DTASelect v1.8
/wfs/bfd/3/scott/cheeseman/bim1
/wfs/dbase/nci/yeast_orfs2
 -o
true	Use criteria
1.8	Minimum +1 XCorr
2.5	Minimum +2 XCorr
3.5	Minimum +3 XCorr
0.08	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
Include	Modified peptide inclusion
Any	Tryptic status requirement
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus	Sequence Count	Spectrum Count	Sequence Coverage	Length	MolWt	pI	Validation Status	Descriptive Name
Unique	FileName	XCorr	DeltCN	M+H+	TotalIntensity	SpRank	IonProportion	Redundancy	Sequence	pI
ORFP:YER016W	122	1344	87.2%	344	38362	5.4	U	BIM1, Chr V from 188276-189310 
*	cheesemanbim1-02.3153.3153.1	2.0165	0.1617	1161.6	4496.1	16	50.0%	1	R.TELLTWLNGL.L	3.7460938
*	cheesemanbim1-02.3154.3154.2	2.6897	0.2631	1161.7	5182.5	1	66.7%	1	R.TELLTWLNGL.L	3.7460938
*	cheesemanbim1-02.3534.3534.2	3.3524	0.2831	1275.4	6246.2	1	70.0%	1	R.TELLTWLNGLL.N	3.7460938
*	cheesemanbim1-02.3864.3864.2	3.2467	0.2607	1500.63	8091.3	1	66.7%	3	R.TELLTWLNGLLNL.N	3.7460938
*	cheesemanbim1-06.3405.3405.2	5.6343	0.4905	1908.81	8667.0	1	80.0%	62	R.TELLTWLNGLLNLNYK.K	6.5625
*	cheesemanbim1-05.3196.3196.2	3.5114	0.3523	1563.61	7734.0	1	70.8%	1	L.LTWLNGLLNLNYK.K	8.8046875
*	cheesemanbim1-05.2992.2992.2	3.4429	0.3029	1450.02	6781.2	1	86.4%	2	L.TWLNGLLNLNYK.K	8.8046875
*	cheesemanbim1-04.0437.0437.2	2.7254	0.2593	1084.67	6519.4	2	78.6%	1	L.NYKKIEEC.G	6.5625
*	cheesemanbim1-04.0595.0595.2	2.9782	0.2645	1370.16	10670.6	1	63.6%	2	L.NYKKIEECGTGA.A	6.5625
*	cheesemanbim1-04.3289.3289.3	4.8682	0.4524	2994.63	6413.2	1	31.0%	4	K.KIEECGTGAAYCQIMDSIYGDLPMNR.V	4.4023438
*	cheesemanbim1-03.3211.3211.3	3.8492	0.307	2868.02	8731.2	1	27.1%	1	K.IEECGTGAAYCQIMDSIYGDLPMNR.V	3.9648438
*	cheesemanbim1-04.3015.3015.2	4.0799	0.4492	2048.59	7766.4	1	62.5%	2	A.AYCQIMDSIYGDLPMNR.V	4.4570312
*	cheesemanbim1-04.2483.2483.2	4.7728	0.3978	1813.45	7633.1	1	82.1%	4	Y.CQIMDSIYGDLPMNR.V	4.4570312
*	cheesemanbim1-04.2282.2282.2	3.6581	0.4245	1653.53	7457.5	1	65.4%	5	C.QIMDSIYGDLPMNR.V	4.4570312
*	cheesemanbim1-03.1193.1193.2	3.1292	0.3108	1281.58	5548.0	1	85.0%	1	M.DSIYGDLPMNR.V	4.4570312
*	cheesemanbim1-05.1277.1277.2	4.8049	0.4345	1953.64	8356.0	1	70.0%	3	R.VKFNATAEYEFQTNYK.I	6.5625
*	cheesemanbim1-06.1728.1728.2	5.2698	0.5009	1728.11	8677.1	1	84.6%	92	K.FNATAEYEFQTNYK.I	4.4570312
*	cheesemanbim1-03.0876.0876.2	3.3928	0.4184	1293.41	6302.4	1	83.3%	2	T.AEYEFQTNYK.I	4.4570312
*	cheesemanbim1-03.0878.0878.1	2.3824	0.1827	1293.49	5621.4	1	72.2%	1	T.AEYEFQTNYK.I	4.4570312
*	cheesemanbim1-04.0863.0863.2	2.5856	0.3002	1011.35	4678.4	1	92.9%	1	K.ILQSCFSR.H	8.2578125
*	cheesemanbim1-03.0524.0524.1	1.8536	0.0838	726.55	4886.1	14	70.0%	1	K.TVYVDK.L	6.5625
*	cheesemanbim1-05.3111.3111.2	4.5794	0.2672	1870.44	7373.0	1	76.9%	11	R.CKFQDNLEFLQWLK.K	6.5625
*	cheesemanbim1-05.3047.3047.3	4.2868	0.2207	1870.63	7153.1	1	48.1%	2	R.CKFQDNLEFLQWLK.K	6.5625
*	cheesemanbim1-04.2191.2191.2	2.775	0.0919	1154.21	4479.6	3	81.2%	1	C.KFQDNLEFL.Q	4.4570312
*	cheesemanbim1-02.2925.2925.2	2.6977	0.1555	1340.91	6931.1	2	72.2%	1	K.FQDNLEFLQW.L	3.5546875
*	cheesemanbim1-06.2833.2833.2	5.0247	0.2385	1582.56	6781.4	1	90.9%	71	K.FQDNLEFLQWLK.K	4.4570312
*	cheesemanbim1-05.2912.2912.2	4.0349	0.2673	1710.08	8138.2	1	75.0%	2	K.FQDNLEFLQWLKK.H	6.5625
*	cheesemanbim1-05.3220.3220.1	2.6261	0.1639	1307.52	5147.3	1	72.2%	1	Q.DNLEFLQWLK.K	4.4570312
*	cheesemanbim1-05.0308.0308.2	3.8877	0.4464	1432.72	5166.9	1	81.8%	56	R.HKDESVYDPDAR.R	4.8945312
*	cheesemanbim1-02.0700.0700.2	2.7687	0.1521	1167.85	3451.4	1	72.2%	5	K.DESVYDPDAR.R	3.9648438
*	cheesemanbim1-06.1468.1468.2	3.7232	0.3459	1506.79	10387.2	1	75.0%	1	R.KYRPIITNNSATK.P	10.294922
*	cheesemanbim1-06.1472.1472.2	3.1519	0.3482	1760.9	5609.0	1	71.4%	3	R.KYRPIITNNSATKPR.T	11.1015625
*	cheesemanbim1-06.1477.1477.3	4.8677	0.3035	1761.36	9049.4	1	55.4%	1	R.KYRPIITNNSATKPR.T	11.1015625
*	cheesemanbim1-06.1511.1511.2	4.051	0.3723	1631.83	5229.0	1	69.2%	5	K.YRPIITNNSATKPR.T	10.9921875
*	cheesemanbim1-06.1515.1515.3	4.8616	0.2061	1633.03	7300.8	1	46.2%	2	K.YRPIITNNSATKPR.T	10.9921875
*	cheesemanbim1-05.0615.0615.2	3.112	0.2836	1315.38	8515.3	1	77.3%	2	R.PIITNNSATKPR.T	10.9921875
*	cheesemanbim1-06.1447.1447.2	4.1795	0.3633	1684.64	6756.5	1	67.6%	1	K.RSSSTGTGSAMSGGLATR.H	12.003906
*	cheesemanbim1-06.1451.1451.3	3.9443	0.2925	1685.79	6807.1	1	44.1%	1	K.RSSSTGTGSAMSGGLATR.H	12.003906
*	cheesemanbim1-04.0752.0752.2	4.2856	0.3419	1528.37	8831.9	1	65.6%	5	R.SSSTGTGSAMSGGLATR.H	10.0625
*	cheesemanbim1-05.0808.0808.2	2.6703	0.2814	1029.46	5625.9	1	77.8%	2	R.HSSLGINGSR.K	10.0625
*	cheesemanbim1-06.1423.1423.1	2.2065	0.2692	1029.6	2236.6	1	66.7%	2	R.HSSLGINGSR.K	10.0625
*	cheesemanbim1-06.1413.1413.2	3.1057	0.1058	1157.14	6405.0	1	85.0%	1	R.HSSLGINGSRK.T	10.9921875
*	cheesemanbim1-05.0907.0907.2	3.7236	0.2796	1373.52	6055.4	1	75.0%	2	R.KTSVTQGQLVAIQ.A	9.078125
*	cheesemanbim1-05.1597.1597.3	4.809	0.437	1915.95	8849.3	1	47.1%	27	R.KTSVTQGQLVAIQAELTK.S	8.8046875
*	cheesemanbim1-06.2058.2058.2	6.2004	0.556	1917.01	9141.0	1	76.5%	151	R.KTSVTQGQLVAIQAELTK.S	8.8046875
*	cheesemanbim1-04.2310.2310.3	5.093	0.2847	1788.41	10713.6	1	48.4%	8	K.TSVTQGQLVAIQAELTK.S	6.5625
*	cheesemanbim1-05.2166.2166.2	5.0842	0.3303	1789.54	7449.8	1	68.8%	82	K.TSVTQGQLVAIQAELTK.S	6.5625
*	cheesemanbim1-04.2083.2083.1	3.0099	0.264	1270.63	8677.8	3	54.5%	4	Q.GQLVAIQAELTK.S	6.5625
*	cheesemanbim1-05.1299.1299.2	4.4592	0.4392	1273.44	8176.3	1	86.4%	2	Q.GQLVAIQAELTK.S	6.5625
*	cheesemanbim1-04.2097.2097.1	2.1751	0.1306	974.61	8550.4	1	75.0%	3	L.VAIQAELTK.S	6.5625
*	cheesemanbim1-03.1414.1414.2	4.5991	0.4532	1869.23	4915.2	1	76.7%	77	K.SQETIGSLNEEIEQYK.G	3.9648438
*	cheesemanbim1-03.1374.1374.2	4.7703	0.4415	2028.31	5956.8	1	58.8%	1	K.SQETIGSLNEEIEQYKGT.V	3.9648438
*	cheesemanbim1-04.1962.1962.2	4.7209	0.3269	2212.65	8653.2	1	55.3%	10	K.SQETIGSLNEEIEQYKGTVS.T	3.9648438
*	cheesemanbim1-05.2637.2637.2	4.3808	0.4154	2426.57	10016.8	1	47.6%	12	K.SQETIGSLNEEIEQYKGTVSTL.E	3.9648438
*	cheesemanbim1-03.2414.2414.2	3.3849	0.3429	2555.75	9465.7	1	40.9%	2	K.SQETIGSLNEEIEQYKGTVSTLE.I	3.8554688
*	cheesemanbim1-05.2714.2714.3	5.3286	0.3716	2955.6	4608.6	1	34.0%	22	K.SQETIGSLNEEIEQYKGTVSTLEIER.E	4.1152344
*	cheesemanbim1-05.2706.2706.2	3.9882	0.4091	2740.03	8388.0	1	41.3%	2	Q.ETIGSLNEEIEQYKGTVSTLEIER.E	4.1152344
