DTASelect v2.1-test
/data/1/catclw/Projects/Jamie/061509_alpha/combined
/garibaldi/people-b/applications/yates/dbase/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
 --trypstat --modstat --cmax 4 --mass --fp 1.0 --pr 0.9 -tpr 0.90 -p 1 -tDM 10.0 -tX 2.0 -tS 3.5
true	Use criteria
0.9	Minimum peptide probability
1.0	Peptide global false discovery rate
0.0	Minimum protein probability
1.0	Protein false discovery rate
1	Minimum charge state
16	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
true	Define delta mass with respect to nearest isotope
Include	Modified peptide inclusion
Any	Tryptic status requirement
false	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
1	Minimum peptides per locus

Locus	Sequence Count	Spectrum Count	Sequence Coverage	Length	MolWt	pI	Validation Status	Descriptive Name
Unique	FileName	XCorr	DeltCN	Prob%	Conf%	M+H+	CalcM+H+	TotalIntensity	SpR	ZScore	IonProportion	Redundancy	Sequence
YIL002W-A	2	15	60.9%	69	7729	4.7	U	YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" 
*	Alpha_a_2_41.14983.14983.4	5.5873	0.3997	98.5	100.0	3086.6023	3084.606	10084.3	1	7.165	26.8	12	M.TRDTPEDVSTAGAKDILDVLNLLKGGEEK.I
*	Alpha_b_1_13.05119.05119.3	3.6842	0.1308	99.2	100.0	2066.0232	2063.0212	6807.6	6	3.723	33.8	3	K.GGEEKISEVELKLDEMEK.K
YKL042W	22	94	45.5%	363	42271	7.9	U	SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" 
*	Alpha_a_1_13.05742.05742.3	4.5342	0.2406	99.8	100.0	3515.47	3513.473	5378.3	1	5.098	25.9	2	R.LYDDYYNIPYQYSNPT*PMNRDYNDVGSR.I
*	Alpha_a_2_10.04123.04123.3	3.3329	0.0194	96.1	100.0	2519.1902	2517.1814	8612.1	14	3.801	29.8	2	K.VKDPMVDDDPVSENYDQINVPK.H
*	Alpha_a_1_10.04397.04397.2	2.5942	0.1743	99.4	100.0	2598.1497	2597.1477	5049.7	34	3.789	35.7	1	K.VKDPMVDDDPVS*ENYDQINVPK.H
*	Alpha_b_1_14.05307.05307.3	4.1835	0.0248	97.3	99.6	2601.1382	2597.1477	6701.6	1	2.993	38.1	7	K.VKDPMVDDDPVS*ENYDQINVPK.H
*	Alpha_b_1_29.10352.10352.3	4.1408	0.2232	99.5	100.0	2928.2842	2924.3008	7579.1	7	4.348	30.2	4	R.SEDGNNDRMS*PLPSPLNT*ILPINNR.L
*	Alpha_b_1_29.10522.10522.3	4.3397	0.3291	99.9	100.0	2926.2864	2924.3008	8849.5	1	5.246	32.3	25	R.SEDGNNDRMS*PLPS*PLNTILPINNR.L
*	Alpha_b_1_19.07194.07194.2	4.0504	0.3623	99.8	100.0	2037.8202	2036.8229	5363.6	1	6.669	62.5	2	K.VNPS*DDDIMMYESAELK.R
*	Alpha_a_2_26.09548.09548.3	4.3321	0.2802	99.9	100.0	3273.5356	3270.538	4322.4	4	5.527	25.9	4	R.KLS*LNNQLQELQSMMDGDDNIKLDNVSK.H
*	Alpha_b_1_10.03910.03910.3	5.2242	0.0305	98.4	100.0	3184.1646	3182.175	5223.5	5	4.093	32.0	1	R.HSSQSS*RDY*SPSSDACLECSNDLYEK.N
*	Alpha_b_1_10.03914.03914.3	5.2074	0.0131	98.2	99.6	3186.1736	3182.175	4760.9	1	3.569	34.0	1	R.HSS*QSSRDYS*PSSDACLECSNDLYEK.N
*	Alpha_b_1_10.03922.03922.3	5.2783	0.0302	98.0	99.6	3186.1606	3182.175	5457.5	1	4.178	34.0	1	R.HSSQS*SRDYS*PSSDACLECSNDLYEK.N
*	Alpha_b_1_10.03928.03928.3	5.1735	0.0225	98.4	100.0	3182.1624	3182.175	5188.0	5	4.465	35.0	2	R.HSS*QSSRDY*SPSSDACLECSNDLYEK.N
*	Alpha_b_1_11.04328.04328.2	5.0112	0.4143	100.0	100.0	2254.889	2252.8958	6563.9	1	7.734	61.1	5	R.DYSPSSDACLECSNDLYEK.N
*	Alpha_b_1_13.04934.04934.2	4.5881	0.5072	99.9	100.0	2333.8574	2332.862	8314.1	1	7.113	55.6	5	R.DYS*PSSDACLECSNDLYEK.N
*	Alpha_b_1_13.04944.04944.2	4.7162	0.53	99.9	100.0	2333.8525	2332.862	8447.5	1	7.47	52.8	3	R.DY*SPSSDACLECSNDLYEK.N
*	Alpha_b_1_14.05343.05343.2	3.3381	0.0435	98.6	99.4	2413.8237	2412.8284	6077.1	1	5.711	44.4	1	R.DYSPS*S*DACLECSNDLYEK.N
*	Alpha_b_1_14.05439.05439.2	3.8475	0.1479	99.5	100.0	2413.8145	2412.8284	6257.2	1	5.789	50.0	3	R.DYS*PSS*DACLECSNDLYEK.N
*	Alpha_b_1_15.05599.05599.2	4.1549	0.1374	99.4	100.0	2414.8135	2412.8284	6696.9	1	6.524	44.4	3	R.DY*SPSS*DACLECSNDLYEK.N
*	Alpha_b_1_9.03568.03568.2	4.051	0.4208	99.8	100.0	2227.988	2226.9849	4783.1	2	6.436	55.6	18	R.VKPENNMSETFAT*PTPNNR.-
*	Alpha_a_2_6.02830.02830.3	2.9221	0.112	98.5	100.0	2227.9858	2226.9849	9077.0	16	3.529	31.9	1	R.VKPENNMSETFAT*PTPNNR.-
*	Alpha_b_1_9.03687.03687.2	3.3891	0.2535	99.6	100.0	2307.9443	2306.9512	4312.5	1	5.213	52.8	2	R.VKPENNMS*ETFATPT*PNNR.-
*	Alpha_b_1_9.03699.03699.2	3.181	0.0755	98.7	99.4	2309.9507	2306.9512	4610.4	1	3.517	50.0	1	R.VKPENNMSET*FATPT*PNNR.-
YDR382W	1	11	43.6%	110	11050	4.1	U	RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" 
*	Alpha_b_1_24.08578.08578.3	4.0041	0.1803	99.3	100.0	4689.9253	4686.9463	5729.0	1	3.842	19.1	11	K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES*DDDMGFGLFD.-
YDR322C-A	1	3	34.4%	96	10875	6.1	U	TIM11 SGDID:S000007255, Chr IV from 1112288-1111998, reverse complement, Verified ORF, "Subunit e of mitochondrial F1F0-ATPase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; essential for the dimeric state of ATP synthase" 
*	Alpha_a_2_41.14676.14676.3	4.1279	0.2789	100.0	100.0	3619.7827	3617.7969	5180.6	1	5.493	26.6	3	K.DVPANASFNLEDPNIDFERVILNAVESLKEAST.-
YPL124W	17	80	32.8%	253	29280	9.5	U	SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" 
*	Alpha_b_1_7.03021.03021.2	1.9156	0.0858	96.4	99.5	1218.5387	1216.5358	5613.2	1	3.637	93.8	2	K.KFQDDT*LNR.V
*	Alpha_b_1_8.03302.03302.2	1.9139	0.0809	96.4	99.5	1088.4371	1088.4408	5636.9	133	4.141	71.4	1	K.FQDDT*LNR.V
*	Alpha_b_1_9.03489.03489.2	2.4639	0.2302	99.5	100.0	1344.6104	1343.6104	2411.3	6	4.736	66.7	4	K.FQDDT*LNRVR.K
*	Alpha_b_1_8.03385.03385.3	2.5283	0.1015	97.8	99.6	2033.9331	2032.9335	3851.3	11	3.993	34.4	1	K.LREENFSSNT*SELGNKK.H
*	Alpha_b_1_9.03548.03548.2	2.7832	0.0426	96.9	99.5	2112.8918	2112.9	3858.7	1	4.93	46.9	1	K.LREENFSS*NTS*ELGNKK.H
*	Alpha_b_1_9.03519.03519.3	2.3086	0.081	96.9	99.6	1490.7137	1490.7185	4671.4	29	3.065	39.6	1	R.MSSPLHRLSPT*GK.S
*	Alpha_b_1_9.03508.03508.2	1.8928	0.1364	97.5	99.5	1570.6793	1570.6848	3730.5	79	3.942	50.0	1	R.MSS*PLHRLS*PTGK.S
