DTASelect v2.0.26
/data/1/catclw/Projects/Jamie/Jamie_June2008/Alpha_SPB_red/splitted
/scratch/yates/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta
SEQUEST 3.0 in SQT format.
 --trypstat --cmax 4 --fp 0.9
true	Use criteria
0.0	Minimum peptide confidence
0.9	Peptide false positive rate
0.0	Minimum protein confidence
1.0	Protein false positive rate
1	Minimum charge state
16	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
false	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
true	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
1000	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus	Sequence Count	Spectrum Count	Sequence Coverage	Length	MolWt	pI	Validation Status	Descriptive Name
Unique	FileName	XCorr	DeltCN	Conf%	M+H+	CalcM+H+	TotalIntensity	SpR	ZScore	IonProportion	Redundancy	Sequence
YIL002W-A	15	17	98.6%	69	7729	4.7	U	YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" 
*	Jamie_Alpha_SPB_13.04464.04464.2	4.2535	0.3848	100.0	1447.5521	1448.5297	6514.1	1	7.747	76.9	1	M.TRDTPEDVSTAGAK.D
*	Jamie_Alpha_SPB_41.14755.14755.2	3.1587	0.328	100.0	2117.372	2117.3176	7346.6	1	6.026	52.6	1	M.TRDTPEDVSTAGAKDILDVL.N
*	Jamie_Alpha_SPB_59.21142.21142.3	6.0139	0.4293	100.0	2584.4944	2585.9146	9218.5	1	8.235	50.0	1	M.TRDTPEDVSTAGAKDILDVLNLLK.G
*	Jamie_Alpha_SPB_30.10854.10854.3	3.0616	0.2127	96.2	2062.7043	2064.3125	8908.3	1	4.163	36.8	1	K.GGEEKISEVELKLDEMEK.K
*	Jamie_Alpha_SPB_31.10897.10897.2	5.644	0.4397	100.0	2063.7322	2064.3125	8727.9	1	9.461	73.5	2	K.GGEEKISEVELKLDEMEK.K
*	Jamie_Alpha_SPB_31.11010.11010.4	3.4755	0.1347	92.5	2192.3765	2192.4866	7438.7	1	3.924	31.5	2	K.GGEEKISEVELKLDEMEKK.M
*	Jamie_Alpha_SPB_32.11360.11360.2	3.4046	0.3386	100.0	2192.5322	2192.4866	7341.3	1	7.225	47.2	1	K.GGEEKISEVELKLDEMEKK.M
*	Jamie_Alpha_SPB_31.11064.11064.3	4.5702	0.3108	100.0	2192.5444	2192.4866	7007.3	1	6.256	38.9	1	K.GGEEKISEVELKLDEMEKK.M
*	Jamie_Alpha_SPB_26.09086.09086.2	2.4202	0.2531	100.0	1563.0322	1563.8036	6283.3	1	4.806	62.5	1	K.ISEVELKLDEMEK.K
*	Jamie_Alpha_SPB_37.13146.13146.3	2.7596	0.1788	95.8	1698.0543	1697.9904	4962.9	255	4.743	36.5	1	K.KMDSLLVQLEDLHR.D
*	Jamie_Alpha_SPB_37.13190.13190.2	2.8238	0.0334	94.7	1699.7722	1697.9904	6841.3	1	3.296	50.0	1	K.KMDSLLVQLEDLHR.D
*	Jamie_Alpha_SPB_37.13372.13372.3	3.3476	0.3665	100.0	2425.7344	2427.6917	8310.8	3	5.547	28.8	1	K.MDSLLVQLEDLHRDNNDLAKS.S
*	Jamie_Alpha_SPB_20.07207.07207.3	3.0036	0.2484	92.3	1894.1344	1894.0946	5060.4	3	4.925	43.3	1	L.LVQLEDLHRDNNDLAK.S
*	Jamie_Alpha_SPB_20.07178.07178.2	2.8058	0.1689	87.5	1895.0322	1894.0946	8374.1	1	4.369	53.3	1	L.LVQLEDLHRDNNDLAK.S
*	Jamie_Alpha_SPB_14.05037.05037.2	1.902	0.1373	28.0	1957.4922	1958.0519	4515.7	5	3.961	37.5	1	L.EDLHRDNNDLAKSSSQK.-
YIL149C	165	206	61.6%	1679	195140	6.0	U	MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" 
*	Jamie_Alpha_SPB_43.15235.15235.3	2.7608	0.0115	40.8	2595.0244	2590.9768	7468.8	270	2.798	23.8	1	K.IAKFERSEEEVTKLNVLVDEIK.S
*	Jamie_Alpha_SPB_50.17998.17998.4	3.1859	0.0229	51.7	3379.0566	3375.8035	7272.8	120	3.259	19.1	1	K.IAKFERSEEEVTKLNVLVDEIKSQYYSR.I
*	Jamie_Alpha_SPB_37.13123.13123.3	6.5838	0.3997	100.0	3503.3044	3501.8296	9579.2	1	7.035	32.8	2	K.LKQLLDESSEQKNTAKEELNGLKDQLNEER.S
*	Jamie_Alpha_SPB_37.13194.13194.4	5.1427	0.31	100.0	3503.4165	3501.8296	6506.6	1	6.168	24.1	4	K.LKQLLDESSEQKNTAKEELNGLKDQLNEER.S
*	Jamie_Alpha_SPB_38.13638.13638.3	3.4729	0.315	100.0	3744.6243	3745.0952	10379.0	11	5.657	18.5	2	K.LKQLLDESSEQKNTAKEELNGLKDQLNEERSR.Y
*	Jamie_Alpha_SPB_38.13402.13402.4	3.174	0.0127	46.7	3746.9365	3745.0952	9700.7	1	4.144	20.4	1	K.LKQLLDESSEQKNTAKEELNGLKDQLNEERSR.Y
*	Jamie_Alpha_SPB_33.11850.11850.4	4.3804	0.2629	100.0	3262.2966	3260.496	6081.7	1	5.079	25.9	1	K.QLLDESSEQKNTAKEELNGLKDQLNEER.S