*	cheesemanbim1-04.1404.1404.2	4.0332	0.2778	1525.13	6267.8	1	75.0%	1	E.TIGSLNEEIEQYK.G	4.142578
*	cheesemanbim1-05.2697.2697.2	3.5834	0.3197	2610.06	9137.6	1	40.9%	2	E.TIGSLNEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-05.2698.2698.2	4.5168	0.3819	2509.05	8271.5	1	54.8%	3	T.IGSLNEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-04.2885.2885.2	4.3014	0.4966	2395.82	7777.7	1	52.5%	10	I.GSLNEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-05.2704.2704.2	3.1118	0.2612	2338.71	6430.5	1	44.7%	1	G.SLNEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-05.2702.2702.2	3.2968	0.3465	2252.21	7490.5	1	47.2%	2	S.LNEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-01.1684.1684.1	2.2594	0.0827	926.44	5147.1	2	75.0%	1	L.NEEIEQY.K	3.4726562
*	cheesemanbim1-03.0599.0599.2	2.593	0.0922	1053.89	5320.2	6	85.7%	1	L.NEEIEQYK.G	4.142578
*	cheesemanbim1-03.0611.0611.1	3.0041	0.1183	1054.53	3975.9	3	78.6%	1	L.NEEIEQYK.G	4.142578
*	cheesemanbim1-03.0755.0755.2	3.0627	0.3405	1397.47	8802.4	1	63.6%	1	L.NEEIEQYKGTVS.T	4.142578
*	cheesemanbim1-03.1038.1038.2	3.6937	0.292	1612.42	7968.6	1	69.2%	1	L.NEEIEQYKGTVSTL.E	4.142578
*	cheesemanbim1-05.1226.1226.2	4.9327	0.4331	2139.52	6062.0	1	70.6%	8	L.NEEIEQYKGTVSTLEIER.E	4.251953
*	cheesemanbim1-05.0823.0823.2	2.9041	0.2534	1233.99	7178.8	1	80.0%	4	Y.KGTVSTLEIER.E	6.5625
*	cheesemanbim1-05.0855.0855.2	3.1412	0.3511	1105.32	7896.2	1	88.9%	2	K.GTVSTLEIER.E	4.4570312
*	cheesemanbim1-04.2397.2397.2	3.5402	0.3807	1461.42	5191.3	1	85.0%	7	S.TLEIEREFYFN.K	4.142578
*	cheesemanbim1-03.1296.1296.2	2.7032	0.2032	1247.2	6766.9	2	75.0%	1	L.EIEREFYFN.K	4.142578
*	cheesemanbim1-04.3660.3660.3	3.5031	0.2905	3300.7	6960.1	2	21.2%	1	R.EFYFNKLRDIEILVHTTQDLINEGVYK.F	5.0039062
*	cheesemanbim1-05.1237.1237.2	3.1047	0.282	1108.44	3627.8	3	87.5%	2	K.LRDIEILVH.T	5.6328125
*	cheesemanbim1-06.2618.2618.3	6.6114	0.5187	2470.69	9166.0	1	47.5%	71	K.LRDIEILVHTTQDLINEGVYK.F	4.8945312
*	cheesemanbim1-06.2566.2566.2	5.9879	0.4454	2470.9	8594.1	1	55.0%	18	K.LRDIEILVHTTQDLINEGVYK.F	4.8945312
*	cheesemanbim1-03.1214.1214.2	2.7789	0.1526	1041.41	5658.2	2	81.2%	1	R.DIEILVHTT.Q	4.4570312
*	cheesemanbim1-03.2843.2843.2	2.5758	0.2424	1754.46	9454.2	1	57.1%	1	R.DIEILVHTTQDLINE.G	3.9648438
*	cheesemanbim1-05.3135.3135.3	6.4921	0.4247	2201.62	7530.6	1	58.3%	21	R.DIEILVHTTQDLINEGVYK.F	4.4023438
*	cheesemanbim1-05.3283.3283.2	6.383	0.4538	2203.86	7255.7	1	69.4%	157	R.DIEILVHTTQDLINEGVYK.F	4.4023438
*	cheesemanbim1-04.3368.3368.2	4.3394	0.3902	1974.48	9024.4	1	65.6%	2	I.EILVHTTQDLINEGVYK.F	4.716797
*	cheesemanbim1-05.1392.1392.2	5.2581	0.5313	1844.66	8621.6	1	70.0%	8	E.ILVHTTQDLINEGVYK.F	5.6328125
*	cheesemanbim1-05.3152.3152.2	3.3875	0.3783	1731.58	8404.2	1	67.9%	1	I.LVHTTQDLINEGVYK.F	5.6328125
*	cheesemanbim1-04.1020.1020.2	5.0007	0.496	1619.39	6345.2	1	80.8%	8	L.VHTTQDLINEGVYK.F	5.6328125
*	cheesemanbim1-04.1007.1007.3	3.5087	0.1214	1620.15	5218.1	3	44.2%	1	L.VHTTQDLINEGVYK.F	5.6328125
*	cheesemanbim1-03.0962.0962.2	3.8043	0.3031	1382.15	6331.5	1	86.4%	3	H.TTQDLINEGVYK.F	4.4570312
*	cheesemanbim1-03.1678.1678.2	2.9674	0.2642	1528.98	9541.7	1	70.8%	2	H.TTQDLINEGVYKF.N	4.4570312
*	cheesemanbim1-03.0927.0927.2	2.8289	0.1526	1282.37	6053.4	21	60.0%	1	T.TQDLINEGVYK.F	4.4570312
*	cheesemanbim1-03.1776.1776.2	3.1318	0.2058	1198.32	7246.9	1	83.3%	1	Q.DLINEGVYKF.N	4.4570312
*	cheesemanbim1-03.0735.0735.2	2.8882	0.3168	1205.5	6725.1	1	70.0%	1	K.FNDETITGHGN.G	4.4570312
*	mth.0736.0736.2	3.3985	0.2444	1376.76	8270.4	1	70.8%	2	K.FNDETITGHGNGN.G	4.4570312
*	cheesemanbim1-03.0955.0955.2	3.1673	0.3775	1675.36	7469.0	1	59.4%	2	K.FNDETITGHGNGNGGAL.L	4.4570312
*	cheesemanbim1-05.0975.0975.2	5.1973	0.5714	1944.65	7171.6	1	52.8%	93	K.FNDETITGHGNGNGGALLR.F	5.6328125
*	cheesemanbim1-04.1067.1067.3	3.5777	0.263	1945.41	4979.5	1	36.1%	1	K.FNDETITGHGNGNGGALLR.F	5.6328125
*	cheesemanbim1-03.0413.0413.2	2.8376	0.2282	887.49	5767.1	1	85.7%	1	F.NDETITGH.G	4.4570312
*	cheesemanbim1-04.1170.1170.1	2.0127	0.2198	1094.57	4630.1	14	50.0%	1	K.KVESILYATA.E	6.5625
*	cheesemanbim1-04.1215.1215.2	3.5026	0.3437	1225.69	7178.7	1	85.0%	3	K.KVESILYATAE.G	4.4570312
*	cheesemanbim1-05.2194.2194.2	4.4704	0.5082	1429.39	7190.9	1	75.0%	3	K.KVESILYATAEGF.E	4.4570312
*	cheesemanbim1-05.2208.2208.2	4.4377	0.4734	1558.46	8737.3	1	69.2%	3	K.KVESILYATAEGFE.M	4.142578
*	cheesemanbim1-05.2609.2609.3	8.4932	0.5403	2818.63	10477.9	1	42.7%	80	K.KVESILYATAEGFEMNDGEDELNDK.N	3.9511719
*	cheesemanbim1-03.2610.2610.2	4.689	0.4232	2690.54	7244.5	1	54.3%	4	K.VESILYATAEGFEMNDGEDELNDK.N	3.6367188
*	cheesemanbim1-03.2051.2051.2	4.9527	0.376	2461.65	8265.6	1	54.8%	2	E.SILYATAEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.1655.1655.2	4.7743	0.4532	2374.51	8553.2	1	55.0%	1	S.ILYATAEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.1097.1097.2	5.1127	0.4679	2148.42	8227.8	1	63.9%	1	L.YATAEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.0998.0998.2	5.2056	0.4844	1988.37	7948.7	1	67.6%	3	Y.ATAEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.0993.0993.2	5.294	0.2736	1917.7	7723.7	1	68.8%	3	A.TAEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.1052.1052.2	4.4078	0.4067	1814.41	7486.2	1	66.7%	5	T.AEGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.1282.1282.2	4.0921	0.3536	2042.24	8945.7	1	58.8%	1	T.AEGFEMNDGEDELNDKNL.G	3.6914062
*	cheesemanbim1-03.0995.0995.2	3.1732	0.2713	1742.69	6256.3	1	60.7%	1	A.EGFEMNDGEDELNDK.N	3.6914062
*	cheesemanbim1-03.0994.0994.2	5.1116	0.4439	1616.22	7637.8	1	80.8%	4	E.GFEMNDGEDELNDK.N	3.8007812
*	cheesemanbim1-03.1233.1233.2	3.26	0.2272	1840.54	10828.8	1	60.0%	1	E.GFEMNDGEDELNDKNL.G	3.8007812
*	cheesemanbim1-03.0610.0610.2	3.0626	0.173	1408.92	9589.6	1	81.8%	1	F.EMNDGEDELNDK.N	3.8007812
*	cheesemanbim1-03.0908.0908.2	3.4335	0.1589	1636.39	11105.1	1	61.5%	1	F.EMNDGEDELNDKNL.G	3.8007812
*	cheesemanbim1-03.0548.0548.2	3.3552	0.1848	1280.21	7023.5	1	85.0%	1	E.MNDGEDELNDK.N	3.8554688
*	cheesemanbim1-03.0405.0405.2	3.1788	0.2358	1149.3	6310.0	1	88.9%	1	M.NDGEDELNDK.N	3.8554688
*	cheesemanbim1-03.1284.1284.2	3.5361	0.25	1700.2	8946.4	1	60.7%	1	M.NDGEDELNDKNLGEH.G	4.1152344
*	cheesemanbim1-04.0787.0787.2	3.1103	0.2467	1444.43	3237.1	2	61.5%	1	K.NLGEHGTVPNQGGY.A	5.359375
*	cheesemanbim1-04.0976.0976.3	5.8815	0.5425	3510.58	7338.1	1	29.5%	1	K.NLGEHGTVPNQGGYANSNGEVNGNEGSNHDVIMQ.N	4.4023438