*	Alpha_b_1_8.03249.03249.2	2.0156	0.2831	99.5	100.0	1378.7417	1378.7454	3319.5	132	5.316	55.0	1	R.KVKS*PLDDKLR.R
*	Alpha_b_1_8.03303.03303.2	1.7046	0.0749	94.4	99.5	1250.6466	1250.6504	3047.2	1	4.155	77.8	1	K.VKS*PLDDKLR.R
*	Alpha_b_1_10.03887.03887.3	3.0705	0.078	97.7	99.6	2819.2139	2816.2134	4692.9	1	3.502	31.8	1	K.EGAREDRSS*QIHIENEST*EDILK.I
*	Alpha_b_1_10.03971.03971.3	3.3117	0.1027	98.5	100.0	2324.04	2323.045	6330.7	2	4.131	34.7	3	R.EDRSSQIHIENEST*EDILK.I
*	Alpha_a_1_7.03456.03456.2	3.4662	0.2705	99.7	100.0	1923.8752	1922.8743	5278.4	1	4.93	56.7	1	R.SSQIHIENES*TEDILK.I
*	Alpha_b_1_11.04135.04135.2	5.1385	0.3515	99.8	100.0	1925.8728	1922.8743	4995.5	1	6.648	63.3	14	R.SSQIHIENEST*EDILK.I
*	Alpha_a_2_26.09569.09569.3	7.246	0.449	100.0	100.0	2812.3171	2808.3088	5819.6	1	7.131	38.0	21	R.SSQIHIENES*TEDILKILSSSFHN.-
*	Alpha_a_2_27.09794.09794.3	6.7042	0.3881	100.0	100.0	2810.3018	2808.3088	8779.6	2	6.537	40.2	24	R.SSQIHIENEST*EDILKILSSSFHN.-
*	Alpha_b_1_25.09037.09037.3	4.7371	0.1008	99.2	100.0	2889.2715	2888.275	5459.5	1	3.959	34.8	2	R.SSQIHIENEST*EDILKILSSS*FHN.-
*	Alpha_b_1_25.09055.09055.3	3.673	0.1128	98.6	100.0	2890.2686	2888.275	4452.2	2	3.645	35.9	1	R.SSQIHIENES*TEDILKILSSS*FHN.-
YIL149C	31	143	28.2%	1679	195140	6.0	U	MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" 
*	Alpha_b_1_10.03869.03869.5	3.8881	0.1067	95.4	99.2	3506.7703	3499.7874	4876.9	339	3.335	21.6	2	K.LKQLLDESSEQKNTAKEELNGLKDQLNEER.S
*	Alpha_a_2_16.06171.06171.4	4.8234	0.3305	99.8	100.0	3254.488	3252.504	7994.1	5	5.327	24.4	8	R.VKEEYDIWQSRDQGNDSLNDDLNKENK.L
*	Alpha_b_1_8.03376.03376.2	4.7644	0.3189	99.9	100.0	1821.8129	1818.81	5489.5	1	5.906	70.0	6	R.DQGNDSLNDDLNKENK.L
*	Alpha_a_2_11.04312.04312.3	3.5152	0.2958	100.0	100.0	2201.072	2201.0793	5614.0	11	5.735	34.7	1	R.DQGNDSLNDDLNKENKLLR.R
*	Alpha_a_2_21.07696.07696.4	5.5849	0.2993	99.8	100.0	3044.4036	3041.4116	8123.1	3	5.066	27.3	14	R.AIEKNDDNSCRNPEHTDVIDELIDTK.L
*	Alpha_a_2_17.06352.06352.3	2.9472	0.0689	96.7	100.0	2602.1572	2600.1528	8368.6	9	3.366	28.6	1	K.NDDNSCRNPEHTDVIDELIDTK.L
*	Alpha_b_1_14.05477.05477.3	4.117	0.3284	99.9	100.0	3022.3545	3020.3662	7157.1	1	5.898	28.8	3	R.LQNIVMDCTKEEEATMTTSAVS*PTVGK.L
*	Alpha_a_1_22.08575.08575.3	3.8195	0.262	99.8	100.0	3725.7512	3723.7566	5499.7	226	4.964	18.8	1	R.LQNIVMDCTKEEEATMTTSAVS*PTVGKLFSDIK.V
*	Alpha_b_1_37.13053.13053.4	3.5226	0.1184	97.0	100.0	3061.603	3059.609	7126.1	2	3.803	27.1	1	K.FQLQNQLEDFILELEHKTPELISFK.E
*	Alpha_a_2_45.16412.16412.5	3.521	0.1863	99.0	100.0	3347.7524	3344.7524	6710.6	83	4.198	24.5	4	K.FQLQNQLEDFILELEHKTPELISFKER.T
*	Alpha_a_2_10.04213.04213.2	3.0557	0.3286	99.9	100.0	1321.7278	1320.7257	8299.5	1	6.414	63.6	1	R.STELLETVSLTK.R
*	Alpha_a_1_19.07607.07607.3	5.1231	0.3653	100.0	100.0	2934.5583	2933.5596	7197.1	1	6.808	32.0	8	K.LLLLNTSAIQETAS*PLSQDELISLRK.I
*	Alpha_b_1_13.04924.04924.2	5.529	0.4472	100.0	100.0	2246.1272	2245.1306	8710.1	1	8.298	60.5	7	K.ILESSNIVNENDSQAIITER.L
*	Alpha_b_1_14.05297.05297.2	5.0619	0.3018	99.7	100.0	2327.0947	2325.097	10663.3	1	6.06	57.9	4	K.ILESSNIVNENDS*QAIITER.L
*	Alpha_a_2_9.03696.03696.2	3.5799	0.3331	99.9	100.0	1550.801	1548.7904	6786.1	1	5.688	70.8	2	R.LVEFSNVNELQEK.N
*	Alpha_a_2_12.04601.04601.2	3.1942	0.2317	99.4	100.0	1342.7188	1342.7213	7864.8	1	5.651	72.7	6	K.DAIIELENINAK.M
*	Alpha_a_2_40.14307.14307.4	7.2705	0.3994	100.0	100.0	3235.7205	3232.7158	9235.8	1	7.464	38.3	39	K.SLLTELSNKETTIEKLSSEIENLDKELR.K
*	Alpha_a_2_46.17027.17027.5	3.3819	0.1221	96.6	100.0	3361.7986	3360.8108	3743.5	1	3.575	26.3	4	K.SLLTELSNKETTIEKLSSEIENLDKELRK.T
*	Alpha_a_2_47.17566.17566.6	3.636	0.0534	96.3	100.0	6374.2754	6372.2734	8484.5	94	2.82	13.3	1	K.FLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK.T
*	Alpha_a_2_34.12427.12427.3	5.3084	0.3456	100.0	100.0	3251.6318	3247.6328	7209.6	1	6.478	30.4	9	K.DANSQIQAYEEIISSNENALIELKNELAK.T
*	Alpha_b_1_8.03261.03261.2	2.4167	0.332	99.7	100.0	1221.5393	1221.5416	5516.0	1	6.237	80.0	2	K.DAADCQAELTK.T
*	Alpha_b_1_24.08902.08902.3	3.9407	0.1232	98.3	100.0	3179.612	3177.6274	8026.1	1	4.16	31.7	3	K.ADYERELISNIEQTESLRVENSVLIEK.V
*	Alpha_b_1_23.08550.08550.5	4.2146	0.1248	97.4	100.0	4777.348	4771.3657	9999.7	282	3.125	15.2	1	K.ADYERELISNIEQTESLRVENSVLIEKVDDTAANNGDKDHLK.L
*	Alpha_b_1_19.07148.07148.3	2.8959	0.0547	95.3	100.0	2544.352	2543.3562	7814.6	219	3.506	23.8	2	R.ELISNIEQTESLRVENSVLIEK.V
*	Alpha_a_2_14.05432.05432.3	2.4467	0.1541	97.2	100.0	1703.914	1702.9221	6181.9	3	3.843	41.1	1	K.DIEKLTNEISDLKGK.L
*	Alpha_b_1_8.03110.03110.2	3.5135	0.2484	99.5	100.0	1359.7775	1357.7798	7840.7	1	5.103	85.0	3	R.IKEAEENLKKR.I
*	Alpha_b_1_15.05716.05716.3	3.4274	0.143	98.4	100.0	3471.5225	3470.5496	3899.4	79	4.002	22.6	1	K.GSGEDAEEELWNS*PSKGNSERPSAVAGFINQK.N
*	Alpha_a_2_9.03596.03596.3	4.0939	0.2834	99.8	100.0	2987.324	2985.349	9021.0	1	5.152	31.5	3	K.NDVSFNDSQSMVTNKENNIVDSSAAGNK.A
*	Alpha_a_1_11.04803.04803.2	4.7309	0.4972	100.0	100.0	2053.9807	2052.9832	8384.9	1	7.786	55.3	3	K.AAINFSNVTDLTNNSTDGAK.I
*	Alpha_a_2_11.04464.04464.2	3.1239	0.3614	97.0	96.2	1981.9373	1981.9462	8396.8	1	6.41	44.4	1	A.AINFSNVTDLTNNSTDGAK.I
*	Alpha_a_2_10.04200.04200.2	2.9134	0.3927	97.0	95.7	1911.9069	1910.909	7773.2	1	6.174	41.2	1	A.INFSNVTDLTNNSTDGAK.I
YNL225C	16	31	27.2%	581	67400	6.0	U	CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" 
*	Alpha_b_1_18.06555.06555.3	3.9627	0.1564	99.1	100.0	3377.5183	3375.493	5428.7	92	4.358	18.8	2	R.LDS*PVS*ENGEIKDGEPIPQNWLNENHVGK.S
*	Alpha_a_2_7.02946.02946.2	2.6607	0.3005	99.6	100.0	2244.847	2244.8574	5532.7	12	5.012	35.3	2	R.DSYEENKS*PSMDQMNYAR.N
*	Alpha_b_1_9.03707.03707.2	3.7253	0.3617	99.7	100.0	2245.8525	2244.8574	5013.3	1	6.113	47.1	4	R.DSYEENKSPS*MDQMNYAR.N
*	Alpha_a_1_5.02425.02425.2	2.1823	0.2323	99.5	100.0	1813.8116	1813.8116	4503.3	16	4.718	42.9	1	R.NTSYQES*PGLQERPK.N