*	Jamie_Alpha_SPB_18.06356.06356.2	3.4196	0.083	99.5	2103.7722	2102.2656	5475.0	1	4.02	52.9	1	K.NTAKEELNGLKDQLNEER.S
*	Jamie_Alpha_SPB_22.07740.07740.2	2.6435	0.3062	100.0	1687.6322	1687.804	5318.0	1	6.088	69.2	1	K.EELNGLKDQLNEER.S
*	Jamie_Alpha_SPB_16.05622.05622.2	2.5526	0.1514	81.7	1601.3922	1601.7344	6585.2	51	4.029	50.0	1	V.SHEAMREVNDEKR.V
*	Jamie_Alpha_SPB_21.07560.07560.3	2.5273	0.0297	51.2	1452.6843	1453.5944	5664.4	227	3.252	42.5	1	R.VKEEYDIWQSR.D
*	Jamie_Alpha_SPB_27.09556.09556.3	3.9395	0.1492	95.9	3253.8542	3254.4075	8997.2	4	4.639	24.0	1	R.VKEEYDIWQSRDQGNDSLNDDLNKENK.L
*	Jamie_Alpha_SPB_27.09657.09657.4	6.0683	0.2139	100.0	3256.7766	3254.4075	4320.0	1	5.895	28.8	2	R.VKEEYDIWQSRDQGNDSLNDDLNKENK.L
*	Jamie_Alpha_SPB_36.12951.12951.3	3.9623	0.3076	100.0	3636.9243	3636.9138	7006.8	1	6.125	24.1	1	R.VKEEYDIWQSRDQGNDSLNDDLNKENKLLR.R
*	Jamie_Alpha_SPB_23.08217.08217.2	4.0147	0.3403	100.0	1820.4922	1819.8363	7120.3	1	5.957	60.0	4	R.DQGNDSLNDDLNKENK.L
*	Jamie_Alpha_SPB_23.08340.08340.4	2.7148	0.0279	47.6	2202.4565	2202.3428	3805.1	3	3.686	33.3	1	R.DQGNDSLNDDLNKENKLLR.R
*	Jamie_Alpha_SPB_26.09138.09138.3	3.8136	0.3202	100.0	2358.7144	2358.5303	5536.6	2	5.05	31.6	1	R.DQGNDSLNDDLNKENKLLRR.K
*	Jamie_Alpha_SPB_23.08217.08217.3	3.9131	0.2159	66.7	2730.2344	2731.0562	7120.3	4	4.529	28.4	1	R.DQGNDSLNDDLNKENKLLRRKLM.E
*	Jamie_Alpha_SPB_32.11332.11332.2	2.2606	0.112	95.9	2016.1522	2016.2324	9398.5	8	4.964	40.0	1	K.LYQMQSNYESVFTYNK.F
*	Jamie_Alpha_SPB_18.06235.06235.2	2.8025	0.2957	100.0	1668.2722	1667.8564	6650.2	1	5.143	53.6	1	K.NLKDTASVEKAEFSK.E
*	Jamie_Alpha_SPB_19.06810.06810.2	1.9012	0.1332	94.9	1537.2922	1537.6764	5434.3	21	3.885	37.5	1	R.SQLTSLEKDCSLR.A
*	Jamie_Alpha_SPB_36.12882.12882.4	6.9505	0.3863	100.0	3311.5366	3312.5408	8587.2	1	6.461	32.1	1	R.AIEKNDDNSCRNPEHTDVIDELIDTKLR.L
*	Jamie_Alpha_SPB_36.12933.12933.3	4.8495	0.3734	100.0	3313.3442	3312.5408	9869.0	1	6.476	31.5	1	R.AIEKNDDNSCRNPEHTDVIDELIDTKLR.L
*	Jamie_Alpha_SPB_40.14340.14340.4	5.3517	0.4244	100.0	3680.2566	3682.9897	9851.1	1	6.86	24.4	1	R.AIEKNDDNSCRNPEHTDVIDELIDTKLRLEK.S
*	Jamie_Alpha_SPB_40.14310.14310.3	3.5729	0.1556	95.0	3684.8044	3682.9897	8760.1	1	3.998	25.0	2	R.AIEKNDDNSCRNPEHTDVIDELIDTKLRLEK.S
*	Jamie_Alpha_SPB_32.11302.11302.3	3.326	0.0938	79.6	2600.6343	2601.666	7920.2	14	4.526	26.2	2	K.NDDNSCRNPEHTDVIDELIDTK.L
*	Jamie_Alpha_SPB_31.11136.11136.2	3.7136	0.3332	100.0	2601.392	2601.666	4606.7	1	6.296	45.2	1	K.NDDNSCRNPEHTDVIDELIDTK.L
*	Jamie_Alpha_SPB_33.11682.11682.3	4.652	0.1846	100.0	1740.3844	1739.8767	8883.6	1	4.985	50.0	1	R.NPEHTDVIDELIDTK.L
*	Jamie_Alpha_SPB_4.01306.01306.1	1.647	0.2581	100.0	759.3	758.8931	6619.1	1	4.845	71.4	1	S.AVSPTVGK.L
*	Jamie_Alpha_SPB_66.23682.23682.4	4.4868	0.2837	100.0	3717.3364	3717.2163	8063.4	1	5.398	22.4	1	R.NQKFQLQNQLEDFILELEHKTPELISFKER.T
*	Jamie_Alpha_SPB_60.21495.21495.2	2.1692	0.1938	99.5	2145.652	2145.4197	8096.2	3	4.757	37.5	1	K.FQLQNQLEDFILELEHK.T
*	Jamie_Alpha_SPB_20.07170.07170.2	3.3554	0.3426	100.0	1240.7922	1241.4331	7227.8	1	6.095	88.9	1	R.TKSLEHELKR.S
*	Jamie_Alpha_SPB_25.08868.08868.3	4.3079	0.2349	100.0	2374.6443	2374.6104	7673.3	1	5.786	41.2	1	R.KILESSNIVNENDSQAIITER.L
*	Jamie_Alpha_SPB_26.09093.09093.2	3.1842	0.3044	100.0	2374.672	2374.6104	8436.5	1	5.912	50.0	1	R.KILESSNIVNENDSQAIITER.L
*	Jamie_Alpha_SPB_20.07035.07035.2	3.0161	0.179	94.1	1805.8922	1803.9237	8135.4	2	4.641	50.0	1	S.SNIVNENDSQAIITER.L
*	Jamie_Alpha_SPB_24.08586.08586.2	3.1383	0.2681	100.0	1548.0322	1549.721	8030.6	1	5.932	75.0	2	R.LVEFSNVNELQEK.N
*	Jamie_Alpha_SPB_47.16964.16964.2	2.6354	0.1387	70.6	2505.7522	2505.7937	9419.8	1	4.899	40.0	1	R.LVEFSNVNELQEKNVELLNCI.R
*	Jamie_Alpha_SPB_42.14880.14880.2	2.4218	0.1343	98.2	2661.2922	2661.9812	6667.8	1	4.178	42.9	1	R.LVEFSNVNELQEKNVELLNCIR.I