*	cheesemanbim1-03.0761.0761.2	3.1871	0.1828	1902.15	6769.1	1	41.2%	1	N.SNGEVNGNEGSNHDVIMQ.N	4.142578
*	cheesemanbim1-03.0738.0738.2	3.1416	0.2228	1701.53	5383.4	7	46.7%	2	N.GEVNGNEGSNHDVIMQ.N	4.142578
*	cheesemanbim1-01.0876.0876.1	1.8183	0.1883	907.44	3303.4	11	50.0%	1	Q.NDEGEVGVS.N	3.4726562
TRYPSIN	29	83	60.3%	229	23993	7.9	U	no description
*	cheesemanbim1-04.1753.1753.2	3.6309	0.3553	1470.35	4339.6	1	73.1%	1	G.GSLINSQWVVSAAH.C	7.328125
*	cheesemanbim1-01.3322.3322.2	3.7116	0.4123	1533.42	7064.6	1	69.2%	6	R.LGEDNINVVEGNEQ.F	3.3359375
*	cheesemanbim1-02.2125.2125.2	2.698	0.2912	1949.6	7820.4	1	52.9%	1	R.LGEDNINVVEGNEQFISA.S	3.3359375
*	cheesemanbim1-04.1774.1774.2	4.8719	0.4046	2163.81	5163.4	1	57.9%	24	R.LGEDNINVVEGNEQFISASK.S	3.9648438
*	cheesemanbim1-03.1640.1640.3	3.7173	0.1998	2166.02	10554.5	1	35.5%	1	R.LGEDNINVVEGNEQFISASK.S	3.9648438
*	cheesemanbim1-03.1189.1189.2	2.7718	0.2329	2050.54	5273.8	1	47.2%	1	L.GEDNINVVEGNEQFISASK.S	3.9648438
*	cheesemanbim1-03.1190.1190.2	3.0371	0.3159	1993.72	5797.8	1	50.0%	1	G.EDNINVVEGNEQFISASK.S	3.9648438
*	cheesemanbim1-04.1273.1273.2	2.9145	0.2634	1750.44	8409.0	1	60.0%	1	D.NINVVEGNEQFISASK.S	4.4570312
*	cheesemanbim1-03.1364.1364.1	2.0825	0.0963	1310.45	4859.0	3	50.0%	1	V.VEGNEQFISASK.S	4.4570312
*	cheesemanbim1-04.0712.0712.2	3.093	0.2894	1118.43	6575.6	1	72.2%	2	K.SIVHPSYNSN.T	7.328125
*	cheesemanbim1-05.0675.0675.1	2.1254	0.2568	1119.4	3334.2	3	61.1%	1	K.SIVHPSYNSN.T	7.328125
*	cheesemanbim1-05.0825.0825.2	2.7082	0.2281	1446.89	7012.8	58	50.0%	1	K.SIVHPSYNSNTLN.N	7.328125
*	cheesemanbim1-05.0804.0804.2	3.3556	0.2962	1560.26	6529.7	1	65.4%	1	K.SIVHPSYNSNTLNN.D	7.328125
*	cheesemanbim1-04.1368.1368.2	3.2539	0.1502	1919.38	7538.9	1	53.1%	2	K.SIVHPSYNSNTLNNDIM.L	5.359375
*	cheesemanbim1-06.2047.2047.2	4.7319	0.5305	2274.07	5150.1	1	60.5%	12	K.SIVHPSYNSNTLNNDIMLIK.L	7.328125
*	cheesemanbim1-06.1958.1958.3	4.1865	0.2368	2274.25	6614.0	14	30.3%	10	K.SIVHPSYNSNTLNNDIMLIK.L	7.328125
*	cheesemanbim1-06.1879.1879.2	3.8565	0.4716	2188.45	6293.8	1	50.0%	1	S.IVHPSYNSNTLNNDIMLIK.L	7.328125
*	cheesemanbim1-04.1883.1883.2	3.9203	0.3744	1655.25	6426.9	1	69.2%	2	S.YNSNTLNNDIMLIK.L	6.5625
*	cheesemanbim1-04.1646.1646.2	3.684	0.3111	1490.79	5970.2	1	75.0%	2	Y.NSNTLNNDIMLIK.L	6.5625
*	cheesemanbim1-04.1528.1528.2	3.3519	0.1572	1175.28	3852.4	1	88.9%	2	N.TLNNDIMLIK.L	6.5625
*	cheesemanbim1-06.1379.1379.1	1.8203	0.1318	1046.7	2893.5	8	55.6%	1	K.LKSAASLNSR.V	10.9921875
*	cheesemanbim1-04.2503.2503.2	3.9719	0.4731	2666.78	8856.7	1	40.0%	1	R.VASISLPTSCASAGTQCLISGWGNTK.S	8.0390625
*	cheesemanbim1-04.0638.0638.1	3.0578	0.2793	1079.46	3454.7	1	72.2%	2	K.APILSDSSCK.S	6.5625
*	cheesemanbim1-04.0629.0629.2	2.5052	0.2182	1080.56	6035.0	1	77.8%	1	K.APILSDSSCK.S	6.5625
*	cheesemanbim1-01.1642.1642.1	1.8098	0.2147	1039.48	3584.9	1	55.6%	1	K.SAYPGQITSN.M	6.125
*	cheesemanbim1-04.2333.2333.3	4.5735	0.3666	2254.31	7342.1	1	45.0%	1	K.SAYPGQITSNMFCAGYLEGGK.D	6.5625
*	cheesemanbim1-04.1205.1205.1	2.2293	0.168	1232.42	7780.0	1	65.0%	1	N.MFCAGYLEGGK.D	6.5625
*	cheesemanbim1-04.1265.1265.1	2.0195	0.2061	1081.46	4010.0	3	61.1%	1	I.VSWGSGCAQK.N	8.2578125
*	cheesemanbim1-06.1275.1275.1	1.8986	0.1737	792.64	3330.6	1	75.0%	1	N.KPGVYTK.V	9.6796875
ORFP:YPL269W	49	124	56.4%	644	74245	8.6	U	KAR9, Chr XVI from 33013-34947 
*	cheesemanbim1-03.1620.1620.2	4.7048	0.5158	1852.69	7835.8	1	71.4%	14	R.SMTIGDDFQENFCER.L	3.9648438
*	cheesemanbim1-03.1223.1223.2	2.9604	0.1983	1631.2	7962.4	1	66.7%	1	M.TIGDDFQENFCER.L	3.9648438
*	cheesemanbim1-04.3718.3718.3	3.7805	0.197	2393.8	5980.5	1	36.2%	1	L.LVQFYDDLENVASVIPDLVNK.K	3.9648438
*	cheesemanbim1-04.3724.3724.2	5.0408	0.3569	2395.53	6852.1	1	57.5%	3	L.LVQFYDDLENVASVIPDLVNK.K	3.9648438
*	cheesemanbim1-03.3120.3120.2	4.513	0.2426	2054.58	6572.1	1	61.8%	5	Q.FYDDLENVASVIPDLVNK.K	3.9648438
*	cheesemanbim1-05.3026.3026.2	3.1599	0.3009	2179.94	8770.5	1	44.4%	2	Q.FYDDLENVASVIPDLVNKK.R	4.4023438
*	cheesemanbim1-02.1207.1207.1	2.1433	0.1352	1210.48	6370.7	3	66.7%	1	L.DLLEDEFSKD.D	3.8554688
*	cheesemanbim1-02.1194.1194.2	3.7224	0.263	1212.35	7106.1	1	83.3%	4	L.DLLEDEFSKD.D	3.8554688
*	cheesemanbim1-04.3120.3120.2	4.6413	0.4173	1774.63	6270.4	1	78.6%	5	R.FSPMFDVIEESTQIK.T	4.142578
*	cheesemanbim1-04.3129.3129.2	4.6077	0.3366	1538.81	6671.0	1	87.5%	1	S.PMFDVIEESTQIK.T	4.142578
*	cheesemanbim1-04.2031.2031.2	3.4194	0.212	1344.05	3835.8	1	80.0%	2	K.TQLEPWLTNLK.E	6.5625
*	cheesemanbim1-03.1871.1871.2	3.8006	0.3519	1638.44	7527.6	1	73.1%	4	K.ELLDTSLEFNEISK.D	3.9648438
*	cheesemanbim1-06.1836.1836.3	4.3469	0.2888	2619.11	8286.8	1	29.8%	1	K.ELLDTSLEFNEISKDHMDTLHK.I	4.696289
*	cheesemanbim1-04.1717.1717.2	5.0684	0.4455	1981.77	6730.1	1	73.3%	3	K.IINSNISYCLEIQEER.F	4.142578
*	cheesemanbim1-05.1809.1809.2	2.553	0.1806	1401.27	4018.1	1	72.7%	1	R.HTPSFTLEQLVK.L	7.328125
*	cheesemanbim1-05.0630.0630.2	2.9473	0.2869	1327.54	7363.2	1	68.2%	4	K.LLGTHTETTEPK.V	5.6328125
*	cheesemanbim1-06.1575.1575.2	4.0761	0.5215	1827.71	6464.6	1	65.6%	1	L.GTHTETTEPKVPKFSPA.E	7.328125
*	cheesemanbim1-04.1367.1367.1	1.872	0.1156	1134.63	4192.7	2	61.1%	1	K.FSPAEDILSR.K	4.4570312
*	cheesemanbim1-04.1375.1375.2	2.8653	0.0911	1044.77	4041.6	2	87.5%	2	K.SLTDILPQR.I	6.5625
*	cheesemanbim1-04.2497.2497.2	5.1628	0.3716	1601.7	6940.8	1	88.5%	3	R.NITNITTLQTILQK.K	9.078125
*	cheesemanbim1-04.1289.1289.2	2.8205	0.1711	927.55	4146.6	12	91.7%	1	K.TFNIIYR.A	9.078125
*	cheesemanbim1-04.2493.2493.2	5.0105	0.434	1421.41	8247.8	1	84.6%	3	R.ALEFSLLDAGVASK.T	4.4570312
*	cheesemanbim1-06.1656.1656.1	2.2751	0.1641	1185.58	5550.7	1	66.7%	2	R.WLNIKPTADK.I	8.8046875
*	cheesemanbim1-05.1040.1040.2	3.0643	0.2176	1186.2	5937.0	1	88.9%	3	R.WLNIKPTADK.I	8.8046875
*	cheesemanbim1-06.2341.2341.3	5.3456	0.4457	2323.52	7360.0	1	41.2%	4	K.SLGFGRPNSVIGTITQDFQER.V	6.5625
*	cheesemanbim1-06.2343.2343.2	3.79	0.4053	2324.12	5308.9	1	52.5%	2	K.SLGFGRPNSVIGTITQDFQER.V	6.5625
*	cheesemanbim1-04.2609.2609.2	4.0692	0.4928	1705.73	6460.8	1	67.9%	2	R.PNSVIGTITQDFQER.V	4.4570312
*	cheesemanbim1-04.2415.2415.2	3.6886	0.4664	1496.12	5514.3	1	70.8%	4	N.SVIGTITQDFQER.V	4.4570312
*	cheesemanbim1-03.0554.0554.2	2.9959	0.3759	1777.57	6699.2	1	53.1%	1	R.VAINEGDSNKTPENSTT.V	4.142578
*	cheesemanbim1-04.0843.0843.2	4.484	0.5066	2188.86	6320.8	1	42.5%	1	R.VAINEGDSNKTPENSTTVALK.G	4.716797