*	Alpha_b_1_10.03787.03787.2	1.9029	0.0458	93.1	99.5	1893.772	1893.778	5696.3	138	3.294	39.3	1	R.NT*SYQES*PGLQERPK.N
*	Alpha_b_1_8.03384.03384.2	3.3255	0.2333	99.5	100.0	1895.8109	1893.778	4101.1	24	4.655	50.0	4	R.NTS*YQES*PGLQERPK.N
*	Alpha_b_1_8.03266.03266.2	2.7648	0.1877	99.4	100.0	2265.9543	2264.9585	3932.1	28	4.234	38.2	1	R.NTSY*QES*PGLQERPKNEK.D
*	Alpha_b_1_11.04182.04182.2	1.8916	0.0459	94.2	99.5	1363.6194	1362.6201	5320.4	1	3.359	65.0	1	K.DVPNFIHST*PR.E
*	Alpha_b_1_9.03714.03714.2	2.269	0.0859	97.1	99.5	1908.863	1907.8647	4723.3	109	3.047	43.3	1	K.DVPNFIHST*PRENSSK.H
*	Alpha_b_1_9.03680.03680.3	2.21	0.0485	93.5	98.9	2530.1047	2529.1072	5298.5	192	3.568	27.6	2	K.DVPNFIHST*PRENS*SKHFTR.A
*	Alpha_a_2_6.02849.02849.3	2.9791	0.1881	97.9	100.0	2889.2334	2885.249	6230.0	1	3.778	26.9	1	R.ANEQASAQPTDEHTSPDISIEDCNGAK.I
*	Alpha_b_1_9.03647.03647.3	3.846	0.1588	98.8	100.0	2966.1912	2965.2153	10287.2	110	4.5	22.1	2	R.ANEQASAQPTDEHTSPDIS*IEDCNGAK.I
*	Alpha_b_1_9.03677.03677.3	4.8307	0.3691	100.0	100.0	3046.1714	3045.1816	7957.9	1	5.988	28.8	5	R.ANEQASAQPTDEHTS*PDIS*IEDCNGAK.I
*	Alpha_b_1_9.03692.03692.3	4.6826	0.2161	99.7	100.0	3048.175	3045.1816	7188.5	3	5.05	26.0	1	R.ANEQASAQPTDEHT*SPDIS*IEDCNGAK.I
*	Alpha_b_1_39.13864.13864.4	5.2612	0.2891	99.8	100.0	3882.9802	3880.9895	7369.0	1	5.56	24.0	2	R.KAELFEIPIGILFFDLYDSEENSSKLDHILQEK.Y
*	Alpha_b_1_9.03719.03719.2	2.5928	0.1323	91.8	100.0	1530.7363	1530.7394	7556.2	1	4.219	66.7	1	K.AEAEDLRNELENK.K
YBR109C	1	8	25.2%	147	16135	4.3	U	CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" 
*	Alpha_b_1_40.14009.14009.3	5.6436	0.4408	100.0	100.0	4108.916	4106.932	6534.5	1	8.34	29.9	8	R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q
YBL003C	1	1	25.0%	132	13989	10.7	U	HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " 
YDR225W	1	1	25.0%	132	13989	10.7	U	HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " 
	Alpha_b_1_52.18446.18446.4	3.0722	0.1745	98.3	100.0	3434.8745	3430.8582	9036.7	2	3.685	21.4	1	R.IGSGAPVYLTAVLEYLAAEILELAGNAARDNKK.T
YLR421C	3	10	20.5%	156	17902	4.5	U	RPN13 SGDID:S000004413, Chr XII from 965556-965086, reverse complement, Verified ORF, "Subunit of the 19S regulatory particle of the 26S proteasome lid" 
*	Alpha_a_1_9.04076.04076.3	3.152	0.0893	97.8	99.6	3653.4956	3650.4993	6447.0	78	2.89	19.4	1	K.MIGVLNNS*SESDEEESNDEKQKAQDVDVSMQD.-
*	Alpha_a_2_10.04005.04005.3	3.2896	0.1089	98.2	99.6	3651.485	3650.4993	8563.0	18	4.06	21.0	2	K.MIGVLNNSS*ESDEEESNDEKQKAQDVDVSMQD.-
*	Alpha_b_1_13.04962.04962.3	5.266	0.443	100.0	100.0	3651.4878	3650.4993	8540.3	1	6.603	25.0	7	K.MIGVLNNSSES*DEEESNDEKQKAQDVDVSMQD.-
YPL255W	7	16	19.0%	385	45384	6.5	U	BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" 
*	Alpha_b_1_20.07268.07268.2	2.3348	0.1897	99.3	100.0	1462.6335	1461.633	7487.8	1	4.313	58.3	1	K.DALFGTDISPS*MK.Y
*	Alpha_a_2_9.03581.03581.2	1.5899	0.1197	95.1	99.5	1539.654	1539.6587	6958.4	79	3.755	45.8	1	R.SNS*WSGLDSTLHR.K
*	Alpha_b_1_12.04574.04574.2	1.8672	0.1601	98.3	99.4	1539.653	1539.6587	5093.6	382	4.208	41.7	1	R.S*NSWSGLDSTLHR.K
*	Alpha_a_1_7.03130.03130.2	2.1541	0.2156	99.5	100.0	1274.6892	1272.6824	4113.4	3	5.18	65.0	6	R.SLRS*PAPIVPR.E
*	Alpha_b_1_10.03868.03868.3	2.396	0.1469	98.0	99.6	2136.008	2135.013	4771.7	320	3.706	30.9	1	K.VLDQTISHEAELAT*SRER.L
*	Alpha_b_1_10.03972.03972.2	3.1676	0.2947	99.6	100.0	2086.8176	2085.8274	4492.0	1	4.464	50.0	2	R.NNERKDTS*AGS*NIFSTGQ.-
*	Alpha_b_1_12.04721.04721.2	3.0669	0.3105	99.6	100.0	1573.5898	1572.5978	4713.8	2	5.774	57.7	4	R.KDTS*AGS*NIFSTGQ.-
YGR282C	7	13	18.5%	313	34119	4.5	U	BGL2 SGDID:S000003514, Chr VII from 1058730-1057789, reverse complement, Verified ORF, "Endo-beta-1,3-glucanase, major protein of the cell wall, involved in cell wall maintenance" 
*	Alpha_a_2_9.03687.03687.2	3.1293	0.2646	99.4	100.0	2277.0186	2274.019	7661.4	3	5.689	36.8	1	K.NNDGTCKSTSDYETELQALK.S
*	Alpha_a_2_9.03678.03678.3	4.2967	0.3659	100.0	100.0	2277.0186	2274.019	7875.9	1	6.145	36.8	4	K.NNDGTCKSTSDYETELQALK.S
*	Alpha_a_2_17.06442.06442.4	3.456	0.0417	91.6	99.3	3044.3953	3040.4053	8513.4	1	3.098	26.3	1	K.NNDGTCKSTSDYETELQALKSYTSTVK.V
*	Alpha_a_2_10.03949.03949.2	4.2863	0.2461	99.8	100.0	1486.7114	1484.7115	7917.1	1	5.83	75.0	3	K.STSDYETELQALK.S
*	Alpha_a_2_8.03417.03417.2	4.1403	0.3583	100.0	100.0	1788.9067	1788.9086	7780.5	1	7.06	56.7	2	R.NDLTASQLSDKINDVR.S
*	Alpha_a_2_8.03474.03474.3	3.301	0.1968	99.6	100.0	1790.9099	1788.9086	6149.8	8	4.36	38.3	1	R.NDLTASQLSDKINDVR.S
*	Alpha_a_2_10.04148.04148.2	3.1213	0.3712	97.0	95.8	1751.7384	1751.7429	6987.6	1	6.506	50.0	1	F.TSSDNLKYSLDCDFS.-
YNL178W	3	17	16.7%	240	26503	9.4	U	RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" 
*	Alpha_a_2_21.07775.07775.4	4.7044	0.4306	99.9	100.0	4347.1836	4345.1973	4699.5	1	6.164	23.5	10	K.ALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA.-
*	Alpha_b_1_21.07562.07562.3	3.938	0.2008	99.4	100.0	4428.1475	4425.1636	5273.8	103	4.403	16.7	2	K.ALPDAVTIIEPKEEEPILAPS*VKDYRPAEETEAQAEPVEA.-
*	Alpha_a_2_7.02935.02935.2	3.6631	0.2855	99.8	100.0	1905.8485	1904.8508	4447.5	1	5.544	53.1	5	K.DYRPAEETEAQAEPVEA.-
YPL059W	1	1	16.7%	150	16931	4.9	U	GRX5 SGDID:S000005980, Chr XVI from 444576-445028, Verified ORF, "Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; mitochondrial matrix protein involved in the synthesis/assembly of iron-sulfur centers; monothiol glutaredoxin subfamily member along with Grx3p and Grx4p" 
*	Alpha_a_2_30.10979.10979.3	3.0889	0.1049	97.6	100.0	2801.3372	2800.3372	9497.9	1	3.946	31.2	1	R.SGELADLLEEAQALVPEEEEETKDR.-
contaminant_NRL_1IKFL	2	4	15.4%	214	23527	6.5	U	owl|| Immunoglobulin igg1-kappa antibody fragment fab complexed With... 