*	Jamie_Alpha_SPB_19.06658.06658.2	2.7946	0.091	98.3	1765.1322	1764.9731	7111.5	1	4.54	53.6	1	R.ILADKLENYEGKQDK.T
*	Jamie_Alpha_SPB_59.21126.21126.4	3.7304	0.0184	54.9	2955.3364	2955.3787	6358.0	2	3.343	25.3	1	K.TLQKVENQTIKEAKDAIIELENINAK.M
*	Jamie_Alpha_SPB_45.15961.15961.2	2.6336	0.3029	100.0	2384.4321	2385.677	6776.5	1	5.788	45.0	1	V.ENQTIKEAKDAIIELENINAK.M
*	Jamie_Alpha_SPB_30.10638.10638.3	3.2326	0.1696	14.0	2016.0844	2014.3269	8512.9	19	4.233	29.4	1	Q.TIKEAKDAIIELENINAK.M
*	Jamie_Alpha_SPB_30.10668.10668.1	2.4189	0.1919	100.0	1342.37	1343.5199	6758.4	2	5.191	59.1	1	K.DAIIELENINAK.M
*	Jamie_Alpha_SPB_30.10638.10638.2	4.9988	0.276	100.0	1344.3922	1343.5199	8512.9	1	6.13	81.8	1	K.DAIIELENINAK.M
*	Jamie_Alpha_SPB_19.06846.06846.2	2.0219	0.1624	43.2	1898.2922	1899.0215	9564.1	4	4.069	46.9	1	R.DSYKLLASTEENKANTN.S
*	Jamie_Alpha_SPB_20.07114.07114.2	3.2016	0.3741	100.0	2083.7922	2085.2322	5690.8	1	7.4	47.2	1	R.DSYKLLASTEENKANTNSV.T
*	Jamie_Alpha_SPB_24.08425.08425.2	1.2692	0.0077	63.5	2830.0122	2832.0686	7356.1	12	2.78	26.0	1	R.DSYKLLASTEENKANTNSVTSMEAAR.E
*	Jamie_Alpha_SPB_25.08728.08728.3	3.663	0.2099	95.9	2832.7144	2832.0686	10149.9	1	5.18	31.0	1	R.DSYKLLASTEENKANTNSVTSMEAAR.E
*	Jamie_Alpha_SPB_8.02747.02747.2	2.0155	0.2012	99.5	1003.6722	1005.11304	3712.2	1	4.695	87.5	1	K.LLASTEENK.A
*	Jamie_Alpha_SPB_22.07944.07944.1	1.5226	0.1113	12.9	1187.42	1188.3666	6317.9	19	3.918	44.4	1	K.KIRELEAELS.S
*	Jamie_Alpha_SPB_34.12255.12255.4	4.5023	0.2072	100.0	2742.1765	2743.133	9138.8	1	4.696	31.9	1	K.IRELEAELSSTKVENSAIIQNLRK.E
*	Jamie_Alpha_SPB_33.11599.11599.2	2.5096	0.2144	99.4	2345.5723	2345.612	6531.2	1	4.662	37.5	1	R.ELEAELSSTKVENSAIIQNLR.K
*	Jamie_Alpha_SPB_30.10712.10712.3	3.0472	0.0675	66.5	2476.6443	2473.7861	7827.7	1	3.85	28.6	1	R.ELEAELSSTKVENSAIIQNLRK.E
*	Jamie_Alpha_SPB_19.06817.06817.2	2.4318	0.1152	40.0	1701.0122	1701.9639	6862.0	1	4.17	57.1	1	S.STKVENSAIIQNLRK.E
*	Jamie_Alpha_SPB_30.10834.10834.2	2.871	0.334	100.0	1242.3722	1244.3434	6422.2	2	5.232	83.3	1	K.TTLEDFENFK.G
*	Jamie_Alpha_SPB_33.11725.11725.2	2.8096	0.2878	100.0	1612.9922	1613.8076	7139.7	1	5.422	57.7	1	K.TTLEDFENFKGLAK.E
*	Jamie_Alpha_SPB_19.06582.06582.2	3.2752	0.2814	100.0	1339.6721	1339.5345	5186.8	1	5.777	75.0	1	I.DHLKAELEKQK.S
*	Jamie_Alpha_SPB_21.07417.07417.3	2.1897	0.0967	60.2	2122.7644	2124.33	5213.8	167	3.273	29.4	1	R.LKESEISHNENKMDFSSK.E
*	Jamie_Alpha_SPB_21.07612.07612.2	2.0388	0.092	94.0	2123.6921	2124.33	5663.0	23	3.921	35.3	1	R.LKESEISHNENKMDFSSK.E
*	Jamie_Alpha_SPB_22.07884.07884.2	2.8823	0.2178	100.0	1457.6322	1457.67	7954.7	6	5.724	54.5	1	K.AKIKELENNLER.L
*	Jamie_Alpha_SPB_15.05354.05354.1	2.3273	0.1495	100.0	988.41	988.1289	4885.5	1	3.371	78.6	2	K.IQEIESIR.S
*	Jamie_Alpha_SPB_29.10304.10304.2	1.6888	0.0629	82.2	2024.4321	2024.2097	7656.4	12	3.622	37.5	1	K.DSQLKWAQNTIDDTEMK.M
*	Jamie_Alpha_SPB_33.11805.11805.2	2.8244	0.3731	100.0	2282.3123	2283.5764	7287.6	1	6.446	33.3	1	K.DSQLKWAQNTIDDTEMKMK.S
*	Jamie_Alpha_SPB_69.24691.24691.4	6.6569	0.4277	100.0	3234.4966	3234.6257	8704.7	1	7.319	35.8	3	K.SLLTELSNKETTIEKLSSEIENLDKELR.K
*	Jamie_Alpha_SPB_69.24558.24558.3	3.0528	0.1538	89.2	3237.4143	3234.6257	8726.3	4	4.021	22.2	1	K.SLLTELSNKETTIEKLSSEIENLDKELR.K
*	Jamie_Alpha_SPB_68.24405.24405.4	4.8545	0.2911	100.0	3364.6565	3362.7998	9077.9	1	4.946	26.2	1	K.SLLTELSNKETTIEKLSSEIENLDKELRK.T
*	Jamie_Alpha_SPB_17.05982.05982.2	3.1934	0.1967	100.0	1147.8922	1148.2554	6218.4	1	5.149	88.9	1	K.LSSEIENLDK.E
*	Jamie_Alpha_SPB_23.08191.08191.2	3.1921	0.1331	91.7	1434.5922	1433.5583	7478.0	1	4.073	81.8	1	L.SSEIENLDKELR.K
*	Jamie_Alpha_SPB_24.08545.08545.2	3.6091	0.1712	100.0	1562.5721	1561.7324	5675.9	1	4.44	75.0	1	L.SSEIENLDKELRK.T
*	Jamie_Alpha_SPB_27.09636.09636.3	3.1888	0.219	24.0	1662.7743	1662.8375	4895.3	6	4.414	40.4	1	L.SSEIENLDKELRKT.K