*	cheesemanbim1-04.0847.0847.3	3.9892	0.2998	2190.41	8084.5	2	37.5%	1	R.VAINEGDSNKTPENSTTVALK.G	4.716797
*	cheesemanbim1-03.0408.0408.2	3.4215	0.396	1479.38	6047.8	2	57.7%	1	N.EGDSNKTPENSTTV.A	4.142578
*	cheesemanbim1-05.1312.1312.2	2.9442	0.3411	1903.8	8903.2	1	50.0%	1	K.MNIKPATSPNSSNAINPF.F	9.078125
*	cheesemanbim1-05.1676.1676.3	4.9926	0.3746	2819.08	6693.5	1	38.0%	1	K.MNIKPATSPNSSNAINPFFDPESPNK.G	6.5625
*	cheesemanbim1-06.1851.1851.3	5.0721	0.4705	3003.75	5141.8	1	32.4%	2	K.MNIKPATSPNSSNAINPFFDPESPNKGK.L	8.640625
*	cheesemanbim1-04.1702.1702.2	4.0436	0.4258	2331.84	7655.6	1	54.8%	1	K.PATSPNSSNAINPFFDPESPNK.G	4.4570312
*	cheesemanbim1-05.1343.1343.3	4.8135	0.3863	2517.56	8187.8	1	38.0%	1	K.PATSPNSSNAINPFFDPESPNKGK.L	6.5625
*	cheesemanbim1-04.2630.2630.2	3.3211	0.4416	2262.85	3654.6	1	42.1%	12	K.LILSSVPPLPYDETDETTLR.V	3.9648438
*	cheesemanbim1-03.1173.1173.2	4.3723	0.4159	1649.6	5471.4	1	73.1%	5	V.PPLPYDETDETTLR.V	3.9648438
*	cheesemanbim1-04.0901.0901.2	3.1964	0.279	1567.77	5995.3	1	61.5%	1	R.GENEKSPDSFITSR.H	4.716797
*	cheesemanbim1-04.1105.1105.1	2.2463	0.2714	1230.5	7236.0	2	60.0%	2	K.VQITETPLMAK.N	6.5625
*	cheesemanbim1-04.1103.1103.2	3.2862	0.1812	1232.3	4338.4	2	80.0%	1	K.VQITETPLMAK.N	6.5625
*	cheesemanbim1-06.1752.1752.2	3.9371	0.4486	1805.15	8550.0	1	65.4%	6	K.SVLDIEKDKWNHYR.S	7.328125
*	cheesemanbim1-04.0698.0698.2	2.7808	0.2254	1074.73	6805.0	1	72.2%	1	K.VTVENTPIAK.V	6.5625
*	cheesemanbim1-04.0652.0652.1	2.1195	0.1019	919.53	3830.6	20	64.3%	1	K.VFQTPPTK.I	9.078125
*	cheesemanbim1-04.0657.0657.2	2.55	0.1942	920.02	4349.2	2	85.7%	1	K.VFQTPPTK.I	9.078125
*	cheesemanbim1-05.0881.0881.2	2.8512	0.3555	1660.43	4595.2	1	67.9%	1	K.VFQTPPTKITTPNSQ.V	9.078125
*	cheesemanbim1-05.0638.0638.2	2.5277	0.1782	1413.35	7241.8	1	62.5%	1	F.QTPPTKITTPNSQ.V	9.078125
*	cheesemanbim1-04.1239.1239.2	3.5263	0.382	1588.53	6953.2	1	69.2%	2	K.ITTPNSQVWVPSTR.R	10.0625
KERATIN03	40	76	45.2%	593	59519	5.2	U	no description
*	cheesemanbim1-04.1486.1486.2	3.5684	0.4906	1709.43	8928.1	1	58.3%	1	K.GSLGGGFSSGGFSGGSFSR.G	10.0625
*	cheesemanbim1-04.0344.0344.2	2.5909	0.1669	995.08	4682.2	3	75.0%	1	L.SGNEKVTMQ.N	6.5625
	cheesemanbim1-04.0973.0973.2	3.0783	0.1829	1067.2	6077.9	1	87.5%	1	Q.NLNDRLASY.L	6.5625
	cheesemanbim1-05.0872.0872.2	2.7187	0.238	1065.39	7613.5	1	87.5%	1	R.LASYLDKVR.A	8.8046875
*	cheesemanbim1-04.0805.0805.2	3.0752	0.2305	1238.57	7613.8	1	83.3%	1	Y.YKTIDDLKNQ.I	6.5625
*	cheesemanbim1-04.0606.0606.2	2.8578	0.1637	1075.6	9722.1	10	75.0%	2	Y.KTIDDLKNQ.I	6.5625
*	cheesemanbim1-03.0578.0578.2	2.7589	0.0874	947.89	3027.4	6	85.7%	1	K.TIDDLKNQ.I	4.4570312
*	cheesemanbim1-06.3106.3106.3	3.546	0.1466	3054.04	9265.2	3	25.0%	2	K.TIDDLKNQILNLTTDNANILLQIDNAR.L	4.4023438
*	cheesemanbim1-05.2958.2958.3	6.2369	0.3439	2369.26	10399.0	1	48.8%	4	K.NQILNLTTDNANILLQIDNAR.L	4.4570312
*	cheesemanbim1-04.2290.2290.2	3.8325	0.286	1899.79	7542.8	1	62.5%	1	L.NLTTDNANILLQIDNAR.L	4.4570312
*	cheesemanbim1-03.1513.1513.2	4.1034	0.2943	1673.24	6701.7	1	75.0%	2	L.TTDNANILLQIDNAR.L	4.4570312
*	cheesemanbim1-03.0765.0765.2	3.0826	0.2264	995.61	4090.6	1	100.0%	2	K.YENEVALR.Q	4.4570312
*	cheesemanbim1-03.0711.0711.2	3.0326	0.2315	1122.4	7480.0	1	93.8%	2	K.YENEVALRQ.S	4.4570312
	cheesemanbim1-03.1059.1059.2	2.7741	0.2584	1203.34	4544.6	1	75.0%	3	R.QSVEADINGLR.R	4.4570312
*	cheesemanbim1-04.3780.3780.2	3.9193	0.4038	2097.75	8022.8	1	55.9%	2	K.ADLEMQIESLTEELAYLK.K	3.8554688
*	cheesemanbim1-06.2897.2897.2	4.3529	0.3149	2225.71	7828.3	1	52.8%	2	K.ADLEMQIESLTEELAYLKK.N	4.251953
*	cheesemanbim1-04.1893.1893.2	2.513	0.3075	1167.32	5646.2	1	66.7%	1	E.SLTEELAYLK.K	4.4570312
*	cheesemanbim1-05.0306.0306.2	2.805	0.0803	1273.78	7837.2	23	66.7%	1	K.KNHEEEMKDL.R	4.8945312
*	cheesemanbim1-03.3119.3119.3	4.7336	0.4121	2875.14	7951.9	1	31.7%	1	R.NVSTGDVNVEMNAAPGVDLTQLLNNMR.S	4.142578
*	cheesemanbim1-04.3224.3224.2	2.958	0.3294	1858.28	6110.6	1	59.4%	1	E.MNAAPGVDLTQLLNNMR.S	6.5625
*	cheesemanbim1-04.3108.3108.2	3.1608	0.324	1616.72	4480.8	1	57.1%	2	N.AAPGVDLTQLLNNMR.S	6.5625
*	cheesemanbim1-03.0716.0716.2	3.6701	0.2654	1365.76	8913.2	1	85.0%	1	R.SQYEQLAEQNR.K	4.4570312
*	cheesemanbim1-03.1137.1137.1	2.6856	0.3025	1111.51	4339.0	1	68.8%	2	K.DAEAWFNEK.S	4.142578
*	cheesemanbim1-03.1077.1077.2	4.0118	0.3839	1834.81	9652.0	1	60.0%	6	K.SKELTTEIDNNIEQIS.S	3.9648438
*	cheesemanbim1-04.2356.2356.2	4.8596	0.4016	2083.84	10642.0	1	61.8%	4	K.SKELTTEIDNNIEQISSY.K	3.9648438
*	cheesemanbim1-04.2288.2288.2	5.3329	0.4359	2213.81	8221.9	1	63.9%	5	K.SKELTTEIDNNIEQISSYK.S	4.4023438
*	cheesemanbim1-04.2127.2127.3	5.1816	0.2624	2214.39	5705.2	1	43.1%	1	K.SKELTTEIDNNIEQISSYK.S	4.4023438
*	cheesemanbim1-03.1292.1292.2	4.3116	0.4575	1999.34	7165.2	1	68.8%	3	K.ELTTEIDNNIEQISSYK.S	3.9648438
*	cheesemanbim1-04.3050.3050.3	4.5048	0.3072	1798.71	9058.4	1	55.0%	1	R.NVQALEIELQSQLALK.Q	4.4570312
*	cheesemanbim1-03.1019.1019.2	4.139	0.4425	1394.37	6139.6	1	79.2%	3	K.QSLEASLAETEGR.Y	4.142578
*	cheesemanbim1-03.0574.0574.2	2.6336	0.3233	1100.23	6587.3	1	87.5%	1	S.LAETEGRYC.V	4.4570312
*	cheesemanbim1-06.3136.3136.2	6.0758	0.5109	2747.72	7997.9	1	61.4%	1	R.YCVQLSQIQAQISALEEQLQQIR.A	4.4570312
*	cheesemanbim1-06.3134.3134.3	5.9354	0.485	2748.83	4909.0	1	38.6%	1	R.YCVQLSQIQAQISALEEQLQQIR.A	4.4570312
*	cheesemanbim1-04.3133.3133.2	4.5787	0.3845	1997.49	8484.8	1	65.6%	1	S.QIQAQISALEEQLQQIR.A	4.4570312
*	cheesemanbim1-04.1059.1059.2	3.9335	0.1359	1228.51	8453.8	1	88.9%	1	S.ALEEQLQQIR.A	4.4570312
*	cheesemanbim1-03.0774.0774.2	3.3755	0.1379	1168.03	6607.9	1	93.8%	2	R.LENEIQTYR.S	4.4570312
*	cheesemanbim1-04.0777.0777.2	4.743	0.4878	1420.65	9166.0	1	78.6%	1	Y.RSLLEGEGSSGGGGR.G	6.5625
*	cheesemanbim1-04.1053.1053.2	4.6163	0.4468	1825.83	9200.0	1	68.4%	5	Y.RSLLEGEGSSGGGGRGGGSF.G	6.5625
*	cheesemanbim1-04.1208.1208.2	4.9972	0.5083	2158.8	7266.3	1	60.9%	1	Y.RSLLEGEGSSGGGGRGGGSFGGGY.G	6.5625
*	cheesemanbim1-01.1763.1763.2	3.497	0.3862	1469.36	7285.7	1	59.4%	2	L.LEGEGSSGGGGRGGGSF.G	4.4570312
KERATIN13	27	37	40.7%	643	65494	6.6	U	no description
*	cheesemanbim1-02.2680.2680.2	4.8913	0.1676	2123.48	8549.2	1	50.0%	1	Y.GGGGFGGGGFGGGGFGGGGIGGGGFGGF.G	6.125
*	cheesemanbim1-04.2558.2558.2	4.339	0.3931	1968.18	4609.3	1	56.2%	3	N.QSLLQPLNVEIDPEIQK.V	4.142578
*	cheesemanbim1-05.2423.2423.2	2.8004	0.3482	1640.71	7654.4	1	53.8%	1	K.SLNNQFASFIDKVR.F	9.078125