contaminant_S68241	2	4	15.1%	218	23846	6.7	U	owl|S68241| immunoglobulin light chain (Mab13-1) - mouse (fragment) 
	Alpha_b_1_18.06688.06688.4	4.206	0.3103	99.6	100.0	3803.711	3799.7239	7012.0	2	4.751	21.4	3	R.QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYER.H
	Alpha_b_1_13.05111.05111.2	4.0197	0.2248	99.4	100.0	2230.0017	2227.007	7934.4	1	5.373	50.0	1	K.DSTYSMSSTLTLTKDEYER.H
YOR373W	22	47	15.2%	851	94104	7.0	U	NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" 
*	Alpha_b_1_17.06405.06405.3	4.0652	0.2503	99.8	100.0	3527.566	3526.5686	5516.0	13	5.03	23.3	2	K.VFKEYES*NHDFQDSNFTSQVVEPAISDSVK.K
*	Alpha_b_1_10.03823.03823.2	2.2096	0.1736	99.0	99.4	2098.9192	2098.9229	4857.5	20	3.962	38.9	1	K.VPS*GFSGTTATSHQEAQWK.Q
*	Alpha_b_1_19.06946.06946.3	4.734	0.2444	99.8	100.0	3284.4326	3282.449	8932.9	3	4.929	27.9	2	K.KIQEEENLANSDDT*PLDT*PKFNDLFTK.N
*	Alpha_b_1_10.03966.03966.2	4.9605	0.4236	99.8	100.0	2209.9453	2208.9543	7839.7	1	7.343	63.9	2	K.IQEEENLANSDDT*PLDTPK.F
*	Alpha_b_1_11.04262.04262.2	3.5586	0.3308	99.7	100.0	2208.9426	2208.9543	8654.1	1	5.945	50.0	1	K.IQEEENLANS*DDTPLDTPK.F
*	Alpha_b_1_11.04301.04301.2	4.7191	0.3612	99.8	100.0	2289.9172	2288.9207	5319.1	1	6.925	47.2	2	K.IQEEENLANS*DDT*PLDTPK.F
*	Alpha_b_1_23.08263.08263.3	4.4341	0.3969	100.0	100.0	3157.342	3154.354	9401.6	1	5.959	28.0	3	K.IQEEENLANSDDT*PLDT*PKFNDLFTK.N
*	Alpha_b_1_19.07078.07078.3	3.3953	0.1759	98.6	100.0	3584.5342	3582.5671	5917.6	1	4.46	22.4	1	K.IQEEENLANSDDT*PLDT*PKFNDLFTKNGTR.A
*	Alpha_b_1_16.06131.06131.3	5.5093	0.3341	100.0	100.0	3167.488	3164.5034	7719.9	1	5.869	31.7	3	K.LKTFPAERVEDITSISEVNTS*FNETEK.Q
*	Alpha_b_1_16.06134.06134.3	5.0576	0.3771	100.0	100.0	3167.5073	3164.5034	7777.1	1	6.259	26.0	1	K.LKTFPAERVEDITSISEVNT*SFNETEK.Q
*	Alpha_b_1_18.06607.06607.3	5.1964	0.0848	99.1	100.0	3247.467	3244.4697	4395.9	9	3.918	28.8	4	K.LKTFPAERVEDITSIS*EVNT*SFNETEK.Q
*	Alpha_b_1_18.06611.06611.3	5.596	0.1314	99.5	100.0	3247.462	3244.4697	4790.9	3	4.372	31.7	1	K.LKTFPAERVEDITSIS*EVNTS*FNETEK.Q
*	Alpha_b_1_18.06767.06767.3	4.6163	0.2714	99.9	100.0	2926.3215	2923.3245	6687.0	1	5.337	33.3	4	K.TFPAERVEDITSISEVNTS*FNETEK.Q
*	Alpha_b_1_19.07031.07031.3	4.2735	0.2547	99.8	100.0	2924.318	2923.3245	7035.2	1	4.776	29.2	1	K.TFPAERVEDITS*ISEVNTSFNETEK.Q
*	Alpha_b_1_20.07379.07379.3	5.6906	0.2061	99.9	100.0	3006.2974	3003.2908	7049.0	1	5.627	31.2	2	K.TFPAERVEDITSIS*EVNTS*FNETEK.Q
*	Alpha_b_1_20.07505.07505.3	4.6267	0.0837	98.9	100.0	3004.2827	3003.2908	8448.7	2	4.727	30.2	4	K.TFPAERVEDITS*ISEVNTS*FNETEK.Q
*	Alpha_b_1_20.07522.07522.3	4.4157	0.1992	99.6	100.0	3004.2783	3003.2908	7106.2	2	4.53	32.3	1	K.TFPAERVEDITS*ISEVNT*SFNETEK.Q
*	Alpha_b_1_15.05751.05751.2	4.7293	0.3882	99.8	100.0	2224.974	2221.9749	7457.1	1	6.439	63.9	4	R.VEDITSISEVNTS*FNETEK.Q
*	Alpha_b_1_18.06623.06623.2	3.0474	0.1439	99.0	99.4	2302.9282	2301.9412	7847.5	12	4.807	36.1	1	R.VEDITS*ISEVNTS*FNETEK.Q
*	Alpha_b_1_18.06715.06715.2	4.1073	0.382	99.8	100.0	2304.9368	2301.9412	6640.2	1	6.215	41.7	3	R.VEDITSIS*EVNTS*FNETEK.Q
*	Alpha_b_1_35.12452.12452.3	4.201	0.1753	99.5	100.0	3207.5757	3205.5762	7320.2	1	4.921	27.8	1	R.VEDITSISEVNTS*FNETEKQLISILTSK.L
*	Alpha_b_1_11.04114.04114.2	3.1098	0.3011	99.6	100.0	1552.6047	1550.6046	4676.4	1	6.398	70.8	3	K.LSGS*PSYDSDWEK.I
YJR009C	3	5	14.8%	332	35847	7.0	U	TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " 
	Alpha_a_1_23.08993.08993.3	3.3033	0.228	99.4	100.0	2595.2983	2593.2637	4727.7	2	4.497	27.2	1	K.VINDAFGIEEGLMTTVHSMTATQK.T
	Alpha_a_2_11.04351.04351.2	3.4574	0.3146	99.9	100.0	1753.7858	1752.7864	8895.9	1	7.112	61.5	2	K.LVSWYDNEYGYSTR.V
	Alpha_a_2_7.03208.03208.2	3.2102	0.2372	99.5	100.0	1180.6731	1179.6732	8066.4	1	5.479	80.0	2	R.VVDLVEHVAKA.-
YGR192C	3	6	14.8%	332	35747	7.0	U	TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " 
*	Alpha_a_1_25.09806.09806.3	2.6085	0.1205	97.2	100.0	2576.3079	2575.3071	6118.4	8	3.679	28.3	2	K.VINDAFGIEEGLMTTVHSLTATQK.T
	Alpha_a_2_11.04351.04351.2	3.4574	0.3146	99.9	100.0	1753.7858	1752.7864	8895.9	1	7.112	61.5	2	K.LVSWYDNEYGYSTR.V
	Alpha_a_2_7.03208.03208.2	3.2102	0.2372	99.5	100.0	1180.6731	1179.6732	8066.4	1	5.479	80.0	2	R.VVDLVEHVAKA.-
YMR142C	2	7	14.6%	199	22525	11.1	U	RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" 
*	Alpha_a_2_20.07358.07358.3	4.9806	0.2019	99.8	100.0	2956.484	2953.4902	6938.2	4	6.243	25.9	5	R.DGKAPEAEQVLSAAATFPIAQPATDVEAR.A
	Alpha_a_2_8.03528.03528.2	3.7679	0.1996	93.9	97.4	1588.8153	1586.8173	7584.9	6	5.365	57.1	2	A.ATFPIAQPATDVEAR.A
YLR457C	2	3	14.1%	319	37354	10.2	U	NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" 
*	Alpha_b_1_19.06897.06897.2	3.561	0.3457	99.7	100.0	2025.9521	2024.9576	6981.2	2	5.862	50.0	2	R.ILEDLLDSS*NIHPSYTK.S
*	Alpha_b_1_17.06365.06365.3	3.1736	0.2167	99.2	100.0	3420.452	3418.4631	8712.1	1	3.862	23.1	1	K.TYNRDGNIPEMQPLQENIS*PACPT*PPYR.S
YLR061W	1	3	14.0%	121	13693	6.2	U	RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" 
*	Alpha_a_2_14.05396.05396.2	2.9942	0.203	99.0	100.0	2074.8577	2071.8503	7400.3	1	3.921	43.8	3	R.LAFYQVTPEEDEEEDEE.-
YDR418W	2	3	13.9%	165	17823	9.4	U	RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
YEL054C	2	3	13.9%	165	17823	9.4	U	RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
	Alpha_a_2_21.07709.07709.3	3.1875	0.2921	99.9	100.0	2564.2598	2563.2676	3789.9	9	5.092	31.8	1	R.VDFKNPHDIIEGINAGEIEIPEN.-
	Alpha_a_2_17.06388.06388.2	3.9185	0.3235	99.9	100.0	2075.0142	2074.0088	4174.7	2	5.487	47.2	2	K.NPHDIIEGINAGEIEIPEN.-
YDR356W	15	23	13.7%	944	111782	7.1	U	SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" 
*	Alpha_a_1_6.02795.02795.3	3.3588	0.2778	99.7	100.0	2919.3481	2918.3528	7695.0	11	4.602	25.0	2	R.NTTQTQVVSPT*KVPNANNGDENEGPVK.K
*	Alpha_a_1_6.02812.02812.3	3.9148	0.1122	98.7	100.0	2921.3484	2918.3528	7529.3	9	4.319	26.0	1	R.NT*TQTQVVSPTKVPNANNGDENEGPVK.K
*	Alpha_a_2_6.02822.02822.3	3.0685	0.0764	94.8	99.3	2922.3328	2918.3528	7570.7	1	3.153	28.8	1	R.NTTQTQVVS*PTKVPNANNGDENEGPVK.K
*	Alpha_b_1_9.03553.03553.3	4.1744	0.2174	99.6	100.0	2919.3445	2918.3528	8122.0	9	5.554	26.0	1	R.NTT*QTQVVSPTKVPNANNGDENEGPVK.K
*	Alpha_a_1_7.03353.03353.3	2.6903	0.1201	96.4	99.6	3205.5266	3202.5488	5238.1	147	3.439	20.5	1	R.NTTQT*QVVSPTKVPNANNGDENEGPVKKR.Q
*	Alpha_b_1_8.03285.03285.2	1.9395	0.0588	94.9	99.5	1642.7509	1642.7544	4630.8	1	3.653	62.5	1	R.QRRSIDDT*IDSTR.L
*	Alpha_a_1_22.08744.08744.3	3.7706	0.1408	99.1	100.0	3044.3423	3043.3455	9518.8	7	5.128	24.0	1	R.SIDDT*IDSTRLFSEASQFDDSFPEIK.A
*	Alpha_a_1_22.08750.08750.3	4.3805	0.0854	98.9	100.0	3045.3481	3043.3455	8929.1	43	5.023	25.0	3	R.S*IDDTIDSTRLFSEASQFDDSFPEIK.A
*	Alpha_a_2_27.10019.10019.3	4.5435	0.1349	99.3	100.0	3046.3435	3043.3455	8531.7	1	5.111	29.0	4	R.SIDDTIDST*RLFSEASQFDDSFPEIK.A
*	Alpha_b_1_20.07450.07450.2	2.9735	0.2789	99.6	100.0	1940.8256	1939.836	9566.1	3	5.1	40.0	1	R.LFSEASQFDDS*FPEIK.A
*	Alpha_b_1_12.04445.04445.3	4.1789	0.2641	100.0	100.0	2670.2146	2669.2173	7096.4	1	5.271	33.3	1	K.EKNDTLNNYDTLEEETDDLKNR.L
*	Alpha_a_2_10.03987.03987.2	4.8072	0.2818	99.9	100.0	1831.9062	1830.908	8099.5	1	7.568	70.0	1	K.DQVLELENNSDVQSLK.L
*	Alpha_b_1_11.04099.04099.3	4.6626	0.3023	100.0	100.0	2399.133	2398.151	7513.7	1	5.647	43.4	1	K.DIEEYKESAKDSEDKIEELK.I
*	Alpha_b_1_11.04102.04102.4	4.5553	0.2703	99.6	100.0	2399.1401	2398.151	8672.0	1	5.781	38.6	3	K.DIEEYKESAKDSEDKIEELK.I