*	Jamie_Alpha_SPB_30.10729.10729.3	2.4522	0.0928	64.0	2502.4443	2502.7864	9375.3	3	3.506	27.5	1	K.FQYKFLDQNSDASTLEPTLRK.E
*	Jamie_Alpha_SPB_29.10363.10363.2	2.6969	0.1541	99.5	1809.1122	1807.9548	7958.3	2	3.945	53.3	1	K.FLDQNSDASTLEPTLR.K
*	Jamie_Alpha_SPB_60.21589.21589.2	3.8896	0.2923	100.0	2695.7722	2693.9243	6814.1	1	5.507	41.3	1	K.DANSQIQAYEEIISSNENALIELK.N
*	Jamie_Alpha_SPB_42.15032.15032.2	3.2683	0.338	100.0	2257.2322	2258.531	8149.1	2	5.704	42.1	1	Y.EEIISSNENALIELKNELAK.T
*	Jamie_Alpha_SPB_18.06261.06261.2	2.9244	0.3384	100.0	1580.0322	1581.7631	6676.6	1	6.187	62.5	1	K.TKENYDAKIELEK.K
*	Jamie_Alpha_SPB_119.42578.42578.3	2.2063	0.046	45.6	1966.7644	1967.2267	6275.2	293	3.127	35.0	1	K.TKENYDAKIELEKKEK.W
*	Jamie_Alpha_SPB_27.09496.09496.2	2.0055	0.1072	94.4	1967.7522	1967.2267	7723.4	18	4.053	36.7	1	K.TKENYDAKIELEKKEK.W
*	Jamie_Alpha_SPB_31.11004.11004.3	2.859	0.2014	96.6	2160.2944	2160.435	7695.3	2	4.844	40.6	1	K.IELEKKEKWAREEDLSR.L
*	Jamie_Alpha_SPB_18.06457.06457.2	2.2761	0.0031	86.1	1419.0721	1419.537	4184.7	406	3.403	55.0	1	K.EKWAREEDLSR.L
*	Jamie_Alpha_SPB_18.06450.06450.3	2.0809	0.1232	75.3	1420.2244	1419.537	3659.1	4	3.592	42.5	1	K.EKWAREEDLSR.L
*	Jamie_Alpha_SPB_15.05137.05137.1	1.3493	0.0727	25.0	1005.52	1006.0599	3563.1	42	3.568	50.0	1	K.WAREEDLS.R
*	Jamie_Alpha_SPB_22.07770.07770.2	4.0576	0.3045	100.0	1613.5122	1614.8418	7589.3	1	6.209	69.2	2	K.LKEGALHFVQQSEK.L
*	Jamie_Alpha_SPB_34.12033.12033.4	2.8166	0.0724	65.7	2271.6565	2270.51	6440.5	22	3.707	28.7	1	K.EGALHFVQQSEKLRNEVER.I
*	Jamie_Alpha_SPB_11.03951.03951.2	2.7358	0.0292	97.9	917.2322	916.02496	5081.5	23	3.365	91.7	1	K.LRNEVER.I
*	Jamie_Alpha_SPB_30.10575.10575.1	2.1966	0.1821	100.0	945.34	945.1039	4752.7	24	3.917	71.4	1	K.DLSELVIR.L
*	Jamie_Alpha_SPB_30.10536.10536.2	2.5851	0.0219	94.9	946.83215	945.1039	5421.6	2	3.191	92.9	1	K.DLSELVIR.L
*	Jamie_Alpha_SPB_38.13681.13681.2	2.2318	0.1511	99.0	1314.2122	1315.5529	5132.6	105	3.953	60.0	1	K.DLSELVIRLEK.D
*	Jamie_Alpha_SPB_56.19915.19915.3	3.7155	0.2362	100.0	2517.1743	2518.79	8485.6	1	5.523	28.6	1	K.DLSELVIRLEKDAADCQAELTK.T
*	Jamie_Alpha_SPB_56.20040.20040.2	1.8862	0.1837	98.3	2519.892	2518.79	7782.2	2	4.419	31.0	1	K.DLSELVIRLEKDAADCQAELTK.T
*	Jamie_Alpha_SPB_14.04885.04885.2	2.7975	0.2217	100.0	1822.9922	1821.9885	6231.8	1	4.791	50.0	1	R.LEKDAADCQAELTKTK.S
*	Jamie_Alpha_SPB_23.08331.08331.2	2.5435	0.1017	96.6	1765.6522	1762.917	7929.1	1	3.455	64.3	1	K.SSLYSAQDLLDKHER.K
*	Jamie_Alpha_SPB_27.09684.09684.2	2.0995	0.0076	82.7	1531.4321	1532.6909	7731.8	17	3.319	50.0	1	R.ELISNIEQTESLR.V
*	Jamie_Alpha_SPB_12.04329.04329.2	2.8179	0.372	100.0	1612.1322	1613.6812	6038.0	1	6.919	60.7	1	K.VDDTAANNGDKDHLK.L
*	Jamie_Alpha_SPB_32.11437.11437.2	4.0443	0.3146	100.0	1603.3522	1602.7473	9051.6	1	5.925	79.2	1	K.EYQCSAVIIDEFK.D
*	Jamie_Alpha_SPB_23.08055.08055.2	1.7052	0.0666	11.5	2036.3522	2036.2089	4617.1	151	2.98	33.3	1	K.NREIYKQLNDRQEEIS.R
*	Jamie_Alpha_SPB_25.08874.08874.3	3.0937	0.2081	96.2	2191.4043	2192.3965	5419.9	1	4.519	43.8	2	K.NREIYKQLNDRQEEISR.L
*	Jamie_Alpha_SPB_25.08844.08844.4	2.9592	0.1897	96.7	2192.9365	2192.3965	5538.2	3	3.949	30.2	1	K.NREIYKQLNDRQEEISR.L
*	Jamie_Alpha_SPB_17.05824.05824.2	3.097	0.2363	100.0	1717.9122	1717.917	6852.8	1	6.106	53.6	1	R.DLIQTKEQVSINSNK.I
*	Jamie_Alpha_SPB_24.08698.08698.2	2.2521	0.0916	31.9	1974.0922	1973.1714	9334.6	1	3.58	46.7	1	I.NSNKILVYESEMEQCK.Q
*	Jamie_Alpha_SPB_23.07981.07981.2	2.6182	0.2571	100.0	1530.8322	1529.7114	6751.9	1	4.995	72.7	1	K.ILVYESEMEQCK.Q
*	Jamie_Alpha_SPB_19.06722.06722.2	2.3697	0.2719	100.0	1813.7722	1814.0297	8375.7	1	4.743	61.5	1	K.ILVYESEMEQCKQR.Y
*	Jamie_Alpha_SPB_15.05263.05263.2	1.8725	0.0585	86.1	2192.652	2194.4062	7529.7	8	3.9	35.3	1	R.YQDLSQQQKDAQKKDIEK.L