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	Q.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
*	cheesemanbim1-04.2125.2125.2	2.8349	0.3577	1384.26	5391.8	2	60.0%	1	R.THNLEPYFESF.I	4.4570312
*	cheesemanbim1-05.2557.2557.2	2.6691	0.2529	1611.59	6518.4	1	66.7%	1	R.THNLEPYFESFIN.N	4.4570312
*	cheesemanbim1-06.1403.1403.2	3.9338	0.2165	1465.83	6876.9	1	75.0%	1	Y.RNKYEDEINKR.T	8.640625
*	cheesemanbim1-06.1408.1408.3	3.9178	0.2961	1468.08	9201.5	1	65.0%	1	Y.RNKYEDEINKR.T	8.640625
*	cheesemanbim1-04.1039.1039.2	3.4696	0.3053	1267.75	6744.0	1	75.0%	4	R.TNAENEFVTIK.K	4.4570312
*	cheesemanbim1-04.0893.0893.2	3.223	0.3275	1394.82	7704.6	1	59.1%	1	R.TNAENEFVTIKK.D	6.5625
*	cheesemanbim1-04.2776.2776.2	3.4364	0.1207	1548.43	8533.7	3	62.5%	1	Q.AKLDNLQQEIDFL.T	4.142578
*	cheesemanbim1-02.2371.2371.2	2.5341	0.1044	1348.19	7035.5	1	75.0%	1	K.LDNLQQEIDFL.T	3.4726562
*	cheesemanbim1-02.2549.2549.2	2.9953	0.1508	1449.13	8864.1	1	68.2%	2	K.LDNLQQEIDFLT.A	3.4726562
*	cheesemanbim1-02.2840.2840.2	3.5206	0.1804	1520.49	8498.8	1	70.8%	2	K.LDNLQQEIDFLTA.L	3.4726562
*	cheesemanbim1-02.3656.3656.2	3.7894	0.271	2325.87	8841.4	1	47.4%	1	K.LDNLQQEIDFLTALYQAELS.Q	3.3359375
*	cheesemanbim1-02.3869.3869.2	3.9396	0.219	2583.7	6954.5	1	42.9%	1	K.LDNLQQEIDFLTALYQAELSQM.Q	3.3359375
*	cheesemanbim1-06.1715.1715.3	4.8261	0.5044	2502.72	7206.8	1	40.5%	1	K.SKAEAESLYQSKYEELQITAGR.H	4.8945312
*	cheesemanbim1-03.0651.0651.1	1.9706	0.1688	1125.45	6890.2	1	66.7%	1	K.AEAESLYQSK.Y	4.4570312
*	cheesemanbim1-03.0646.0646.2	3.2208	0.2927	1126.97	5859.1	1	88.9%	1	K.AEAESLYQSK.Y	4.4570312
*	cheesemanbim1-05.0940.0940.2	3.7151	0.3368	1847.86	7446.0	1	70.0%	2	K.KQISNLQQSISDAEQR.G	6.5625
*	cheesemanbim1-05.1292.1292.2	3.3206	0.1749	1529.57	6948.3	1	66.7%	2	A.KNKLNDLEDALQQ.A	4.716797
*	cheesemanbim1-05.2227.2227.2	2.8305	0.1864	1277.92	10146.4	1	75.0%	1	K.LALDLEIATYR.T	4.4570312
*	cheesemanbim1-03.0435.0435.2	2.7653	0.2346	1038.34	4266.0	1	81.2%	1	L.LEGEESRMS.G	4.142578
*	cheesemanbim1-04.0632.0632.2	5.8549	0.2687	2384.05	7966.7	1	46.7%	1	R.GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR.G	8.640625
*	cheesemanbim1-05.0743.0743.3	3.5705	0.2612	3314.15	9691.6	6	16.4%	1	R.GSYGSGGGSYGSGGSSYGSGGGGGGHGSYGSGSSSGGYR.G	8.5859375
ORFP:YGL123W	6	12	39.8%	254	27450	10.4	U	RPS2, Chr VII from 277618-278382 
*	cheesemanbim1-04.2946.2946.2	3.0175	0.2418	1216.53	6693.6	1	88.9%	1	K.ITTIEEIFLH.S	4.4570312
*	cheesemanbim1-05.3199.3199.2	4.7805	0.4365	1743.58	8089.4	1	71.4%	4	K.ITTIEEIFLHSLPVK.E	5.6328125
*	cheesemanbim1-04.3608.3608.3	3.7475	0.2472	2770.15	5458.0	1	35.9%	1	K.EFQIIDTLLPGLQDEVMNIKPVQK.Q	4.4023438
*	cheesemanbim1-06.1703.1703.2	3.9051	0.464	1731.73	4946.6	1	66.7%	1	R.GYWGTNLGQPHSLATK.T	8.8046875
*	cheesemanbim1-04.1913.1913.2	4.0175	0.4176	1836.8	8447.0	1	59.4%	4	K.LLQLAGVEDVYTQSNGK.T	4.4570312
*	cheesemanbim1-04.3580.3580.3	4.1431	0.4305	3189.3	7580.1	1	25.0%	1	Y.GFLTPNLWAEQPLPVSPLDIYSDEASAQK.K	3.9648438
NRL_1MCOH	19	50	38.3%	428	46852	8.9	U	owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain H... 
*	cheesemanbim1-05.1247.1247.1	2.2888	0.275	1186.51	5266.4	1	68.2%	1	K.GPSVFPLAPSSK.S	9.078125
*	cheesemanbim1-05.1225.1225.2	3.0202	0.2117	1187.24	4204.7	1	77.3%	2	K.GPSVFPLAPSSK.S	9.078125
*	cheesemanbim1-04.1075.1075.2	2.7569	0.3131	1322.67	7668.7	1	65.4%	1	K.STSGGTAALGCLVK.D	8.2578125
*	cheesemanbim1-04.3716.3716.3	4.1782	0.4115	3728.02	9114.2	1	23.5%	2	K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSL.S	5.359375
*	cheesemanbim1-04.3656.3656.3	3.6821	0.346	3814.7	9538.2	1	24.3%	1	K.DYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS.S	5.359375
*	cheesemanbim1-04.1516.1516.3	3.8976	0.2981	2141.58	7149.2	1	36.1%	1	R.TPEVTCVVVDVSHEDPQVK.F	4.4023438
*	cheesemanbim1-05.1407.1407.2	4.9143	0.298	2141.78	6235.4	1	61.1%	4	R.TPEVTCVVVDVSHEDPQVK.F	4.4023438
*	cheesemanbim1-03.2171.2171.2	3.637	0.4084	2400.73	8067.7	1	47.5%	4	R.TPEVTCVVVDVSHEDPQVKFN.W	4.4023438
*	cheesemanbim1-05.1469.1469.2	3.8762	0.3661	1678.62	7447.9	1	69.2%	3	K.FNWYVDGVQVHNAK.T	7.328125
*	cheesemanbim1-03.1208.1208.2	2.979	0.3073	1104.39	5083.8	1	93.8%	1	N.WYVDGVQVH.N	5.359375
*	cheesemanbim1-06.2546.2546.2	5.1498	0.449	1810.91	8000.4	1	63.3%	6	R.VVSVLTVLHQNWLDGK.E	7.328125
*	cheesemanbim1-06.2497.2497.2	3.5487	0.3975	2230.43	9835.3	1	50.0%	1	R.VVSVLTVLHQNWLDGKEYK.C	7.2460938
*	cheesemanbim1-05.1056.1056.2	3.2693	0.3025	1311.54	8033.3	1	75.0%	1	L.TVLHQNWLDGK.E	7.328125
*	cheesemanbim1-03.2187.2187.3	4.0935	0.2951	3816.47	8868.5	1	17.2%	4	T.KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK.T	4.8945312
*	cheesemanbim1-03.2167.2167.3	3.5879	0.2258	2546.64	6975.4	1	32.1%	1	K.GFYPSDIAVEWESNGQPENNYK.T	3.9648438
*	cheesemanbim1-03.2168.2168.2	5.1381	0.4685	2548.41	9555.7	1	50.0%	14	K.GFYPSDIAVEWESNGQPENNYK.T	3.9648438
*	cheesemanbim1-03.1122.1122.2	3.5099	0.4487	1993.75	5209.2	1	59.4%	1	S.DIAVEWESNGQPENNYK.T	3.9648438
*	cheesemanbim1-04.2262.2262.2	3.1474	0.3226	2313.57	5675.5	1	37.5%	1	N.GQPENNYKTTPPVLDSDGSFF.L	4.142578
*	cheesemanbim1-03.2180.2180.2	2.5556	0.3023	1674.48	8972.6	1	50.0%	1	T.PPVLDSDGSFFLYSK.L	4.4570312
gi|67568|pir||ELPG	26	36	35.7%	266	28821	8.1	U	pancreatic elastase (EC 3.4.21.36) I precursor - pig 
*	cheesemanbim1-06.1793.1793.2	3.2094	0.3826	2377.28	9628.0	1	40.0%	2	R.VVGGTEAQRNSWPSQISLQYR.S	9.078125
*	cheesemanbim1-06.1789.1789.3	4.2319	0.4265	2377.32	4913.1	1	38.8%	3	R.VVGGTEAQRNSWPSQISLQYR.S	9.078125
*	cheesemanbim1-04.1100.1100.2	2.6738	0.0807	1474.84	3695.6	5	58.3%	1	G.GTEAQRNSWPSQI.S	6.5625
*	cheesemanbim1-05.1327.1327.2	4.3049	0.5256	2121.99	9013.0	1	58.8%	1	G.GTEAQRNSWPSQISLQYR.S	9.078125
*	cheesemanbim1-06.1820.1820.2	2.9267	0.2701	1479.43	3810.2	1	72.7%	1	R.NSWPSQISLQYR.S	9.078125
*	cheesemanbim1-03.0404.0404.2	3.09	0.2	1271.48	7553.4	1	80.0%	1	G.EHNLNQNDGTE.Q	4.142578
*	cheesemanbim1-03.0391.0391.2	3.9393	0.3555	1399.43	7571.6	1	81.8%	2	G.EHNLNQNDGTEQ.Y	4.142578
*	cheesemanbim1-03.0602.0602.2	3.8754	0.3905	1562.47	11290.8	1	62.5%	3	G.EHNLNQNDGTEQY.V	4.142578
*	cheesemanbim1-03.0757.0757.2	4.4637	0.4336	1808.56	9400.4	1	60.0%	2	H.NLNQNDGTEQYVGVQK.I	4.4570312
*	cheesemanbim1-03.0650.0650.2	3.0328	0.1175	1224.51	8305.3	1	75.0%	1	N.DGTEQYVGVQK.I	4.4570312
*	cheesemanbim1-06.1532.1532.2	2.83	0.2462	1083.54	5985.8	1	87.5%	1	G.VQKIVVHPY.W	8.8046875
*	cheesemanbim1-06.1759.1759.2	3.1734	0.3885	1269.53	6254.0	1	88.9%	1	G.VQKIVVHPYW.N	8.8046875