*	Alpha_b_1_7.02943.02943.2	2.4585	0.2005	98.1	100.0	1590.7572	1588.7561	4977.3	1	4.432	66.7	1	R.EKEELNENSNNIR.I
YJR053W	5	8	13.6%	574	66087	5.9	U	BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" 
*	Alpha_b_1_37.13247.13247.4	4.7688	0.3037	92.0	100.0	5581.353	5576.3584	6449.4	3	5.114	16.0	1	K.IDNDTQDTILAKFS*S*DDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F
*	Alpha_b_1_35.12427.12427.3	5.8294	0.5865	100.0	100.0	4169.7144	4168.7305	5649.1	1	8.456	23.6	2	K.FSS*DDEGDFLTGFEELEGEAIDETISSNDKESADHPR.F
*	Alpha_b_1_31.10936.10936.3	5.1677	0.3375	100.0	100.0	3408.583	3405.5808	8323.4	9	6.026	24.1	2	K.LASWFIPRDET*IISVDEETIMDESTVNSK.R
*	Alpha_b_1_33.11847.11847.3	5.3339	0.4039	100.0	100.0	3488.5513	3485.547	8757.0	1	7.207	26.8	2	K.LASWFIPRDET*IIS*VDEETIMDESTVNSK.R
*	Alpha_b_1_21.07868.07868.2	5.3836	0.5173	100.0	100.0	2356.07	2355.0754	9402.0	1	9.321	55.0	1	R.DETIISVDEETIMDESTVNSK.R
YER131W	1	2	12.6%	119	13447	10.9	U	RPS26B SGDID:S000000933, Chr V from 423948-424307, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Ap and has similarity to rat S26 ribosomal protein" 
YGL189C	1	2	12.6%	119	13505	10.8	U	RPS26A SGDID:S000003157, Chr VII from 148594-148235, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps26Bp and has similarity to rat S26 ribosomal protein" 
	Alpha_a_2_13.05088.05088.2	3.2124	0.2255	99.2	100.0	1683.8345	1681.8319	5572.1	13	5.111	46.4	2	R.DLSEASVYPEYALPK.T
YFR028C	2	5	12.3%	551	61907	8.0	U	CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" 
*	Alpha_b_1_34.11991.11991.5	6.8893	0.3375	99.9	100.0	5003.3877	4995.379	5674.7	1	5.004	19.9	4	K.GLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPK.G
*	Alpha_b_1_9.03614.03614.3	3.534	0.1469	98.4	100.0	2863.1355	2861.1567	7419.0	7	3.695	28.1	1	K.VVIESNNS*DDESMQDTNGTSNHYPK.V
contaminant_KERATIN02	4	10	10.0%	622	61987	5.2	U	no description
*	Alpha_b_1_7.02872.02872.2	3.9468	0.4263	97.0	100.0	1234.6078	1232.5978	7114.4	1	8.63	76.7	5	T.SGGGGGGGLGSGGSIR.S
*	Alpha_b_1_7.02722.02722.2	3.0554	0.3636	97.0	95.5	1147.5724	1145.5658	6322.2	1	6.826	57.1	2	S.GGGGGGGLGSGGSIR.S
*	Alpha_a_2_12.04615.04615.3	4.0398	0.206	99.8	100.0	2512.1375	2510.1318	8478.9	4	4.316	29.5	2	K.EIETYHNLLEGGQEDFESSGAGK.I
*	Alpha_b_1_5.01892.01892.2	2.0205	0.2983	99.0	100.0	1791.7249	1791.7277	6905.8	18	5.132	31.8	1	R.GGSGGSYGGGGSGGGYGGGSGSR.G
YOR204W	1	6	9.9%	604	65553	7.8	U	DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" 
*	Alpha_a_2_35.12737.12737.4	4.6667	0.259	99.6	100.0	6536.1787	6531.193	5501.7	1	4.677	14.4	6	R.NEKAEIAIFGVPEDPNFQSSGINFDNYDDIPVDASGKDVPEPITEFTSPPLDGLLLENIK.L
YLR212C	2	14	9.7%	473	52628	4.7	U	TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" 
*	Alpha_b_1_46.16108.16108.3	6.186	0.5627	100.0	100.0	5172.319	5169.3086	8639.5	1	10.38	21.7	8	R.EVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.-
*	Alpha_b_1_42.14839.14839.3	5.7153	0.4097	100.0	100.0	4515.9624	4513.9546	9385.5	1	8.318	24.4	6	L.MEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHKLV.-
YNL302C	1	6	9.7%	144	15891	9.6	U	RPS19B SGDID:S000005246, Chr XIV from 62943-62924,62372-61958, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps19Ap and has similarity to rat S19 ribosomal protein" 
YOL121C	1	6	9.7%	144	15917	9.6	U	RPS19A SGDID:S000005481, Chr XV from 92849-92830,92439-92025, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps19Bp and has similarity to rat S19 ribosomal protein" 
	Alpha_a_2_13.05075.05075.2	4.4146	0.3009	99.9	100.0	1619.7617	1617.7603	7749.1	1	5.976	80.8	6	R.DLDRIAAQTLEEDE.-
YAL038W	2	4	9.0%	500	54545	7.7	U	CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" 
*	Alpha_a_2_29.10582.10582.3	3.2848	0.1997	99.5	100.0	2611.4128	2608.412	3689.0	1	5.105	31.8	2	R.IIYVDDGVLSFQVLEVVDDKTLK.V
*	Alpha_a_2_26.09593.09593.3	3.7613	0.323	100.0	100.0	2570.2107	2569.2246	7787.6	6	5.677	29.8	2	R.GVFPFVFEKEPVSDWTDDVEAR.I
YOR078W	1	1	8.9%	214	24385	6.6	U	BUD21 SGDID:S000005604, Chr XV from 472726-473370, Verified ORF, "Component of small ribosomal subunit (SSU) processosome that contains U3 snoRNA; originally isolated as bud-site selection mutant that displays a random budding pattern" 
*	Alpha_b_1_10.03899.03899.3	2.1375	0.0996	96.1	99.2	2269.9802	2269.986	5231.6	4	4.029	34.7	1	R.HVTFDKLDES*DENEEALAK.A
YLR449W	1	3	8.7%	392	43903	4.7	U	FPR4 SGDID:S000004441, Chr XII from 1030829-1032007, Verified ORF, "Nuclear protein, putative peptidyl-prolyl cis-trans isomerase (PPIase) with similarity to Fpr3p; overproduction suppresses the growth defect resulting from the absence of E3 ubiquitin-protein ligase Tom1p" 
*	Alpha_b_1_10.03962.03962.3	3.7491	0.2548	99.7	100.0	4130.628	4129.6455	5299.7	6	6.149	19.7	3	R.NPELTRGEYYNQDNNDGLEEDES*ES*EQEADVPKR.S
YOR287C	1	7	8.3%	300	36125	8.6	U	YOR287C SGDID:S000005813, Chr XV from 851836-850934, reverse complement, Uncharacterized ORF, "Protein required for cell viability" 
*	Alpha_a_2_24.08733.08733.3	5.0527	0.298	100.0	100.0	2855.2825	2853.286	10503.7	1	5.333	32.3	7	K.NLKPDLNS*DVEEDDGNLLESIMANK.S
YNL064C	1	7	8.1%	409	44671	6.3	U	YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" 
*	Alpha_b_1_54.19212.19212.3	6.5812	0.3699	100.0	100.0	3564.7236	3561.727	4460.7	1	5.488	28.9	7	R.DGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLK.V
YGR086C	1	5	8.0%	339	38349	4.6	U	PIL1 SGDID:S000003318, Chr VII from 650621-649602, reverse complement, Verified ORF, "Long chain base-responsive inhibitor of protein kinases Pkh1p and Pkh2p, acts along with Lsp1p to down-regulate heat stress resistance via regulation of the Pkc1p and Ypk1p pathways; phosphorylated by Phk1p and Phk2p" 
*	Alpha_a_2_20.07360.07360.3	4.8562	0.3824	100.0	100.0	2990.3896	2987.392	9329.5	1	6.119	33.7	5	K.ALLELLDDSPVT*PGETRPAYDGYEASK.Q
YPR148C	1	1	7.8%	435	49279	4.8	U	YPR148C SGDID:S000006352, Chr XVI from 828136-826829, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" 
*	Alpha_b_1_14.05231.05231.3	2.8601	0.0993	96.8	100.0	3865.5447	3863.5493	9274.2	35	3.803	18.2	1	K.TAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIK.V
YPL061W	1	2	7.6%	500	54414	5.4	U	ALD6 SGDID:S000005982, Chr XVI from 432585-434087, Verified ORF, "Cytosolic aldehyde dehydrogenase that is activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for the conversion of acetaldehyde to acetate; constitutively expressed" 
*	Alpha_a_2_27.09990.09990.3	5.0292	0.2712	100.0	100.0	4240.826	4236.8345	8581.6	1	6.096	21.6	2	K.AQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADR.A
YOR230W	1	2	7.6%	437	48383	5.4	U	WTM1 SGDID:S000005756, Chr XV from 770800-772113, Verified ORF, "Transcriptional repressor involved in regulation of meiosis and silencing; contains WD repeats" 
*	Alpha_a_2_30.10935.10935.3	4.2718	0.2814	100.0	100.0	3693.753	3691.765	9394.5	1	5.213	24.2	2	R.NTAAWHPVIENLVGTVDDDSLVSIYKPYTEESE.-
YFL039C	2	12	7.5%	375	41690	5.7	U	ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" 
*	Alpha_b_1_5.01680.01680.2	3.2608	0.3917	100.0	100.0	1356.6288	1354.6233	5363.0	1	6.872	77.3	4	K.DSYVGDEAQSKR.G
*	Alpha_a_1_11.04998.04998.2	4.5216	0.3777	100.0	100.0	1792.8944	1790.892	5263.1	1	6.54	73.3	8	K.SYELPDGQVITIGNER.F
YBL016W	5	21	7.4%	353	40772	7.1	U	FUS3 SGDID:S000000112, Chr II from 192454-193515, Verified ORF, "Mitogen-activated protein kinase involved in mating pheromone response; activated by phoshporylation by Ste7p; provides specificity during the mating vs. filamentous growth response by phosphorylating transcriptional and cytoplasmic targets" 