*	Jamie_Alpha_SPB_40.14305.14305.4	3.7118	0.1982	96.1	3391.8965	3393.776	8296.3	1	3.89	22.6	1	R.YQDLSQQQKDAQKKDIEKLTNEISDLKGK.L
*	Jamie_Alpha_SPB_40.14250.14250.3	4.8309	0.2778	100.0	3394.8542	3393.776	9691.9	1	6.27	27.7	1	R.YQDLSQQQKDAQKKDIEKLTNEISDLKGK.L
*	Jamie_Alpha_SPB_36.12940.12940.3	4.4106	0.2617	100.0	2273.6343	2274.5767	7473.8	1	5.409	36.8	1	K.DAQKKDIEKLTNEISDLKGK.L
*	Jamie_Alpha_SPB_37.13040.13040.2	5.2738	0.4193	100.0	2274.4922	2274.5767	7968.7	1	7.448	57.9	1	K.DAQKKDIEKLTNEISDLKGK.L
*	Jamie_Alpha_SPB_47.16731.16731.3	2.4657	0.0584	51.7	3579.8342	3578.915	9182.7	3	3.438	21.0	1	K.DIEKLTNEISDLKGKLSSAENANADLENKFNR.L
*	Jamie_Alpha_SPB_17.05994.05994.2	4.1568	0.4141	100.0	1895.1322	1894.0079	7348.2	1	6.818	62.5	2	K.LSSAENANADLENKFNR.L
*	Jamie_Alpha_SPB_30.10711.10711.2	2.8388	0.3053	100.0	1898.5521	1900.1417	8551.6	1	7.029	53.3	1	K.AIKDKLEQDLHFENAK.V
*	Jamie_Alpha_SPB_30.10549.10549.3	3.389	0.1581	96.8	1899.8944	1900.1417	9380.5	1	4.756	41.7	1	K.AIKDKLEQDLHFENAK.V
*	Jamie_Alpha_SPB_38.13630.13630.2	2.5975	0.4158	100.0	2684.652	2685.0496	7963.7	1	6.766	36.4	1	K.AIKDKLEQDLHFENAKVIDLDTK.L
*	Jamie_Alpha_SPB_26.09373.09373.3	3.0769	0.2	42.3	1716.1743	1715.9034	6557.6	3	4.346	44.2	1	I.KDKLEQDLHFENAK.V
*	Jamie_Alpha_SPB_20.07260.07260.2	3.1385	0.3144	100.0	1586.6721	1587.7294	6830.9	1	6.144	66.7	2	K.DKLEQDLHFENAK.V
*	Jamie_Alpha_SPB_21.07548.07548.3	4.039	0.1949	100.0	1589.7244	1587.7294	5590.3	50	4.466	47.9	1	K.DKLEQDLHFENAK.V
*	Jamie_Alpha_SPB_33.11811.11811.2	2.2401	0.081	94.5	2370.9922	2372.6372	6213.5	25	3.079	28.9	1	K.DKLEQDLHFENAKVIDLDTK.L
*	Jamie_Alpha_SPB_17.05932.05932.1	2.5559	0.1916	100.0	1045.4	1045.2645	6000.0	2	4.299	68.8	1	K.VIDLDTKLK.A
*	Jamie_Alpha_SPB_35.12302.12302.3	2.7526	0.0713	59.5	3345.1443	3342.647	9608.7	110	3.399	21.3	2	K.VIDLDTKLKAHELQSEDVSRDHEKDTYR.T
*	Jamie_Alpha_SPB_15.05394.05394.3	2.5464	0.0686	63.2	1513.3444	1512.6627	4757.8	41	3.504	39.6	1	K.LKAHELQSEDVSR.D
*	Jamie_Alpha_SPB_26.09342.09342.3	3.4615	0.1251	87.8	2558.5444	2557.7393	7475.7	1	4.879	31.2	1	K.LKAHELQSEDVSRDHEKDTYR.T
*	Jamie_Alpha_SPB_13.04492.04492.1	2.8007	0.4688	100.0	1271.41	1271.3292	4716.4	1	8.091	70.0	1	K.AHELQSEDVSR.D
*	Jamie_Alpha_SPB_13.04566.04566.2	2.3911	0.0567	94.7	1271.7922	1271.3292	5280.9	1	4.393	85.0	1	K.AHELQSEDVSR.D
*	Jamie_Alpha_SPB_20.07108.07108.2	2.3009	0.1756	99.5	2315.7122	2316.4055	8362.9	1	4.975	41.7	1	K.AHELQSEDVSRDHEKDTYR.T
*	Jamie_Alpha_SPB_10.03348.03348.2	1.4626	0.1041	10.4	1286.3922	1285.3531	6012.4	11	3.807	59.1	1	F.KTANSSSDAFEK.L
*	Jamie_Alpha_SPB_7.02319.02319.2	1.9765	0.3726	100.0	1156.0922	1157.1791	4987.3	1	6.081	65.0	1	K.TANSSSDAFEK.L
*	Jamie_Alpha_SPB_45.16200.16200.3	1.8472	0.0741	42.7	3155.8442	3155.507	4511.3	409	3.049	19.2	1	K.TANSSSDAFEKLKVNMEKEKDRIIDER.T
*	Jamie_Alpha_SPB_15.05216.05216.2	2.0675	0.2235	87.2	1226.3922	1226.3287	4341.8	15	4.886	65.0	1	A.NSSSDAFEKLK.V
*	Jamie_Alpha_SPB_28.09981.09981.3	2.4213	0.0283	40.8	2872.1643	2872.1992	8485.2	83	3.395	21.9	1	K.KLQETLNKSTSSEAEYSKDIETLKK.E
*	Jamie_Alpha_SPB_51.18094.18094.3	2.8369	0.16	88.6	4335.054	4336.7505	10471.2	3	4.609	18.6	1	K.LQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLR.R
*	Jamie_Alpha_SPB_52.18451.18451.4	5.7754	0.319	100.0	4493.4565	4492.938	9265.5	1	6.023	21.8	1	K.LQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRR.I
*	Jamie_Alpha_SPB_50.17907.17907.4	5.4501	0.3725	100.0	3666.5366	3665.9897	7044.8	1	7.236	27.6	2	K.STSSEAEYSKDIETLKKEWLKEYEDETLRR.I
*	Jamie_Alpha_SPB_51.18213.18213.3	3.9288	0.3423	100.0	3666.6843	3665.9897	7487.9	1	6.202	29.3	1	K.STSSEAEYSKDIETLKKEWLKEYEDETLRR.I
*	Jamie_Alpha_SPB_28.10011.10011.2	2.874	0.3295	100.0	1613.1322	1611.7484	4690.1	1	5.422	77.3	1	K.EWLKEYEDETLR.R