*	cheesemanbim1-06.1771.1771.2	3.0969	0.3571	1884.73	8812.9	1	50.0%	1	G.VQKIVVHPYWNTDDVA.A	5.6328125
*	cheesemanbim1-04.1932.1932.2	2.9021	0.3349	1823.7	8121.3	1	46.7%	1	K.IVVHPYWNTDDVAAGY.D	4.4570312
*	cheesemanbim1-04.2401.2401.2	2.6976	0.3397	2119.6	7753.9	1	38.9%	1	K.IVVHPYWNTDDVAAGYDIA.L	4.142578
*	cheesemanbim1-04.3322.3322.2	2.5464	0.2538	2345.78	7359.3	1	35.0%	1	K.IVVHPYWNTDDVAAGYDIALL.R	4.142578
*	cheesemanbim1-05.2864.2864.2	5.4861	0.5061	2503.95	9806.8	1	54.8%	2	K.IVVHPYWNTDDVAAGYDIALLR.L	4.716797
*	cheesemanbim1-03.2431.2431.2	3.304	0.3579	1793.67	6376.2	1	80.0%	1	Y.WNTDDVAAGYDIALLR.L	4.142578
*	cheesemanbim1-05.2525.2525.2	4.8553	0.5195	1959.92	6459.4	1	64.7%	2	R.LAQSVTLNSYVQLGVLPR.A	9.078125
*	cheesemanbim1-05.2255.2255.2	3.2765	0.3867	1559.63	9714.7	1	57.7%	1	S.VTLNSYVQLGVLPR.A	9.078125
*	cheesemanbim1-05.1615.1615.2	3.3328	0.2438	1359.78	8607.1	1	72.7%	2	T.LNSYVQLGVLPR.A	9.078125
*	cheesemanbim1-05.1658.1658.2	3.4291	0.3472	1488.86	7209.3	1	61.5%	1	T.LNSYVQLGVLPRAG.T	9.078125
*	cheesemanbim1-04.1443.1443.2	3.1642	0.2511	1248.2	8686.4	1	85.0%	1	L.NSYVQLGVLPR.A	9.078125
*	cheesemanbim1-04.1441.1441.2	3.3127	0.4058	1133.33	8010.5	1	88.9%	1	N.SYVQLGVLPR.A	9.078125
*	cheesemanbim1-05.1037.1037.2	2.5758	0.2353	883.07	3859.9	1	92.9%	1	Y.VQLGVLPR.A	10.0625
*	cheesemanbim1-02.2924.2924.2	3.1043	0.3309	1537.3	9252.5	1	65.4%	1	R.VSAYISWINNVIAS.N	6.125
KERATIN22	22	27	34.6%	645	65865	8.0	U	no description
*	cheesemanbim1-05.2298.2298.3	4.8766	0.4717	2835.49	11477.5	1	29.3%	2	R.GGGFGGGSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F	10.0625
*	cheesemanbim1-06.1954.1954.2	3.4586	0.2101	2399.85	8721.8	1	44.8%	1	G.GSGFGGGSGFGGGSGFSGGGFGGGGFGGGR.F	10.0625
*	cheesemanbim1-05.1256.1256.2	2.6214	0.3494	1274.34	6192.3	1	64.3%	1	F.SGGGFGGGGFGGGRF.G	10.0625
*	cheesemanbim1-06.1631.1631.2	3.748	0.4565	1386.15	6208.6	1	80.0%	1	L.GGPGGFGPGGYPGGIH.E	7.328125
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	K.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
*	cheesemanbim1-05.2285.2285.2	2.8001	0.0909	1986.04	9182.4	2	43.8%	1	L.QQMNVGTRPINLEPIFQ.G	6.5625
*	cheesemanbim1-05.2025.2025.2	3.6663	0.3228	1598.86	4549.0	1	69.2%	3	M.NVGTRPINLEPIFQ.G	6.5625
*	cheesemanbim1-03.1874.1874.2	5.0374	0.5244	2129.63	9533.2	1	61.8%	2	R.TSQNSELNNMQDLVEDYK.K	3.9648438
*	cheesemanbim1-04.1762.1762.2	3.8306	0.3918	2256.38	9689.2	1	55.6%	1	R.TSQNSELNNMQDLVEDYKK.K	4.4023438
*	cheesemanbim1-03.0979.0979.2	2.8226	0.34	1209.91	4773.9	1	80.0%	1	R.TAAENDFVTLK.K	4.4570312
*	cheesemanbim1-05.2782.2782.3	3.7836	0.2914	3049.23	7238.3	1	26.9%	1	K.VLYDAEISQIHQSVTDTNVILSMDNSR.N	4.4023438
	cheesemanbim1-03.0674.0674.2	3.0591	0.2911	1108.62	4559.1	1	87.5%	1	K.AQYEEIAQR.S	4.4570312
	cheesemanbim1-03.0516.0516.2	2.8152	0.1683	911.71	3927.1	1	91.7%	1	Q.YEEIAQR.S	4.4570312
*	cheesemanbim1-03.0918.0918.2	3.8812	0.4121	1330.47	5990.2	1	81.8%	1	K.NVQDAIADAEQR.G	4.142578
*	cheesemanbim1-04.1968.1968.2	2.6832	0.1397	1614.75	8600.7	1	69.2%	1	R.NKLNDLEEALQQAK.E	4.716797
*	cheesemanbim1-03.1308.1308.2	4.2503	0.2454	1373.37	8249.8	1	77.3%	1	K.LNDLEEALQQAK.E	4.142578
*	cheesemanbim1-04.1411.1411.2	2.6217	0.1463	1030.01	4853.0	5	75.0%	1	Q.AKEDLARLL.R	6.5625
	cheesemanbim1-03.1051.1051.2	3.175	0.2338	1141.92	7848.7	1	81.2%	1	R.DYQELMNVK.L	4.4570312
	cheesemanbim1-04.1900.1900.2	3.8389	0.3636	1265.35	6533.2	1	90.0%	1	K.LALDVEIATYR.K	4.4570312
*	cheesemanbim1-04.0465.0465.2	4.0751	0.51	1742.84	6306.4	1	52.3%	1	R.GGSGGGGSISGGGYGSGGGSGGR.Y	9.078125
KERATIN02	17	23	33.8%	622	61987	5.2	U	no description
*	cheesemanbim1-04.0598.0598.2	3.3509	0.4026	1233.4	6335.9	1	80.0%	1	T.SGGGGGGGLGSGGSIR.S	10.0625
*	cheesemanbim1-04.0469.0469.2	2.5282	0.3214	1236.42	8489.7	1	58.3%	1	R.FSSSSGYGGGSSR.V	9.078125
*	cheesemanbim1-04.1982.1982.3	4.4652	0.4451	2706.44	10810.3	1	25.0%	1	R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G	8.8046875
*	cheesemanbim1-04.1357.1357.2	3.6205	0.5037	2023.77	8308.2	1	41.3%	1	Y.SYGGGSGGGFSASSLGGGFGGGSR.G	9.078125
*	cheesemanbim1-04.1228.1228.2	3.3855	0.5063	1773.36	8931.6	1	52.4%	1	Y.GGGSGGGFSASSLGGGFGGGSR.G	10.0625
*	cheesemanbim1-06.1992.1992.2	4.122	0.3601	2378.14	10121.0	1	50.0%	1	R.LASYLDKVQALEEANNDLENK.I	4.251953
*	cheesemanbim1-04.2122.2122.3	5.7107	0.3639	2379.76	9421.5	1	47.5%	3	R.LASYLDKVQALEEANNDLENK.I	4.251953
*	cheesemanbim1-03.1274.1274.2	3.0269	0.2911	1607.08	5316.6	1	75.0%	1	K.NYSPYYNTIDDLK.D	4.4570312
*	cheesemanbim1-05.3232.3232.3	4.5689	0.4023	2903.76	3616.8	1	34.4%	1	K.NYSPYYNTIDDLKDQIVDLTVGNNK.T	4.4023438
*	cheesemanbim1-04.3457.3457.2	4.3208	0.3375	2538.9	9608.9	1	52.4%	1	S.PYYNTIDDLKDQIVDLTVGNNK.T	4.4023438
*	cheesemanbim1-04.3086.3086.2	5.2315	0.5241	2278.76	10069.3	1	60.5%	1	Y.YNTIDDLKDQIVDLTVGNNK.T	4.4023438
*	cheesemanbim1-03.0829.0829.2	2.7596	0.1383	1160.22	4545.1	1	75.0%	1	R.QGVDADINGLR.Q	4.4570312
*	cheesemanbim1-03.2828.2828.2	3.8649	0.4076	2351.39	10339.5	1	42.1%	1	K.DIENQYETQITQIEHEVSSS.G	3.8554688
*	cheesemanbim1-04.3010.3010.3	5.1462	0.4986	3267.61	8154.3	1	31.2%	5	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E	4.1152344
*	cheesemanbim1-03.1651.1651.2	2.603	0.2575	2197.36	8753.6	1	44.4%	1	K.EIETYHNLLEGGQEDFESS.G	3.8007812
*	cheesemanbim1-03.0686.0686.2	4.2011	0.4229	1511.41	6909.9	1	75.0%	1	L.LEGGQEDFESSGAGK.I	3.9648438
*	cheesemanbim1-04.0750.0750.3	6.8309	0.5668	3224.89	11352.2	1	28.2%	1	R.GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK.S	4.716797
ORFP:YNL209W	16	23	30.0%	613	66595	5.5	U	SSB2, Chr XIV from 252058-253899 
	cheesemanbim1-03.2425.2425.2	5.2259	0.4698	2161.59	5331.5	1	66.7%	3	K.VIDVDGNPVIEVQYLEETK.T	3.8554688
	cheesemanbim1-03.2445.2445.3	5.1181	0.3344	2161.91	8832.9	1	41.7%	2	K.VIDVDGNPVIEVQYLEETK.T	3.8554688
	cheesemanbim1-04.2665.2665.2	3.3343	0.3526	1552.49	6286.2	1	69.2%	1	K.TFSPQEISAMVLTK.M	6.5625
	cheesemanbim1-03.0810.0810.2	3.1002	0.2828	1064.35	4854.7	1	88.9%	1	K.TGLDISDDAR.A	4.142578
	cheesemanbim1-03.1115.1115.2	4.0443	0.1812	1460.54	7142.3	1	80.8%	1	K.SQIDEVVLVGGSTR.I	4.4570312
	cheesemanbim1-04.2107.2107.1	1.8552	0.2111	1041.47	6695.7	1	68.8%	1	K.LLSDFFDGK.Q	4.4570312
	cheesemanbim1-03.0769.0769.2	2.8703	0.3302	1705.9	9456.7	1	59.4%	1	A.AVQGAILTGQSTSDETK.D	4.4570312
	cheesemanbim1-02.3008.3008.2	3.0477	0.2673	1311.48	4342.1	2	77.3%	1	E.TKDLLLLDVAPL.S	4.4570312