*	Alpha_a_1_8.03660.03660.2	2.2717	0.3299	99.6	100.0	2851.2065	2850.2134	8121.1	46	5.172	22.0	1	R.IIDESAADNSEPTGQQSGMTEYVAT*R.W
*	Alpha_a_1_8.03676.03676.2	2.7778	0.0614	97.7	99.5	2854.2158	2850.2134	7153.9	1	3.309	32.0	2	R.IIDESAADNSEPTGQQSGMT*EYVATR.W
*	Alpha_a_1_7.03153.03153.3	5.0822	0.3602	100.0	100.0	2853.2124	2850.2134	7020.5	1	6.409	33.0	8	R.IIDESAADNSEPTGQQSGMTEY*VATR.W
*	Alpha_a_2_9.03765.03765.3	4.2302	0.3603	100.0	100.0	2851.2073	2850.2134	7906.9	1	6.255	29.0	3	R.IIDESAADNSEPTGQQS*GMTEYVATR.W
*	Alpha_b_1_12.04689.04689.3	5.5469	0.3962	100.0	100.0	2853.2148	2850.2134	6654.6	1	7.282	38.0	7	R.IIDESAADNSEPTGQQSGMT*EYVATR.W
YMR131C	2	6	7.2%	511	57261	4.6	U	RRB1 SGDID:S000004738, Chr XIII from 534697-533162, reverse complement, Verified ORF, "Essential nuclear protein involved in early steps of ribosome biogenesis; physically interacts with the ribosomal protein Rpl3p" 
*	Alpha_a_1_16.06578.06578.3	4.8244	0.3317	100.0	100.0	4288.876	4286.8813	4663.2	1	6.979	20.1	1	K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNR.L
*	Alpha_a_1_16.06532.06532.4	4.9686	0.2452	99.6	100.0	4288.8677	4286.8813	7723.3	1	4.7	23.1	5	K.TLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNR.L
YOR310C	2	16	7.0%	511	56956	8.9	U	NOP58 SGDID:S000005837, Chr XV from 898355-896820, reverse complement, Verified ORF, "Protein involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA" 
*	Alpha_a_2_16.06282.06282.2	5.448	0.3374	100.0	100.0	1961.9344	1959.9393	4265.8	1	7.024	75.0	6	K.ASETDLSEILPEEIEER.V
*	Alpha_a_2_8.03243.03243.3	4.5969	0.3314	100.0	100.0	2098.939	2096.9368	6985.4	1	6.537	43.1	10	R.YDALAEDRDDSGDIGLESR.A
YDR432W	3	7	7.0%	414	45407	5.5	U	NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" 
*	Alpha_a_2_34.12121.12121.2	4.6344	0.4373	100.0	100.0	2438.1729	2437.177	6352.3	1	8.111	52.4	2	R.DFDGTGALEFPSEEILVEALER.L
*	Alpha_a_2_34.12131.12131.3	4.2812	0.2633	100.0	100.0	2440.174	2437.177	7221.6	1	5.787	32.1	1	R.DFDGTGALEFPSEEILVEALER.L
*	Alpha_a_1_35.13108.13108.3	3.5706	0.1395	99.2	100.0	3326.6484	3323.643	5357.4	12	3.717	22.3	4	R.DFDGTGALEFPSEEILVEALERLNNIEFR.G
YOL054W	2	16	6.7%	406	47068	4.4	U	YOL054W SGDID:S000005415, Chr XV from 228612-229832, Uncharacterized ORF, "Nuclear protein, putative RNA polymerase II elongation factor; isolated as Pob3p/Spt16p-binding protein" 
*	Alpha_b_1_11.04100.04100.2	4.5766	0.4291	99.8	100.0	1701.7152	1699.717	6712.9	1	7.227	70.0	8	K.NSALAVADDS*DDGITR.C
*	Alpha_b_1_14.05223.05223.2	2.6762	0.187	99.4	100.0	1333.5505	1331.5515	4954.4	2	3.921	75.0	8	R.FRVVLGDS*DDE.-
YMR116C	1	3	6.6%	319	34805	6.2	U	ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "WD repeat protein (G-beta like protein) involved in translation regulation; required for repression of Gcn4p activity in the absence of amino-acid starvation; core component of the ribosome; ortholog of mammalian RACK1" 
*	Alpha_a_2_7.03003.03003.3	3.4095	0.3132	100.0	100.0	2190.0835	2187.0776	7049.3	83	5.533	26.2	3	R.VVPNEKADDDSVTIISAGNDK.M
YGR280C	2	6	6.3%	271	31312	9.9	U	PXR1 SGDID:S000003512, Chr VII from 1051731-1050916, reverse complement, Verified ORF, "Essential protein involved in rRNA and snoRNA maturation; competes with TLC1 RNA for binding to Est2p, suggesting a role in regulation of telomerase; human homolog inhibits telomerase; contains a G-patch RNA interacting domain" 
*	Alpha_a_1_6.02835.02835.2	3.8847	0.4327	99.8	100.0	1869.8778	1868.8749	3909.4	5	6.491	53.1	5	K.LKSSES*ASNIPDAVNTR.L
*	Alpha_a_1_6.02915.02915.2	4.2069	0.4049	99.8	100.0	1629.7037	1627.6959	4083.8	1	6.669	78.6	1	K.SSES*ASNIPDAVNTR.L
YER036C	1	4	6.2%	610	68377	6.5	U	YER036C SGDID:S000000838, Chr V from 225198-223366, reverse complement, Uncharacterized ORF, "ATPase of the ATP-binding cassette (ABC) family involved in ribosome biogenesis, has similarity to Gcn20p" 
*	Alpha_a_2_40.14195.14195.4	4.4987	0.3366	99.8	100.0	4480.1953	4479.176	10273.9	1	5.909	19.4	4	K.RIEDLVEKTILEDGPESELLEPLYERMDSLDPDTFESR.A
YOR261C	1	1	6.2%	338	38313	5.6	U	RPN8 SGDID:S000005787, Chr XV from 816929-815913, reverse complement, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome; has similarity to the human p40 proteasomal subunit and to another S. cerevisiae regulatory subunit, Rpn11p" 
*	Alpha_a_1_6.02952.02952.2	3.061	0.3617	99.7	100.0	2315.0112	2314.0083	3811.6	1	5.437	42.5	1	K.VSDDS*ESESGDKEATAPLIQR.K
YCL043C	1	6	5.9%	522	58227	4.5	U	PDI1 SGDID:S000000548, Chr III from 50221-48653, reverse complement, Verified ORF, "Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds" 
*	Alpha_a_1_18.07379.07379.3	5.3667	0.371	100.0	100.0	3405.4792	3403.482	6285.4	1	6.626	30.0	6	K.ALYEEAQEKAAEEADADAELADEEDAIHDEL.-
YLR075W	1	1	5.9%	221	25361	10.0	U	RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" 
*	Alpha_b_1_8.03375.03375.2	2.8697	0.3734	99.9	100.0	1364.6658	1364.6692	4654.0	1	6.759	70.8	1	R.EAGEVKDDGAFVK.F
YPL131W	1	1	5.7%	297	33715	6.8	U	RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" 
*	Alpha_a_2_27.09701.09701.2	3.3566	0.292	99.7	100.0	2094.9863	2092.9863	7691.4	1	4.972	50.0	1	R.FPGWDFETEEIDPELLR.S
YDR033W	1	1	5.6%	320	36191	9.2	U	MRH1 SGDID:S000002440, Chr IV from 508143-509105, Verified ORF, "Protein that localizes primarily to the plasma membrane, also found at the nuclear envelope; has similarity to Hsp30p and Yro2p, which are induced during heat shock" 
*	Alpha_b_1_8.03297.03297.3	2.4134	0.1203	97.9	99.6	1900.9684	1899.9688	6076.8	83	3.624	29.4	1	K.APVASPRPAATPNLS*KDK.K
YMR215W	2	3	5.5%	524	56794	4.8	U	GAS3 SGDID:S000004828, Chr XIII from 696795-698369, Verified ORF, "Putative 1,3-beta-glucanosyltransferase, has similarity to Gas1p; localizes to the cell wall" 
*	Alpha_a_2_12.04627.04627.2	3.4165	0.4316	100.0	100.0	1581.7964	1581.802	7116.0	1	7.938	76.9	2	R.DAYAFQQLGVNTVR.I
*	Alpha_a_2_7.03172.03172.2	3.4331	0.4493	100.0	100.0	1579.7756	1578.7759	4680.6	1	6.871	64.3	1	R.SIPVGYSAADNTDLR.L
YJR064W	1	1	5.3%	562	61914	5.5	U	CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" 
*	Alpha_a_2_47.17571.17571.3	4.6499	0.3024	100.0	100.0	3100.607	3098.6104	10123.4	1	6.312	25.0	1	K.SQDDEIGDGTTGVVVLASALLDQALELIQK.G
YCR012W	2	18	5.3%	416	44738	7.6	U	PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" 
*	Alpha_a_2_38.13706.13706.3	4.2042	0.1979	99.7	100.0	2521.234	2519.2427	9585.0	1	5.154	34.5	10	K.FRHELSSLADVYINDAFGTAHR.A
*	Alpha_a_2_39.14175.14175.4	4.4009	0.1475	96.2	100.0	2521.2058	2519.2427	7238.6	1	4.725	33.3	8	K.FRHELSSLADVYINDAFGTAHR.A
YGL076C	1	1	5.3%	244	27638	10.1	U	RPL7A SGDID:S000003044, Chr VII from 365999-365989,365529-365436,364967-364338, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" 
YPL198W	1	1	5.3%	244	27696	10.1	U	RPL7B SGDID:S000006119, Chr XVI from 173151-173161,173571-173664,174072-174701, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Ap and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" 
	Alpha_b_1_8.03267.03267.2	3.4767	0.3964	100.0	100.0	1573.7273	1572.7289	7440.0	1	6.687	66.7	1	R.NAAYQKEYETAER.N
YBR127C	2	7	5.2%	517	57749	5.1	U	VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" 
*	Alpha_a_2_12.04723.04723.3	3.2306	0.1204	97.8	100.0	2803.1794	2800.1816	4588.8	370	3.745	23.9	3	K.ILDEFYDRARDDADEDEEDPDTR.S
