.PAYFNDSQR.Q 6.5625 cheesemansli15-05.1521.1521.2 3.9693 0.4802 1788.98 5234.5 1 59.4% 10 R.IINEPTAAAIAYGLDKK.G 6.5625 cheesemansli15-04.1449.1449.2 3.543 0.3717 1676.87 6418.5 1 60.0% 8 K.ATAGDTHLGGEDFDNR.L 4.4023438 * cheesemansli15-04.1460.1460.2 2.805 0.3004 1243.48 2963.4 2 80.0% 1 R.STLEPVEKVLK.D 6.5625 cheesemansli15-02.3249.3249.2 3.1592 0.2776 1512.12 7468.1 1 69.2% 1 K.TQDLLLLDVAPLSL.G 3.5546875 cheesemansli15-04.2537.2537.2 3.8563 0.4816 1937.54 5870.9 1 56.2% 1 T.YADNQPGVLIQVFEGER.T 4.142578 cheesemansli15-05.2203.2203.2 3.7043 0.3921 1772.59 7515.1 1 66.7% 9 Y.ADNQPGVLIQVFEGER.T 4.142578 cheesemansli15-03.0923.0923.1 1.9579 0.0958 773.28 6025.9 32 75.0% 1 K.DNNLLGK.F 6.5625 cheesemansli15-04.1532.1532.2 3.1751 0.2809 1184.58 4072.8 1 85.0% 3 K.FELSGIPPAPR.G 6.5625 cheesemansli15-04.1544.1544.1 1.8821 0.0939 1184.84 4615.7 14 50.0% 1 K.FELSGIPPAPR.G 6.5625 NRL_1MCOL 3 6 15.7% 216 22815 6.3 U owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain L... * cheesemansli15-04.1736.1736.2 2.8802 0.3011 2044.32 3387.2 1 47.2% 2 K.ANPTVTLFPPSSEELQANK.A 4.4570312 * cheesemansli15-04.2048.2048.2 3.446 0.3266 1746.05 6382.4 1 64.3% 3 K.YAASSYLSLTPEQWK.S 6.5625 * cheesemansli15-04.1840.1840.2 2.5762 0.2917 1352.48 5947.4 1 80.0% 1 S.SYLSLTPEQWK.S 6.5625 GR78_YEAST 8 20 14.4% 682 74468 4.9 U owl|P16474| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... ORFP:YJL034W 8 20 14.4% 682 74468 4.9 U KAR2, Chr X from 381023-383071 cheesemansli15-04.1415.1415.2 3.1964 0.2436 1514.1 4535.2 1 62.5% 1 R.ITPSYVAFTDDER.L 4.142578 cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 cheesemansli15-04.1746.1746.2 3.5562 0.1586 1200.56 6369.9 1 81.8% 11 K.DAGTIAGLNVLR.I 6.5625 cheesemansli15-04.2927.2927.2 3.9176 0.4571 2025.17 7483.8 1 61.8% 1 R.IEIDSFVDGIDLSETLTR.A 3.8554688 cheesemansli15-03.1464.1464.2 3.2496 0.3773 1345.72 7230.5 1 83.3% 3 K.DVDDIVLVGGSTR.I 4.142578 cheesemansli15-05.1942.1942.2 2.9626 0.3575 1632.11 11609.2 1 63.3% 1 L.TLGIETTGGVMTPLIK.R 6.5625 cheesemansli15-03.0923.0923.1 1.9579 0.0958 773.28 6025.9 32 75.0% 1 K.DNNLLGK.F 6.5625 cheesemansli15-03.0852.0852.2 2.5047 0.2926 1108.39 5520.4 1 72.2% 1 K.SESITITNDK.G 4.4570312 ORFP:YPL106C 5 7 14.3% 693 77367 5.2 U SSE1, Chr XVI from 350189-352270, reverse complement * cheesemansli15-06.1860.1860.2 3.5006 0.401 1929.09 5914.7 1 56.7% 1 R.IIGLDYHHPDFEQESK.H 4.8398438 * cheesemansli15-06.2789.2789.2 2.7772 0.2112 1797.99 10568.7 1 57.1% 1 R.DFDLAITEHFADEFK.T 