*	cheesemanbim1-04.1712.1712.2	3.8778	0.4477	2418.75	7457.4	1	57.5%	2	R.TFTTVSDNQTTVQFPVYQGER.V	4.4570312
*	cheesemanbim1-03.1089.1089.2	2.5118	0.1502	1869.39	8760.6	1	50.0%	1	V.SDNQTTVQFPVYQGER.V	4.4570312
	cheesemanbim1-04.3950.3950.2	3.9583	0.4213	2669.86	4206.0	1	50.0%	2	K.NIPMMPAGEPVLEAIFEVDANGILK.V	3.9648438
	cheesemanbim1-04.3880.3880.3	4.0593	0.2241	2672.45	9631.9	1	31.2%	1	K.NIPMMPAGEPVLEAIFEVDANGILK.V	3.9648438
	cheesemanbim1-05.2916.2916.2	2.7994	0.1968	2451.91	5908.2	6	33.3%	1	R.QRLESYVASIEQTVTDPVLSSK.L	4.716797
	cheesemanbim1-03.2651.2651.2	3.5882	0.5068	2167.93	7707.6	1	55.3%	2	R.LESYVASIEQTVTDPVLSSK.L	4.142578
	cheesemanbim1-03.1043.1043.2	3.1968	0.379	1504.96	5515.2	1	65.4%	1	A.SIEQTVTDPVLSSK.L	4.4570312
	cheesemanbim1-04.3381.3381.2	4.7616	0.3689	2411.78	10173.1	1	45.5%	2	K.IEAALSDALAALQIEDPSADELR.K	3.8007812
ORFP:YDL229W	15	21	29.2%	613	66602	5.4	U	SSB1, Chr IV from 44066-45907 
	cheesemanbim1-03.2425.2425.2	5.2259	0.4698	2161.59	5331.5	1	66.7%	3	K.VIDVDGNPVIEVQYLEETK.T	3.8554688
	cheesemanbim1-03.2445.2445.3	5.1181	0.3344	2161.91	8832.9	1	41.7%	2	K.VIDVDGNPVIEVQYLEETK.T	3.8554688
	cheesemanbim1-04.2665.2665.2	3.3343	0.3526	1552.49	6286.2	1	69.2%	1	K.TFSPQEISAMVLTK.M	6.5625
	cheesemanbim1-03.0810.0810.2	3.1002	0.2828	1064.35	4854.7	1	88.9%	1	K.TGLDISDDAR.A	4.142578
	cheesemanbim1-03.1115.1115.2	4.0443	0.1812	1460.54	7142.3	1	80.8%	1	K.SQIDEVVLVGGSTR.I	4.4570312
	cheesemanbim1-04.2107.2107.1	1.8552	0.2111	1041.47	6695.7	1	68.8%	1	K.LLSDFFDGK.Q	4.4570312
	cheesemanbim1-03.0769.0769.2	2.8703	0.3302	1705.9	9456.7	1	59.4%	1	A.AVQGAILTGQSTSDETK.D	4.4570312
	cheesemanbim1-02.3008.3008.2	3.0477	0.2673	1311.48	4342.1	2	77.3%	1	E.TKDLLLLDVAPL.S	4.4570312
*	cheesemanbim1-03.1098.1098.2	3.2538	0.313	1853.83	7357.8	1	60.0%	1	C.ADNQTTVQFPVYQGER.V	4.4570312
	cheesemanbim1-04.3950.3950.2	3.9583	0.4213	2669.86	4206.0	1	50.0%	2	K.NIPMMPAGEPVLEAIFEVDANGILK.V	3.9648438
	cheesemanbim1-04.3880.3880.3	4.0593	0.2241	2672.45	9631.9	1	31.2%	1	K.NIPMMPAGEPVLEAIFEVDANGILK.V	3.9648438
	cheesemanbim1-05.2916.2916.2	2.7994	0.1968	2451.91	5908.2	6	33.3%	1	R.QRLESYVASIEQTVTDPVLSSK.L	4.716797
	cheesemanbim1-03.2651.2651.2	3.5882	0.5068	2167.93	7707.6	1	55.3%	2	R.LESYVASIEQTVTDPVLSSK.L	4.142578
	cheesemanbim1-03.1043.1043.2	3.1968	0.379	1504.96	5515.2	1	65.4%	1	A.SIEQTVTDPVLSSK.L	4.4570312
	cheesemanbim1-04.3381.3381.2	4.7616	0.3689	2411.78	10173.1	1	45.5%	2	K.IEAALSDALAALQIEDPSADELR.K	3.8007812
ORFP:YLL024C	16	21	27.4%	639	69470	5.1	U	SSA2, Chr XII from 95565-97484, reverse complement 
*	cheesemanbim1-04.1139.1139.2	3.0218	0.132	1594.72	5230.0	1	67.9%	2	K.NQAAMNPANTVFDAK.R	6.5625
*	cheesemanbim1-03.0803.0803.2	3.0443	0.1777	1394.44	5765.3	4	72.7%	1	R.NFNDPEVQGDMK.H	4.142578
	cheesemanbim1-04.2704.2704.2	2.6607	0.1184	1553.51	5501.3	2	65.4%	1	K.NFTPEQISSMVLGK.M	6.5625
	cheesemanbim1-03.1363.1363.2	2.6069	0.1475	1896.89	3899.4	3	53.1%	1	K.VNDAVVTVPAYFNDSQR.Q	4.4570312
	cheesemanbim1-04.1895.1895.2	3.9912	0.4102	1660.11	5709.2	1	70.0%	1	R.IINEPTAAAIAYGLDK.K	4.4570312
	cheesemanbim1-04.0793.0793.2	3.3375	0.4543	1676.57	6248.8	1	73.3%	1	K.ATAGDTHLGGEDFDNR.L	4.4023438
	cheesemanbim1-06.1733.1733.2	3.6933	0.3527	1275.65	7269.6	1	83.3%	1	R.LVNHFIQEFK.R	7.328125
	cheesemanbim1-03.2976.2976.2	6.0382	0.5977	2580.88	7849.2	1	52.0%	3	R.SINPDEAVAYGAAVQAAILTGDESSK.T	3.9648438
	cheesemanbim1-03.0843.0843.2	2.7119	0.1628	1390.42	8228.0	1	61.5%	1	A.AVQAAILTGDESSK.T	4.4570312
	cheesemanbim1-03.0484.0484.2	2.7557	0.3416	1179.22	6030.1	1	85.0%	1	A.ILTGDESSKTQ.D	4.4570312
	cheesemanbim1-02.3008.3008.2	3.0477	0.2673	1311.48	4342.1	2	77.3%	1	K.TQDLLLLDVAPL.S	3.5546875
	cheesemanbim1-04.3736.3736.2	5.8004	0.5353	2556.14	4891.3	1	52.1%	3	K.TQDLLLLDVAPLSLGIETAGGVMTK.L	4.142578
	cheesemanbim1-04.3738.3738.3	3.993	0.3716	2558.73	8173.7	1	35.4%	1	K.TQDLLLLDVAPLSLGIETAGGVMTK.L	4.142578
	cheesemanbim1-03.2282.2282.2	3.5185	0.4524	1761.58	5548.6	1	67.6%	1	L.DVAPLSLGIETAGGVMTK.L	4.4570312
	cheesemanbim1-05.2914.2914.3	4.5209	0.3911	2713.83	11798.7	1	37.0%	1	K.KSEVFSTYADNQPGVLIQVFEGER.A	4.4023438
	cheesemanbim1-04.2690.2690.2	3.922	0.41	1774.21	6309.7	1	63.3%	1	Y.ADNQPGVLIQVFEGER.A	4.142578
ORFP:YAL005C	15	19	25.5%	642	69768	5.1	U	SSA1, Chr I from 139501-141429, reverse complement 
*	cheesemanbim1-03.0851.0851.2	3.2053	0.2226	1408.36	6188.8	1	81.8%	1	R.NFNDPEVQADMK.H	4.142578
	cheesemanbim1-04.2704.2704.2	2.6607	0.1184	1553.51	5501.3	2	65.4%	1	K.NFTPEQISSMVLGK.M	6.5625
	cheesemanbim1-03.1363.1363.2	2.6069	0.1475	1896.89	3899.4	3	53.1%	1	K.VNDAVVTVPAYFNDSQR.Q	4.4570312
	cheesemanbim1-04.1895.1895.2	3.9912	0.4102	1660.11	5709.2	1	70.0%	1	R.IINEPTAAAIAYGLDK.K	4.4570312
	cheesemanbim1-04.0793.0793.2	3.3375	0.4543	1676.57	6248.8	1	73.3%	1	K.ATAGDTHLGGEDFDNR.L	4.4023438
	cheesemanbim1-06.1733.1733.2	3.6933	0.3527	1275.65	7269.6	1	83.3%	1	R.LVNHFIQEFK.R	7.328125
	cheesemanbim1-03.2976.2976.2	6.0382	0.5977	2580.88	7849.2	1	52.0%	3	R.SINPDEAVAYGAAVQAAILTGDESSK.T	3.9648438
	cheesemanbim1-03.0843.0843.2	2.7119	0.1628	1390.42	8228.0	1	61.5%	1	A.AVQAAILTGDESSK.T	4.4570312
	cheesemanbim1-03.0484.0484.2	2.7557	0.3416	1179.22	6030.1	1	85.0%	1	A.ILTGDESSKTQ.D	4.4570312
	cheesemanbim1-02.3008.3008.2	3.0477	0.2673	1311.48	4342.1	2	77.3%	1	K.TQDLLLLDVAPL.S	3.5546875
	cheesemanbim1-04.3736.3736.2	5.8004	0.5353	2556.14	4891.3	1	52.1%	3	K.TQDLLLLDVAPLSLGIETAGGVMTK.L	4.142578
	cheesemanbim1-04.3738.3738.3	3.993	0.3716	2558.73	8173.7	1	35.4%	1	K.TQDLLLLDVAPLSLGIETAGGVMTK.L	4.142578
	cheesemanbim1-03.2282.2282.2	3.5185	0.4524	1761.58	5548.6	1	67.6%	1	L.DVAPLSLGIETAGGVMTK.L	4.4570312
	cheesemanbim1-04.2690.2690.2	3.922	0.41	1774.21	6309.7	1	63.3%	1	Y.ADNQPGVLIQVFEGER.A	4.142578
*	cheesemanbim1-03.1145.1145.2	2.935	0.1412	1360.4	6121.0	2	68.2%	1	K.ELQDIANPIMSK.L	4.4570312
ORFP:YDR450W	3	4	21.2%	146	17038	10.3	U	RPS18A, Chr IV from 1359912-1359958,1360394-1360787 
ORFP:YML026C	3	4	21.2%	146	17038	10.3	U	RPS18B, Chr XIII from 222987-223033,223435-223828, reverse complement 
	cheesemanbim1-03.0783.0783.2	3.2998	0.2667	1275.44	7466.2	1	75.0%	1	R.AGELTQEELER.I	3.9648438
	cheesemanbim1-06.1617.1617.2	4.1053	0.3894	1475.72	9156.6	1	77.3%	2	R.IVQIMQNPTHYK.I	8.8046875
	cheesemanbim1-06.2042.2042.2	2.5162	0.3586	1018.04	4200.5	1	92.9%	1	K.IPAWFLNR.Q	10.0625
NRL_1MCOL	4	6	20.4%	216	22815	6.3	U	owl|| Immunoglobulin g1 (igg1) (mcg) with a hinge deletion, chain L... 