*	Alpha_a_2_14.05548.05548.4	3.529	0.1262	97.7	100.0	3162.366	3159.362	5990.5	4	3.742	25.6	4	K.ILDEFYDRARDDADEDEEDPDTRSSGK.K
YDR190C	1	1	5.2%	463	50453	5.9	U	RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" 
*	Alpha_a_2_15.05659.05659.2	3.4615	0.2269	99.3	100.0	2597.186	2596.1936	6368.2	2	5.053	39.1	1	K.EVYEGEVTELTPEDAENPLGGYGK.T
YBR121C	1	5	4.9%	667	75411	6.0	U	GRS1 SGDID:S000000325, Chr II from 483361-481358, reverse complement, Verified ORF, "Cytoplasmic and mitochondrial glycyl-tRNA synthase that ligates glycine to the cognate anticodon bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation" 
*	Alpha_a_2_27.09971.09971.3	4.2297	0.1169	97.5	100.0	3617.669	3612.6975	6636.1	1	4.556	23.4	5	K.AIRDITYNGASWEEGTKDLTPFIAQAEAEAETD.-
YLR249W	4	10	4.7%	1044	115945	6.0	U	YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" 
*	Alpha_a_2_19.07260.07260.3	4.6955	0.4777	100.0	100.0	3847.637	3845.654	6671.4	1	8.168	28.8	2	K.RAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I
*	Alpha_a_2_21.07668.07668.3	5.2051	0.3904	100.0	100.0	3691.5398	3689.553	4814.9	1	7.913	28.1	3	R.AVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAK.I
*	Alpha_b_1_11.04398.04398.2	3.1791	0.4548	99.8	100.0	1796.7566	1796.7626	5507.7	7	7.207	50.0	3	K.KKELGDAYVSS*DEEF.-
*	Alpha_b_1_13.05124.05124.2	2.2181	0.2484	99.5	100.0	1876.7247	1876.7289	5370.8	7	4.157	42.9	2	K.KKELGDAYVS*S*DEEF.-
YLR144C	2	5	4.6%	779	88403	5.4	U	ACF2 SGDID:S000004134, Chr XII from 432017-429678, reverse complement, Verified ORF, "Intracellular beta-1,3-endoglucanase, expression is induced during sporulation; may have a role in cortical actin cytoskeleton assembly" 
*	Alpha_a_2_16.06172.06172.2	3.2674	0.2468	99.3	100.0	1935.8153	1934.8191	6569.1	1	6.444	50.0	2	R.DYSGVDNDDPYFPQFR.S
*	Alpha_a_2_8.03238.03238.2	3.5866	0.1873	92.4	97.5	2072.8804	2069.8782	6470.3	1	5.582	52.6	3	K.GLFPSGDGKDEESTSEDVNS.C
YJL034W	1	7	4.4%	682	74468	4.9	U	KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" 
contaminant_GR78_YEAST	1	7	4.4%	682	74468	4.9	U	owl|P16474| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
	Alpha_a_1_13.05647.05647.2	5.1326	0.4939	100.0	100.0	3272.1912	3270.1938	9317.4	1	8.42	34.5	7	K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.-
YER165W	1	5	4.3%	577	64344	6.0	U	PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" 
*	Alpha_a_2_17.06549.06549.3	4.2844	0.3008	100.0	100.0	2788.2852	2786.289	6670.7	1	6.679	33.3	5	K.NLDDSVDDEKLEEEFAPYGTITSAK.V
YOR361C	1	14	4.2%	763	88130	6.0	U	PRT1 SGDID:S000005888, Chr XV from 1017648-1015357, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" 
*	Alpha_b_1_47.16678.16678.3	4.4874	0.2725	100.0	100.0	3729.7712	3725.769	3033.4	1	5.086	33.1	14	K.IFDVQPEDASDDFTTIEEIVEEVLEETKEKVE.-
YKL054C	2	24	4.2%	738	83973	5.0	U	DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" 
*	Alpha_b_1_9.03428.03428.3	4.7309	0.2319	99.7	100.0	3616.5361	3612.5605	6415.4	1	5.005	26.7	7	K.NNYNYYQTQNGQEQQSPNQGVAQHSEDSQQK.Q
*	Alpha_b_1_9.03464.03464.3	4.7226	0.4563	100.0	100.0	3693.5237	3692.5269	10471.2	14	7.408	22.5	17	K.NNYNYYQTQNGQEQQS*PNQGVAQHSEDSQQK.Q
YKL104C	2	4	4.2%	717	80047	6.4	U	GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" 
*	Alpha_a_2_23.08571.08571.3	4.0551	0.1379	98.8	100.0	3264.4944	3261.51	7216.7	34	3.7	25.0	2	R.HS*QSRAFLSEDGSPTPVEFFVSSDAASVVK.H
*	Alpha_a_2_24.08873.08873.3	4.8472	0.2607	99.9	100.0	3263.4983	3261.51	7896.6	2	5.05	25.9	2	R.HSQS*RAFLSEDGSPTPVEFFVSSDAASVVK.H
YGR180C	1	1	4.1%	345	40055	5.2	U	RNR4 SGDID:S000003412, Chr VII from 856306-855269, reverse complement, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits" 
*	Alpha_b_1_18.06743.06743.2	2.1666	0.2227	99.2	100.0	1665.6605	1665.668	5135.1	30	4.593	42.3	1	K.SATPS*KEINFDDDF.-
YGR254W	1	2	3.9%	437	46816	6.6	U	ENO1 SGDID:S000003486, Chr VII from 1000932-1002245, Verified ORF, "Enolase I, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is repressed in response to glucose" 
YHR174W	1	2	3.9%	437	46914	6.0	U	ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" 
	Alpha_a_2_28.10305.10305.2	3.6118	0.4039	100.0	100.0	1821.9154	1821.9229	7408.7	1	7.455	53.1	2	R.SGETEDTFIADLVVGLR.T
YLR399C	2	7	3.8%	686	76978	6.0	U	BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p" 
*	Alpha_a_1_6.03026.03026.2	2.3196	0.1593	99.0	99.4	1523.7449	1521.7421	2933.4	1	4.395	79.2	3	R.RSS*AQEDAPIVIR.R
*	Alpha_b_1_8.03321.03321.2	3.035	0.3202	99.7	100.0	1315.5494	1315.5525	5028.8	1	5.692	66.7	4	R.DASSLS*PTSAGSR.K
YPL049C	1	12	3.8%	452	49356	8.6	U	DIG1 SGDID:S000005970, Chr XVI from 463836-462478, reverse complement, Verified ORF, "Regulatory protein of unknown function, constitutively-expressed, involved in the regulation of mating-specific genes and the invasive growth pathway, required for MAP-kinase imposed repression, inhibits pheromone-responsive transcription" 
*	Alpha_a_2_9.03612.03612.2	4.0001	0.3472	99.7	100.0	1978.9447	1976.9437	6283.8	2	6.182	53.1	12	R.TSQPQQQS*PSLLQGEIR.L
YAL047C	1	3	3.7%	622	72105	5.1	U	SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" 
*	Alpha_b_1_18.06564.06564.3	5.2244	0.2369	100.0	100.0	2616.2837	2613.289	9923.0	1	5.304	34.1	3	K.LNEQSHLLDSLELEENSSSVIEK.Q
YLR197W	1	1	3.4%	504	56864	8.9	U	SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" 
*	Alpha_b_1_3.01223.01223.2	3.3182	0.3302	99.9	100.0	1905.9374	1904.9447	6714.5	1	7.186	53.1	1	K.DKPAAEVEETKEKESSK.K
YGL075C	1	1	3.4%	387	44585	8.3	U	MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" 
*	Alpha_b_1_4.01377.01377.2	2.1991	0.1255	98.7	99.4	1425.6542	1424.653	6868.7	11	3.677	54.2	1	K.NKNTEGAGIST*PR.K
YBR133C	2	4	3.3%	827	95153	6.4	U	HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" 
*	Alpha_a_1_20.08158.08158.3	4.5469	0.2207	99.8	100.0	3171.5334	3168.5288	7152.1	1	4.742	34.6	2	R.FLENVSS*HSPELPSNYDYVLLPITTPR.Y
*	Alpha_a_1_21.08167.08167.3	3.7587	0.1345	99.0	100.0	3171.5305	3168.5288	7190.5	64	3.639	23.1	2	R.FLENVSSHS*PELPSNYDYVLLPITTPR.Y
YER178W	1	3	3.3%	420	46343	8.1	U	PDA1 SGDID:S000000980, Chr V from 546812-548074, Verified ORF, "E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex, catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA, regulated by glucose" 
*	Alpha_a_1_5.02535.02535.2	2.337	0.3774	99.7	100.0	1608.6162	1608.6149	4032.9	4	5.003	50.0	3	R.YGGHS*MSDPGTTYR.T
contaminant_KERATIN04	1	1	3.1%	458	49644	4.9	U	no description
*	Alpha_a_2_10.04176.04176.2	2.2553	0.2887	99.6	100.0	1473.6608	1472.6603	6733.4	6	5.337	46.2	1	K.MIGFPSSAGSVS*PR.S
YKL060C	1	1	3.1%	359	39621	5.8	U	FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" 
*	Alpha_a_2_8.03438.03438.2	2.5867	0.2812	99.4	100.0	1282.66	1282.6637	6176.8	2	6.16	65.0	1	K.SLETFRTTNTL.-
YPL217C	2	8	3.0%	1183	135571	6.8	U	BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" 
*	Alpha_a_2_10.04040.04040.3	3.527	0.2932	99.8	100.0	4089.701	4087.7087	6668.6	14	4.976	19.9	1	R.IYGKPVQEEDADIDNLPSDEEPY*TNDDDVQDSEPR.M
*	Alpha_b_1_13.04918.04918.3	4.7861	0.3715	100.0	100.0	4089.701	4087.7087	7355.9	1	6.545	25.7	7	R.IYGKPVQEEDADIDNLPS*DEEPYTNDDDVQDSEPR.M
YFR024C-A	1	1	2.9%	451	48547	6.1	U	LSB3 SGDID:S000002968, Chr VI from 203421-203375,203256-201948, reverse complement, Verified ORF, "Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization" 