*	Jamie_Alpha_SPB_22.07632.07632.3	3.4294	0.2365	100.0	1515.2943	1514.7684	5114.9	7	4.812	54.5	1	R.RIKEAEENLKKR.I
*	Jamie_Alpha_SPB_22.07779.07779.2	2.8323	0.3073	100.0	1515.4521	1514.7684	5424.9	1	5.616	59.1	1	R.RIKEAEENLKKR.I
*	Jamie_Alpha_SPB_13.04450.04450.1	2.2392	0.1286	100.0	1073.53	1074.2194	5033.6	15	3.934	68.8	1	R.IKEAEENLK.K
*	Jamie_Alpha_SPB_15.05418.05418.3	2.9557	0.0616	73.4	1357.3744	1358.5809	3537.4	46	3.803	42.5	1	R.IKEAEENLKKR.I
*	Jamie_Alpha_SPB_16.05478.05478.2	3.1957	0.2672	100.0	1359.0521	1358.5809	7002.2	2	4.812	75.0	1	R.IKEAEENLKKR.I
*	Jamie_Alpha_SPB_34.11949.11949.3	2.8594	0.2157	96.3	2063.6042	2063.405	7880.1	1	4.455	40.0	1	K.IISKRKEELEEEFRKK.L
*	Jamie_Alpha_SPB_23.08154.08154.2	3.4749	0.2766	100.0	1365.3322	1365.4857	5432.1	1	5.999	88.9	10	K.RKEELEEEFR.K
*	Jamie_Alpha_SPB_23.08082.08082.3	2.9219	0.2299	100.0	1366.4343	1365.4857	8039.2	4	4.228	47.2	5	K.RKEELEEEFR.K
*	Jamie_Alpha_SPB_24.08700.08700.3	4.8193	0.3217	100.0	1493.5144	1493.6598	8303.6	1	5.443	55.0	1	K.RKEELEEEFRK.K
*	Jamie_Alpha_SPB_25.09045.09045.2	2.6011	0.1757	99.5	1494.5322	1493.6598	4142.0	2	4.57	65.0	1	K.RKEELEEEFRK.K
*	Jamie_Alpha_SPB_30.10611.10611.2	3.9865	0.3442	100.0	1621.0721	1621.8339	6008.0	2	6.289	68.2	3	K.RKEELEEEFRKK.L
*	Jamie_Alpha_SPB_28.10086.10086.3	3.8514	0.2298	100.0	1621.4644	1621.8339	5378.8	6	5.091	52.3	2	K.RKEELEEEFRKK.L
*	Jamie_Alpha_SPB_21.07315.07315.2	3.9583	0.2124	100.0	1465.8722	1465.6464	5117.5	1	4.742	90.0	1	R.KEELEEEFRKK.L
*	Jamie_Alpha_SPB_35.12358.12358.3	4.7592	0.4417	100.0	4164.8345	4165.43	7666.8	1	7.522	21.7	1	K.LKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAV.A
*	Jamie_Alpha_SPB_39.13940.13940.4	7.1948	0.4396	100.0	4925.7764	4924.3057	7581.2	1	7.163	18.1	1	K.LKENAGSLTFLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQK.N
*	Jamie_Alpha_SPB_28.09781.09781.3	4.111	0.1695	11.9	3322.0444	3322.4827	6975.2	1	5.032	27.5	1	T.FLDNKGSGEDAEEELWNSPSKGNSERPSAVA.G
*	Jamie_Alpha_SPB_34.12074.12074.3	3.0044	0.1372	10.5	4011.4744	4010.2793	9471.0	3	4.009	19.4	1	T.FLDNKGSGEDAEEELWNSPSKGNSERPSAVAGFINQK.N
*	Jamie_Alpha_SPB_22.07737.07737.1	1.3601	0.1679	94.4	1734.52	1735.7582	10285.9	11	4.051	36.7	1	K.GSGEDAEEELWNSPSK.G
*	Jamie_Alpha_SPB_22.07752.07752.3	2.4034	0.0643	55.3	1736.3644	1735.7582	6184.4	72	3.534	36.7	1	K.GSGEDAEEELWNSPSK.G
*	Jamie_Alpha_SPB_22.07848.07848.2	5.0391	0.3389	100.0	1737.0922	1735.7582	10255.3	1	6.115	73.3	1	K.GSGEDAEEELWNSPSK.G
*	Jamie_Alpha_SPB_37.13066.13066.2	1.7169	0.2035	11.0	2639.172	2641.9468	7097.6	25	4.291	23.9	1	S.KGNSERPSAVAGFINQKNLKPQEQ.L
*	Jamie_Alpha_SPB_18.06499.06499.2	3.8032	0.3255	100.0	1676.2122	1675.8418	7050.9	1	5.752	60.0	1	K.GNSERPSAVAGFINQK.N
*	Jamie_Alpha_SPB_17.06127.06127.2	4.6654	0.4528	100.0	1686.8722	1686.7906	8433.1	1	8.371	85.7	3	K.NDVSFNDSQSMVTNK.E
*	Jamie_Alpha_SPB_13.04462.04462.2	1.9978	0.0367	86.2	1320.1721	1319.3708	5352.0	4	3.009	58.3	1	K.ENNIVDSSAAGNK.A
*	Jamie_Alpha_SPB_37.13060.13060.2	1.8027	0.2528	83.7	2838.412	2839.0508	7760.0	1	5.076	26.0	1	S.NTSSLQSFQNPFTASQSNINTNAPLR.T
*	Jamie_Alpha_SPB_31.10890.10890.2	2.6609	0.1742	99.5	2052.612	2054.1777	9552.3	8	5.259	34.2	1	K.AAINFSNVTDLTNNSTDGAK.I
*	Jamie_Alpha_SPB_28.10087.10087.2	3.8453	0.4906	100.0	1911.9922	1912.0203	8072.3	1	8.952	58.8	1	A.INFSNVTDLTNNSTDGAK.I
*	Jamie_Alpha_SPB_20.07034.07034.2	3.3023	0.1269	83.7	1799.4321	1798.8608	6323.8	1	4.666	43.8	1	I.NFSNVTDLTNNSTDGAK.I
*	Jamie_Alpha_SPB_9.03051.03051.1	1.6668	0.2703	100.0	935.39	936.0501	4869.5	1	5.653	62.5	1	K.ITEIGSTSK.R
*	Jamie_Alpha_SPB_13.04713.04713.2	2.0437	0.1329	32.2	2193.0322	2193.3293	5666.9	12	4.129	37.5	1	T.EIGSTSKRPIESGTSSDPDTK.K
*	Jamie_Alpha_SPB_9.02985.02985.2	2.7607	0.1991	100.0	1492.0521	1490.5669	3041.0	1	4.291	76.9	3	K.RPIESGTSSDPDTK.K