*	cheesemanbim1-04.2272.2272.2	2.6511	0.311	1555.33	4254.2	1	57.7%	1	L.ISDFYPGAVTVAWK.A	6.5625
*	cheesemanbim1-05.2121.2121.2	3.9159	0.3591	1746.24	7604.5	1	57.1%	3	K.YAASSYLSLTPEQWK.S	6.5625
*	cheesemanbim1-04.1861.1861.2	2.5121	0.1369	1353.29	5480.7	1	70.0%	1	S.SYLSLTPEQWK.S	6.5625
*	cheesemanbim1-04.0395.0395.2	3.7889	0.505	1712.53	6123.0	1	67.9%	1	R.SYSCQVTHEGSTVEK.T	5.6328125
gi|135017|sp|P07518|SUBT_BACPU	4	5	18.5%	275	27656	6.8	U	SUBTILISIN (ALKALINE MESENTERICOPEPTIDASE) 
*	cheesemanbim1-05.0867.0867.1	2.0685	0.133	742.59	2191.4	1	75.0%	1	S.QIKAPAL.H	9.078125
*	cheesemanbim1-03.0960.0960.2	3.9611	0.3294	1357.39	5325.1	1	79.2%	1	A.VIDSGIDSSHPDL.N	4.142578
*	cheesemanbim1-04.3503.3503.2	2.6732	0.1493	2261.63	7053.6	3	32.6%	1	A.GTIAALNNSIGVLGVAPSSALYAV.K	6.125
*	cheesemanbim1-01.3738.3738.1	2.3607	0.1568	838.39	5043.6	27	75.0%	2	N.NMDVINM.S	3.7460938
ORFP:YLR075W	3	5	18.1%	221	25361	10.0	U	RPL10, Chr XII from 282928-283593 
*	cheesemanbim1-05.3720.3720.3	5.4259	0.4579	3230.95	7669.2	1	32.1%	2	K.ATVDEFPLCVHLVSNELEQLSSEALEAAR.I	4.1152344
*	cheesemanbim1-04.3169.3169.2	3.7253	0.3212	1959.98	9222.9	1	55.9%	2	H.LVSNELEQLSSEALEAAR.I	3.9648438
*	cheesemanbim1-04.3066.3066.2	4.1008	0.4152	1247.93	8375.7	1	85.0%	1	R.VDIGQIIFSVR.T	6.5625
KERATIN05	7	7	17.4%	471	51531	5.2	U	no description
	cheesemanbim1-04.0973.0973.2	3.0783	0.1829	1067.2	6077.9	1	87.5%	1	Q.NLNDRLASY.L	6.5625
	cheesemanbim1-05.0872.0872.2	2.7187	0.238	1065.39	7613.5	1	87.5%	1	R.LASYLDKVR.A	8.8046875
*	cheesemanbim1-04.2445.2445.2	4.8006	0.5039	2055.76	10271.6	1	72.2%	1	K.ILTATVDNANVLLQIDNAR.L	4.4570312
*	cheesemanbim1-03.1207.1207.2	4.496	0.5058	2086.76	5705.4	1	50.0%	1	R.GQVGGDVNVEMDAAPGVDLSR.I	3.9648438
*	cheesemanbim1-03.1904.1904.2	2.9417	0.2984	1173.48	6406.5	1	81.2%	1	K.DAEEWFFTK.T	4.142578
	cheesemanbim1-03.0590.0590.2	3.1223	0.2659	1276.59	5199.3	1	70.0%	1	K.TEELNREVATN.S	4.142578
	cheesemanbim1-03.0636.0636.2	3.5629	0.3328	1362.49	8431.3	1	70.8%	1	R.EVATNSELVQSGK.S	4.4570312
ORFP:YNL178W	2	3	14.2%	240	26503	9.4	U	RPS3, Chr XIV from 302677-303399 
*	cheesemanbim1-05.3475.3475.2	4.26	0.4543	1993.65	8456.1	1	75.0%	2	K.LVADGVFYAELNEFFTR.E	4.142578
*	cheesemanbim1-03.0815.0815.2	3.4479	0.4349	1905.58	4667.7	1	56.2%	1	K.DYRPAEETEAQAEPVEA.-	3.8007812
ORFP:YJR045C	5	7	13.1%	654	70628	5.6	U	SSC1, Chr X from 519330-521294, reverse complement 
*	cheesemanbim1-04.3001.3001.2	5.0956	0.5734	2260.85	7063.7	1	61.4%	2	K.VQGSVIGIDLGTTNSAVAIMEGK.V	4.4570312
*	cheesemanbim1-04.1421.1421.2	2.7303	0.2316	1533.2	5655.7	6	50.0%	1	R.QAVVNPENTLFATK.R	6.5625
*	cheesemanbim1-04.1971.1971.2	4.2286	0.4219	1681.67	5687.1	1	70.0%	1	R.GQTYSPAQIGGFVLNK.M	8.8046875
*	cheesemanbim1-03.2824.2824.2	2.8582	0.2425	2007.52	7827.0	1	50.0%	2	K.DAGLSTSDISEVLLVGGMSR.M	4.142578
*	cheesemanbim1-03.0740.0740.2	2.8668	0.2182	1402.34	4676.0	1	79.2%	1	R.VQGGEEVNAEELK.T	3.9648438
gi|89258|pir||A26823	3	3	12.6%	269	28699	8.0	U	pancreatic elastase II (EC 3.4.21.71) precursor - pig 
*	cheesemanbim1-04.2618.2618.2	2.9718	0.38	2127.23	5920.6	1	44.4%	1	R.VVGGEDARPNSWPWQVSLQ.Y	4.4570312
*	cheesemanbim1-02.3094.3094.2	2.6008	0.1609	1494.49	7799.1	1	62.5%	1	R.VSNYIDWINSVIA.N	3.7460938
*	cheesemanbim1-02.3081.3081.2	2.5992	0.1804	1724.3	4900.9	1	53.6%	1	R.VSNYIDWINSVIANN.-	3.7460938
KERATIN17	8	11	11.0%	590	62461	8.1	U	no description
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	K.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-04.3317.3317.2	4.1551	0.4775	1891.71	4728.3	1	75.0%	3	R.QNLEPLFEQYINNLR.R	4.4570312
*	cheesemanbim1-03.0604.0604.2	3.5369	0.2976	1195.42	7240.7	1	94.4%	1	K.YEELQQTAGR.H	4.4570312
	cheesemanbim1-03.0452.0452.1	1.9097	0.1545	817.56	6769.0	3	64.3%	1	R.GELALKDA.R	4.4570312
*	cheesemanbim1-03.1064.1064.2	3.1725	0.1807	1146.01	7510.4	1	88.9%	1	K.LAELEEALQK.A	4.142578
	cheesemanbim1-04.1900.1900.2	3.8389	0.3636	1265.35	6533.2	1	90.0%	1	K.LALDVEIATYR.K	4.4570312
KERATIN18	8	12	10.3%	562	59822	8.0	U	no description
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	K.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-04.3317.3317.2	4.1551	0.4775	1891.71	4728.3	1	75.0%	3	R.QNLEPLFEQYINNLR.R	4.4570312
	cheesemanbim1-03.2159.2159.2	3.3787	0.2483	1408.4	8098.5	1	81.8%	2	K.ADTLTDEINFLR.A	4.142578
	cheesemanbim1-03.0674.0674.2	3.0591	0.2911	1108.62	4559.1	1	87.5%	1	K.AQYEEIAQR.S	4.4570312
	cheesemanbim1-03.0516.0516.2	2.8152	0.1683	911.71	3927.1	1	91.7%	1	Q.YEEIAQR.S	4.4570312
	cheesemanbim1-04.1900.1900.2	3.8389	0.3636	1265.35	6533.2	1	90.0%	1	K.LALDVEIATYR.K	4.4570312
ORFP:YCL018W	2	2	9.9%	364	38953	5.8	U	LEU2, Chr III from 91323-92417 
*	cheesemanbim1-05.1045.1045.2	3.0869	0.2871	1297.26	7753.6	3	61.5%	1	K.KADAVLLGAVGGPK.W	8.8046875
*	cheesemanbim1-03.1152.1152.2	4.8336	0.5107	2136.45	7487.3	1	57.1%	1	R.TGDLGGSNSTTEVGDAVAEEVK.K	3.8554688
KERATIN08	3	3	7.5%	469	50499	5.0	U	no description
	cheesemanbim1-04.0973.0973.2	3.0783	0.1829	1067.2	6077.9	1	87.5%	1	Q.NLNDRLASY.L	6.5625
	cheesemanbim1-05.0872.0872.2	2.7187	0.238	1065.39	7613.5	1	87.5%	1	R.LASYLDKVR.A	8.8046875
*	cheesemanbim1-03.1114.1114.2	4.179	0.1063	2088.54	5965.0	1	45.0%	1	R.GQTGGDVNVEMDAAPGVDLSR.I	3.9648438
KERATIN15	6	8	7.0%	629	64511	6.5	U	no description
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	K.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
*	cheesemanbim1-03.2732.2732.1	2.6121	0.1106	1304.6	3618.0	25	50.0%	2	R.SLDLDSIIAEVGA.Q	3.4726562
	cheesemanbim1-03.1051.1051.2	3.175	0.2338	1141.92	7848.7	1	81.2%	1	R.DYQELMNVK.L	4.4570312
	cheesemanbim1-04.1900.1900.2	3.8389	0.3636	1265.35	6533.2	1	90.0%	1	K.LALDVEIATYR.K	4.4570312
KERATIN20	5	6	6.2%	483	53748	5.4	U	no description
	cheesemanbim1-05.1138.1138.2	2.6918	0.1889	1083.78	8082.3	1	93.8%	2	K.FASFIDKVR.F	9.078125
	cheesemanbim1-06.1901.1901.1	1.8237	0.1368	1037.8	3532.5	12	71.4%	1	S.FIDKVRFL.E	9.078125
	cheesemanbim1-06.1900.1900.2	2.5102	0.1473	1038.49	4440.9	21	78.6%	1	S.FIDKVRFL.E	9.078125
*	cheesemanbim1-03.0452.0452.1	1.9097	0.1545	817.56	6769.0	3	64.3%	1	R.GELAIKDA.N	4.4570312
	cheesemanbim1-05.2227.2227.2	2.8305	0.1864	1277.92	10146.4	1	75.0%	1	K.LALDIEIATYR.K	4.4570312
KERATIN07	2	2	5.9%	473	50915	5.5	U	no description
	cheesemanbim1-05.0872.0872.2	2.7187	0.238	1065.39	7613.5	1	87.5%	1	R.LASYLDKVR.A	8.8046875
*	cheesemanbim1-04.2158.2158.2	3.3943	0.3913	2064.61	5893.7	1	52.8%	1	K.IIAATIENAQPILQIDNAR.L	4.4570312
GR78_HUMAN	2	2	4.3%	653	72116	5.1	U	owl|P11021| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
GR78_RAT	2	2	4.3%	654	72347	5.2	U	owl|P06761| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
GR78_MOUSE	2	2	4.3%	655	72421	5.2	U	owl|P20029| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
GR78_MESAU	2	2	4.3%	654	72379	5.2	U	owl|P07823| 78 KD GLUCOSE REGULATED PROTEIN PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
	cheesemanbim1-04.1895.1895.2	3.9912	0.4102	1660.11	5709.2	1	70.0%	1	R.IINEPTAAAIAYGLDK.R	4.4570312
	cheesemanbim1-04.1128.1128.2	2.7267	0.1449	1424.51	6727.8	3	59.1%	1	A.YSLKNQIGDKEK.L	8.6953125
KERATIN16	3	3	3.7%	534	57265	6.6	U	no description
	cheesemanbim1-03.0674.0674.2	3.0591	0.2911	1108.62	4559.1	1	87.5%	1	R.AQYEEIAQR.S	4.4570312
	cheesemanbim1-03.0516.0516.2	2.8152	0.1683	911.71	3927.1	1	91.7%	1	Q.YEEIAQR.S	4.4570312
	cheesemanbim1-05.2227.2227.2	2.8305	0.1864	1277.92	10146.4	1	75.0%	1	K.LALDIEIATYR.K	4.4570312
ORFP:YDR425W	1	13	3.2%	625	70741	7.0	U	YDR425W, Chr IV from 1320053-1321930 
*	cheesemanbim1-03.2115.2115.2	3.3173	0.1423	2250.74	7349.5	8	39.5%	13	F.NWKDVLSSSPIIILPLNNLL.A	6.5625
ORFP:YER033C	2	5	3.1%	1076	119350	4.9	U	ZRG8, Chr V from 218056-221286, reverse complement 
*	cheesemanbim1-04.2931.2931.2	2.873	0.0827	1943.09	11503.7	7	41.2%	1	N.RTTDSLPAIKGTITHSWG.D	9.078125
*	cheesemanbim1-04.3332.3332.2	2.8803	0.0978	1630.66	2905.9	298	42.9%	4	K.RLENGKETFNGNHGG.H	7.328125
	Proteins	Peptide IDs	Copies
Unfiltered	5628	20437	36773
Redundant	37	492	2003
Nonredundant	33	431	1925

Classification	Nonredundant Proteins	Redundant Proteins
Unclassified	0	0