4.251953 * cheesemansli15-04.2795.2795.2 3.1442 0.2998 1838.58 8966.5 1 53.1% 3 K.LSAEEVDFVEIIGGTTR.I 3.9648438 * cheesemansli15-04.2762.2762.3 3.7023 0.2696 4039.57 5377.9 1 22.2% 1 A.ASYTDITQLPPNTPEQIANWEITGVQLPEGQDSVPVK.L 3.8554688 * cheesemansli15-04.2198.2198.2 3.4898 0.4445 1704.25 5372.8 1 76.9% 1 K.AEEWLYDEGFDSIK.A 3.8554688 ORFP:YDR450W 2 2 11.6% 146 17038 10.3 U RPS18A, Chr IV from 1359912-1359958,1360394-1360787 ORFP:YML026C 2 2 11.6% 146 17038 10.3 U RPS18B, Chr XIII from 222987-223033,223435-223828, reverse complement cheesemansli15-06.1425.1425.2 3.1801 0.3952 1082.53 8266.8 1 93.8% 1 K.KADVDLHKR.A 8.8046875 cheesemansli15-06.2217.2217.1 2.1407 0.1683 1017.88 3554.3 1 78.6% 1 K.IPAWFLNR.Q 10.0625 ORFP:YEL030W 6 8 11.5% 644 70085 6.3 U ECM10, Chr V from 94644-96578 cheesemansli15-03.0726.0726.2 2.8615 0.3004 994.41 4000.4 1 92.9% 1 R.FEDAEVQR.D 4.142578 cheesemansli15-05.0536.0536.2 2.7531 0.3609 1242.54 5344.0 1 85.0% 1 K.HSNGDAWVEAR.N 5.6328125 cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 * cheesemansli15-06.1857.1857.2 4.5737 0.3948 1788.72 5404.0 1 68.8% 1 L.RVVNEPTAAALAYGLDK.S 6.5625 cheesemansli15-03.1712.1712.2 3.3681 0.3919 1742.7 9707.2 1 53.3% 3 K.STNGDTHLGGEDFDIY.L 3.9648438 * cheesemansli15-03.0967.0967.2 3.1298 0.2751 1419.74 7286.9 1 66.7% 1 K.ADQLANDTENSIK.E 4.142578 ORFP:YNL064C 3 3 11.2% 409 44671 6.3 U YDJ1, Chr XIV from 505864-507093, reverse complement * cheesemansli15-05.3298.3298.2 3.0683 0.0842 2215.34 8056.4 3 42.5% 1 D.GDDLVYEAEIDLLTAIAGGEF.A 3.2265625 * cheesemansli15-06.2492.2492.2 3.4718 0.4428 2001.45 9406.0 1 50.0% 1 L.TAIAGGEFALEHVSGDWLK.V 4.716797 * cheesemansli15-05.1651.1651.2 2.5525 0.3273 1394.77 4211.4 1 53.8% 1 K.VGIVPGEVIAPGMR.K 6.5625 KERATIN20 2 2 6.6% 483 53748 5.4 U no description * cheesemansli15-05.2422.2422.2 2.6205 0.1273 2302.07 8989.8 36 27.5% 1 Q.SQISDTSVVLSMDNSRSLDMD.S 3.9648438 cheesemansli15-05.1997.1997.2 3.5332 0.2689 1278.74 8154.7 1 85.0% 1 K.LALDIEIATYR.K 4.4570312 GR78_SCHPO 4 14 6.3% 663 73081 4.9 U owl|P36604| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 * cheesemansli15-04.1746.1746.2 3.5562 0.1586 1200.56 6369.9 1 81.8% 11 K.DAGTIAGLNVIR.I 6.5625 * cheesemansli15-04.1441.1441.2 3.3708 0.1174 1463.72 6705.4 1 69.2% 1 K.SEIDDIVLVGGSTR.I 4.142578 cheesemansli15-03.0923.0923.1 1.9579 0.0958 773.28 6025.9 32 75.0% 1 K.DNNLLGK.F 6.5625 INT-STD1 2 3 4.6% 607 69271 6.1 U BSA * cheesemansli15-04.2825.2825.2 4.4517 0.4112 1569.73 