*	Jamie_Alpha_SPB_12.04356.04356.3	3.5621	0.196	97.3	1619.8744	1618.741	7616.4	5	6.297	41.1	1	K.RPIESGTSSDPDTKK.V
*	Jamie_Alpha_SPB_14.04938.04938.2	2.2096	0.0704	94.1	1846.4122	1846.0476	5934.0	4	3.16	46.9	1	K.RPIESGTSSDPDTKKVK.E
YOR020W-A	2	2	56.7%	90	9618	8.4	U	YOR020W-A SGDID:S000028526, Chr XV from 371684-371956, Uncharacterized ORF, "Identified by homology to <i Ashbya gossypii</i " 
*	Jamie_Alpha_SPB_117.42003.42003.4	4.0046	0.2381	37.5	3657.5764	3658.8872	7484.9	33	4.728	18.1	1	P.KTKNEGKNSSALSQQKSGESSNSDAMGKDDDVVKS.I
*	Jamie_Alpha_SPB_52.18638.18638.4	2.5958	0.1622	10.5	4932.8164	4934.2246	6758.1	6	3.674	14.8	1	E.GKNSSALSQQKSGESSNSDAMGKDDDVVKSIEGFLNDLEKDTRQDT.K
YOR257W	9	10	52.8%	161	18751	4.6	U	CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" 
*	Jamie_Alpha_SPB_27.09690.09690.2	1.8217	0.1022	92.2	1859.0721	1860.0282	6359.9	12	3.424	37.5	1	R.SSLQSGPLNSELLEEQK.Q
*	Jamie_Alpha_SPB_47.16772.16772.2	4.2156	0.3812	100.0	2740.7922	2740.9807	9261.4	1	7.329	37.0	1	R.SSLQSGPLNSELLEEQKQEIYEAF.S
*	Jamie_Alpha_SPB_57.20492.20492.3	2.8963	0.1981	96.8	2680.9744	2679.9866	8249.6	1	4.273	27.3	1	K.ALGFELPKREILDLIDEYDSEGR.H
*	Jamie_Alpha_SPB_38.13616.13616.2	4.1004	0.2935	100.0	1825.3121	1823.9542	6743.0	1	6.286	85.7	1	K.REILDLIDEYDSEGR.H
*	Jamie_Alpha_SPB_43.15285.15285.2	4.5057	0.5254	100.0	1666.9922	1667.7667	6595.3	1	9.526	80.8	2	R.EILDLIDEYDSEGR.H
*	Jamie_Alpha_SPB_34.12040.12040.1	1.7823	0.0797	95.2	1381.16	1380.5549	8721.3	1	3.963	55.0	1	K.YDDFYIVMGEK.I
*	Jamie_Alpha_SPB_22.07854.07854.2	2.7326	0.3225	100.0	1393.8121	1394.4833	6977.0	1	5.471	68.2	1	R.AFQLFDDDHTGK.I
*	Jamie_Alpha_SPB_22.07938.07938.2	2.4638	0.1814	99.5	1701.3121	1703.8871	6472.1	1	4.488	60.7	1	R.VAKELGETLTDEELR.A
*	Jamie_Alpha_SPB_23.07990.07990.1	1.7511	0.1818	100.0	1404.55	1405.5016	2340.7	1	4.486	54.5	1	K.ELGETLTDEELR.A
YGR294W	2	2	50.8%	120	12820	5.3	U	YGR294W SGDID:S000003526, Chr VII from 1080312-1080674, Uncharacterized ORF, "Hypothetical protein" 
	Jamie_Alpha_SPB_97.34815.34815.2	1.6719	0.1952	37.6	1735.5322	1733.0208	7312.6	482	4.714	28.6	1	E.RVNLVELGVYVSDIR.A
*	Jamie_Alpha_SPB_104.37310.37310.4	1.501	0.0128	23.9	6689.6963	6695.498	5309.9	231	2.926	6.2	1	R.VNLVELGVYVSDIRAHLAQYYSFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIAPDQVTR.M
YDR382W	2	2	47.3%	110	11050	4.1	U	RPP2B SGDID:S000002790, Chr IV from 1239482-1239814, Verified ORF, "Ribosomal protein P2 beta, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" 
*	Jamie_Alpha_SPB_19.06564.06564.3	2.4476	0.1596	10.1	1595.9944	1599.7814	3617.1	5	3.945	34.4	1	G.GNAAPSAADIKAVVESV.G
*	Jamie_Alpha_SPB_22.07856.07856.3	2.096	0.0915	53.8	3150.5044	3151.2812	3205.4	1	4.039	25.0	1	K.FATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAK.E
YDR356W	56	64	46.1%	944	111782	7.1	U	SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" 
*	Jamie_Alpha_SPB_39.13759.13759.2	2.3137	0.377	100.0	2088.2722	2088.281	9520.2	1	6.077	50.0	1	T.RLFSEASQFDDSFPEIKA.N
*	Jamie_Alpha_SPB_39.13938.13938.2	3.64	0.26	100.0	1862.4321	1861.0148	8514.6	1	5.109	66.7	1	R.LFSEASQFDDSFPEIK.A
*	Jamie_Alpha_SPB_32.11311.11311.2	2.038	0.1026	11.5	1671.0721	1671.7576	8420.5	2	3.502	42.9	1	F.SEASQFDDSFPEIKA.N
*	Jamie_Alpha_SPB_40.14420.14420.2	1.5377	0.0904	11.1	2604.7722	2606.9883	7418.3	65	3.229	25.0	1	N.IPPSPRSGNVDKSRKRNLIDDLK.K
*	Jamie_Alpha_SPB_47.16798.16798.4	2.6653	0.0564	54.1	3669.2166	3664.233	7202.9	77	2.898	18.4	1	R.NLIDDLKKDVPMSQPLKEQEVREHQMKKER.F
*	Jamie_Alpha_SPB_16.05762.05762.2	1.9254	0.1441	95.5	1656.1122	1656.8944	7919.1	2	3.841	53.8	1	K.DVPMSQPLKEQEVR.E
*	Jamie_Alpha_SPB_28.09938.09938.2	3.0483	0.3265	100.0	2367.2122	2366.633	8202.1	1	5.937	52.6	1	R.HITYANSDISNKELYINEIK.S
*	Jamie_Alpha_SPB_27.09632.09632.2	5.0779	0.4162	100.0	2400.412	2400.4688	6244.2	1	8.238	63.2	2	K.EKNDTLNNYDTLEEETDDLK.N