*	Alpha_a_1_5.02552.02552.2	3.0636	0.1408	99.5	100.0	1388.6163	1387.614	6280.0	1	4.974	70.8	1	R.FTAPTS*PSTSSPK.A
YGL008C	1	8	2.8%	918	99619	5.1	U	PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" 
YPL036W	1	8	2.7%	947	102172	5.0	U	PMA2 SGDID:S000005957, Chr XVI from 482841-485684, Verified ORF, "Plasma membrane H+-ATPase, isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential" 
	Alpha_a_2_15.05916.05916.4	5.6038	0.4582	100.0	100.0	3024.4316	3020.423	9798.2	1	7.338	26.0	8	K.TVEEDHPIPEDVHENYENKVAELASR.G
YDL014W	1	1	2.8%	327	34465	10.2	U	NOP1 SGDID:S000002172, Chr IV from 427361-428344, Verified ORF, "Nucleolar protein, component of the small subunit processome complex, which is required for processing of pre-18S rRNA; has similarity to mammalian fibrillarin" 
*	Alpha_b_1_8.03319.03319.2	2.4115	0.2452	99.1	100.0	1002.5795	1002.583	5048.9	1	6.169	75.0	1	R.GKEDLLVTK.N
YLR286C	1	2	2.7%	562	59015	4.5	U	CTS1 SGDID:S000004276, Chr XII from 710138-708450, reverse complement, Verified ORF, "Endochitinase, required for cell separation after mitosis; transcriptional activation during late G and early M cell cycle phases is mediated by transcription factor Ace2p" 
*	Alpha_a_1_4.02225.02225.2	3.0815	0.3632	99.9	100.0	1586.6461	1585.6469	7511.9	1	5.978	67.9	2	K.STCTEGEIACSADGK.F
YAR009C	2	5	2.6%	1196	136732	8.6	U	YAR009C SGDID:S000000067, Chr I from 164188-160598, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YML045W	2	5	1.8%	1755	198524	8.2	U	YML045W SGDID:S000004508, Chr XIII from 184461-185765,185767-189729, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YML039W	2	5	1.8%	1755	198571	8.1	U	YML039W SGDID:S000004503, Chr XIII from 196628-197932,197934-201896, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YLR227W-B	2	5	1.8%	1755	198404	7.9	U	YLR227W-B SGDID:S000007376, Chr XII from 593440-594744,594746-598708, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YLR157C-B	2	5	1.8%	1755	198544	8.1	U	YLR157C-B SGDID:S000007374, Chr XII from 481602-480298,480296-476334, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YJR029W	2	5	1.8%	1755	198616	8.3	U	YJR029W SGDID:S000003790, Chr X from 478258-479558,479560-483526, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YJR027W	2	5	1.8%	1755	198651	8.0	U	YJR027W SGDID:S000003788, Chr X from 472674-473975,473977-477942, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YGR038C-B	2	5	1.8%	1755	198520	8.2	U	YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YGR027W-B	2	5	1.8%	1755	198656	8.2	U	YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YER138C	2	5	1.8%	1755	198561	8.1	U	YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR365W-B	2	5	1.8%	1755	198658	8.0	U	YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR316W-B	2	5	1.8%	1755	198526	8.2	U	YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR261C-D	2	5	1.9%	1604	181660	7.5	U	YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR210C-D	2	5	1.8%	1755	198838	8.4	U	YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR098C-B	2	5	1.8%	1755	198594	8.4	U	YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Alpha_b_1_8.03187.03187.2	2.6442	0.3805	99.7	100.0	1936.8087	1936.8171	4748.9	2	5.557	47.1	1	K.AVS*PTDSTPPSTHTEDSK.R
	Alpha_a_1_5.02449.02449.2	2.7378	0.2885	99.6	100.0	1612.7498	1610.7421	3098.8	2	5.162	70.8	4	K.TVPQIS*DQETEKR.I
YNL272C	1	1	2.6%	759	84652	5.2	U	SEC2 SGDID:S000005216, Chr XIV from 129084-126805, reverse complement, Verified ORF, "Guanyl-nucleotide exchange factor for the small G-protein Sec4p, located on cytoplasmic vesicles; essential for post-Golgi vesicle transport" 
*	Alpha_a_1_10.04469.04469.2	3.0814	0.3806	99.7	100.0	2266.9695	2266.9712	7413.9	3	6.47	44.7	1	K.IGPLVEDDS*DEDQNDAISVR.L
YDR085C	2	3	2.6%	620	71364	8.7	U	AFR1 SGDID:S000002492, Chr IV from 616145-614283, reverse complement, Verified ORF, "Alpha-factor pheromone receptor regulator, negatively regulates pheromone receptor signaling; required for normal mating projection (shmoo) formation; interacts with Cdc12p" 
*	Alpha_a_1_16.06785.06785.2	2.8756	0.2391	99.6	100.0	1771.7958	1770.7946	7713.6	2	5.693	46.7	1	R.S*NSTSNLFALSSTFSK.L
*	Alpha_a_2_20.07423.07423.2	3.4766	0.2046	99.6	100.0	1771.7887	1770.7946	9038.2	1	5.43	56.7	2	R.SNS*TSNLFALSSTFSK.L
YAL005C	1	1	2.6%	642	69768	5.1	U	SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" 
YLL024C	1	1	2.7%	639	69470	5.1	U	SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" 
	Alpha_a_2_11.04564.04564.2	2.6627	0.2416	98.9	100.0	1895.9246	1894.9293	5924.3	3	4.268	43.8	1	K.VNDAVVTVPAYFNDSQR.Q
YNL308C	3	14	2.4%	591	68654	5.1	U	KRI1 SGDID:S000005252, Chr XIV from 55896-54121, reverse complement, Verified ORF, "Essential nucleolar protein required for 40S ribosome biogenesis; physically and functionally interacts with Krr1p" 
*	Alpha_a_1_10.04603.04603.2	2.1983	0.2692	99.5	100.0	1692.7782	1691.7788	2762.1	3	4.41	53.8	7	R.YREVS*PESFGLTAR.E
*	Alpha_a_2_9.03816.03816.2	1.9619	0.0394	94.3	99.5	1691.777	1691.7788	3812.0	271	3.826	42.3	2	R.YREVSPES*FGLTAR.E
*	Alpha_a_2_10.04248.04248.2	2.1627	0.2385	99.3	100.0	1374.6122	1372.6144	7157.1	2	5.091	59.1	5	R.EVS*PESFGLTAR.E
Reverse_contaminant_UBIQUITIN03	1	1	2.0%	1011	111720	5.9	U	no description
*	Alpha_a_2_29.10393.10393.4	2.4446	0.2049	96.2	99.1	2002.1914	1994.1505	4629.5	296	3.79	21.1	1	K.AVEAGLGQLGSVLVRAGQIR.Q
YDL229W	1	1	2.0%	613	66602	5.4	U	SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" 
YNL209W	1	1	2.0%	613	66595	5.5	U	SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" 
	Alpha_a_2_11.04411.04411.2	2.4228	0.174	92.0	100.0	1185.6514	1185.6586	4841.6	1	5.53	77.3	1	K.DAGAISGLNVLR.I
Reverse_YBR198C	1	1	1.9%	798	88968	7.4	U	TAF5 SGDID:S000000402, Chr II from 618518-616122, reverse complement, Verified ORF, "Subunit (90 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification" 
*	Alpha_a_2_44.16072.16072.2	2.215	0.2333	99.1	99.4	1751.8373	1749.8458	9128.0	1	4.272	46.4	1	K.TYFSAVLDSTPIVT*R.R
YLR223C	1	1	1.8%	1085	122491	4.7	U	IFH1 SGDID:S000004213, Chr XII from 585492-582235, reverse complement, Verified ORF, "Essential protein with a highly acidic N-terminal domain; IFH1 exhibits genetic interactions with FHL1, overexpression interferes with silencing at telomeres and HM loci; potential Cdc28p substrate" 
*	Alpha_a_2_32.11571.11571.4	2.7653	0.1464	96.8	100.0	2579.585	2572.5557	6269.8	175	3.891	26.3	1	R.TRKKIDKMKELQRKKTEKKR.Q
YLR342W	1	2	1.5%	1876	214849	7.2	U	FKS1 SGDID:S000004334, Chr XII from 809997-815627, Verified ORF, "Catalytic subunit of 1,3-beta-D-glucan synthase, functionally redundant with alternate catalytic subunit Gsc2p; binds to regulatory subunit Rho1p; involved in cell wall synthesis and maintenance; localizes to sites of cell wall remodeling" 
*	Alpha_a_2_16.06205.06205.3	3.1737	0.1597	98.8	100.0	3240.43	3238.4329	5876.0	1	3.959	26.8	2	K.AMEEANPEDTEETLNKIEGDNSLEAADFR.W
YNR016C	1	7	0.9%	2233	250351	6.3	U	ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" 
*	Alpha_a_1_12.05354.05354.2	5.3075	0.4848	99.9	100.0	2060.9692	2059.9695	8652.5	1	8.743	69.4	7	R.AVS*VSDLSYVANSQSSPLR.E
	Proteins	Peptide IDs	Spectra
Unfiltered	9513	32918	37002
Filtered	94	271	922
Forward matches	92	269	920
Decoy matches	2	2	2
Forward FDR	2.17	0.74	0.22

Classification	Nonredundant Proteins	Redundant Proteins
Unclassified	0	0