8378.7 1 79.2% 2 K.DAFLGSFLYEYSR.R 4.4570312 * cheesemansli15-06.1802.1802.2 2.7515 0.4275 1640.83 8074.3 1 50.0% 1 R.KVPQVSTPTLVEVSR.S 9.078125 GR78_LYCES 2 11 3.9% 666 73235 5.2 U owl|P49118| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... cheesemansli15-04.1804.1804.1 2.4508 0.2121 1083.76 3349.8 9 62.5% 1 V.PAYFNDAQR.Q 6.5625 cheesemansli15-05.1521.1521.2 3.9693 0.4802 1788.98 5234.5 1 59.4% 10 R.IINEPTAAAIAYGLDKK.G 6.5625 ORFP:YOL122C 1 50 3.7% 575 63264 6.6 U SMF1, Chr XV from 89691-91418, reverse complement * cheesemansli15-05.4301.4301.2 3.7887 0.166 2211.84 7468.5 7 42.5% 50 V.DAGASNQFSLLCIILLSNFIA.I 3.7460938 KERATIN17 3 4 3.6% 590 62461 8.1 U no description KERATIN21 3 4 5.9% 357 39219 5.2 U no description KERATIN18 3 4 3.7% 562 59822 8.0 U no description cheesemansli15-03.0856.0856.1 2.0453 0.2973 1026.65 6675.3 1 75.0% 1 K.DVDAAYMNK.V 4.4570312 cheesemansli15-05.2487.2487.1 2.4368 0.104 1329.66 5950.3 58 50.0% 1 R.NLDLDSIIAEVK.A 4.142578 cheesemansli15-04.2650.2650.2 4.2365 0.3755 1330.5 5798.6 1 86.4% 2 R.NLDLDSIIAEVK.A 4.142578 ORFP:YJR041C 2 3 3.3% 1174 135117 6.4 U YJR041C, Chr X from 509931-513455, reverse complement * cheesemansli15-05.4314.4314.2 2.8638 0.1257 2227.24 7356.2 486 33.3% 1 K.AFFAINDYLIVNFSVEESF.Q 3.4726562 * cheesemansli15-05.2333.2333.2 3.8644 0.1423 2227.46 8459.5 18 39.5% 2 Q.LSITTQFSLNIKKSLQPGIH.A 10.035156 ORFP:YGL092W 2 3 3.1% 1317 145661 5.7 U NUP145, Chr VII from 337904-341857 * cheesemansli15-05.4765.4765.2 2.7893 0.1524 2301.62 7719.4 1 35.7% 2 G.LFGNSNNNNITSTTQNGGLFGK.P 9.078125 * cheesemansli15-04.2557.2557.2 3.134 0.0843 2085.18 10731.8 8 38.9% 1 H.GLNVPAIITLENVYPVDKK.T 6.5625 KERATIN15 2 6 2.1% 629 64511 6.5 U no description * cheesemansli15-04.2685.2685.1 2.282 0.1932 1302.84 10205.9 4 54.2% 2 R.SLDLDSIIAEVGA.Q 3.4726562 * cheesemansli15-04.2645.2645.2 4.4222 0.2942 1303.73 6586.1 1 79.2% 4 R.SLDLDSIIAEVGA.Q 3.4726562 ORFP:YKR027W 1 13 1.8% 765 88044 5.7 U YKR027W, Chr XI from 491002-493299 * cheesemansli15-04.2981.2981.2 3.1275 0.0847 1483.79 7322.9 26 53.8% 13 G.LTLLRVSDLPDAVA.C 4.4570312 ORFP:YML103C 1 14 1.2% 1655 188576 5.6 U NUP188, Chr XIII from 62582-67549, reverse complement * cheesemansli15-05.3765.3765.2 3.5461 0.0898 2227.37 10332.9 1 42.1% 14 R.PLLRSVLVLLELVSSGDRFI.E 6.5625 Proteins Peptide IDs Copies Unfiltered 5809 22797 39658 Redundant 38 483 1749 Nonredundant 34 373 1375 Classification Nonredundant Proteins Redundant Proteins Unclassified 0 0