*	Jamie_Alpha_SPB_26.09254.09254.2	3.8243	0.5332	100.0	2669.8123	2670.76	4931.5	1	9.494	52.4	2	K.EKNDTLNNYDTLEEETDDLKNR.L
*	Jamie_Alpha_SPB_36.12750.12750.2	3.0888	0.4411	100.0	2143.3523	2143.1792	8213.5	1	7.323	44.1	1	K.NDTLNNYDTLEEETDDLK.N
*	Jamie_Alpha_SPB_29.10142.10142.2	2.6019	0.2	99.4	2412.8523	2413.4705	8131.4	1	4.496	39.5	2	K.NDTLNNYDTLEEETDDLKNR.L
*	Jamie_Alpha_SPB_28.09930.09930.2	3.8765	0.1436	100.0	1832.8922	1831.9744	9257.7	1	5.544	73.3	2	K.DQVLELENNSDVQSLK.L
*	Jamie_Alpha_SPB_33.11826.11826.2	1.629	0.0718	85.6	1218.7122	1218.4106	6210.5	18	2.948	61.1	1	K.NLMNELNELK.S
*	Jamie_Alpha_SPB_19.06579.06579.2	2.66	0.2546	100.0	1079.5721	1079.2103	4868.3	1	5.639	81.2	1	K.SDEMDLQLK.Q
*	Jamie_Alpha_SPB_25.08866.08866.3	2.4602	0.0287	47.4	1487.7843	1488.6812	5422.1	18	3.841	47.7	1	K.RLKDELNELETK.F
*	Jamie_Alpha_SPB_25.08883.08883.2	3.399	0.2999	100.0	1487.8121	1488.6812	6446.0	4	6.017	59.1	1	K.RLKDELNELETK.F
*	Jamie_Alpha_SPB_31.11078.11078.2	2.4346	0.281	100.0	3069.5322	3069.3062	6766.4	2	5.383	28.8	1	R.LKDELNELETKFSENGSQSSAKENELK.M
*	Jamie_Alpha_SPB_31.11184.11184.4	3.8141	0.2637	100.0	3070.4165	3069.3062	5160.2	1	4.824	23.7	1	R.LKDELNELETKFSENGSQSSAKENELK.M
*	Jamie_Alpha_SPB_33.11596.11596.3	5.0317	0.1778	97.1	3071.9343	3069.3062	7863.7	1	4.63	33.7	3	R.LKDELNELETKFSENGSQSSAKENELK.M
*	Jamie_Alpha_SPB_29.10213.10213.2	3.3828	0.2569	100.0	1506.3722	1504.6775	6423.5	1	4.924	75.0	2	K.NKIAELEEEISTK.N
*	Jamie_Alpha_SPB_35.12649.12649.4	3.7397	0.2335	100.0	2573.9766	2573.9036	8985.2	1	5.032	29.5	1	K.NKIAELEEEISTKNSQLIAKEGK.L
*	Jamie_Alpha_SPB_22.07861.07861.3	4.8269	0.2966	100.0	2348.8145	2347.5876	8463.0	1	5.636	39.5	1	R.DSQLGSREEELKKTNDKLQK.D
*	Jamie_Alpha_SPB_34.12247.12247.3	4.068	0.1678	96.5	2731.4043	2732.0232	6409.8	1	4.532	33.0	1	R.DSQLGSREEELKKTNDKLQKDIR.I
*	Jamie_Alpha_SPB_27.09573.09573.2	2.8797	0.3312	100.0	2416.9521	2417.6758	7992.5	22	5.953	30.0	1	K.THSESKTITDNELESKDKLIK.I
*	Jamie_Alpha_SPB_35.12390.12390.4	3.7898	0.195	96.1	3202.8965	3202.5425	8087.1	1	4.433	30.7	1	K.ELKEREFNYKISESKLEDEKTTLNEK.I
*	Jamie_Alpha_SPB_32.11239.11239.4	2.9571	0.0392	53.9	2830.2566	2832.0935	7952.4	1	3.295	26.5	1	K.EREFNYKISESKLEDEKTTLNEK.I
*	Jamie_Alpha_SPB_27.09631.09631.3	3.0733	0.0671	67.8	2546.7544	2546.7905	7744.6	1	3.536	30.0	1	R.EFNYKISESKLEDEKTTLNEK.I
*	Jamie_Alpha_SPB_16.05682.05682.2	5.2884	0.4495	100.0	1864.1522	1865.0447	7266.4	1	8.53	80.0	1	K.ISESKLEDEKTTLNEK.I
*	Jamie_Alpha_SPB_14.05047.05047.2	2.2248	0.1858	80.6	1665.1721	1664.807	4451.9	2	3.929	61.5	1	S.ESKLEDEKTTLNEK.I
*	Jamie_Alpha_SPB_40.14102.14102.4	3.8594	0.2652	100.0	2951.5366	2953.2761	6117.9	4	4.856	24.6	1	L.RKDIEEYKESAKDSEDKIEELKIR.I
*	Jamie_Alpha_SPB_34.12276.12276.3	4.1457	0.3115	100.0	2794.9744	2797.0886	8857.6	190	5.391	23.9	1	R.KDIEEYKESAKDSEDKIEELKIR.I
*	Jamie_Alpha_SPB_31.11074.11074.4	3.9666	0.3551	100.0	2665.7366	2668.9146	7405.4	1	6.135	34.9	1	K.DIEEYKESAKDSEDKIEELKIR.I
*	Jamie_Alpha_SPB_31.11059.11059.2	4.6175	0.4804	100.0	2668.5723	2668.9146	6579.4	1	8.446	47.6	1	K.DIEEYKESAKDSEDKIEELKIR.I
*	Jamie_Alpha_SPB_32.11282.11282.3	4.7231	0.3974	100.0	2670.1443	2668.9146	10351.1	1	6.27	33.3	1	K.DIEEYKESAKDSEDKIEELKIR.I
*	Jamie_Alpha_SPB_19.06900.06900.3	2.8757	0.2598	100.0	1475.4543	1475.639	6284.7	1	5.2	56.8	1	K.DSEDKIEELKIR.I
*	Jamie_Alpha_SPB_41.14760.14760.4	5.4862	0.2716	100.0	3374.5366	3375.7551	8719.0	1	5.511	30.4	1	R.SKDIKQKDEQISDLTQNLKLQEDEISSLK.S
*	Jamie_Alpha_SPB_24.08400.08400.2	2.6291	0.123	98.1	2018.3522	2017.2438	7947.4	1	3.862	50.0	1	K.DIKQKDEQISDLTQNLK.L
*	Jamie_Alpha_SPB_21.07326.07326.2	2.8044	0.2795	100.0	1659.7122	1660.8217	3399.9	1	5.276	57.7	1	K.QKDEQISDLTQNLK.L
*	Jamie_Alpha_SPB_42.15081.15081.2	3.0081	0.3429	100.0	1875.4922	1875.0831	9543.4	2	6.176	50.0	1	L.NLENKLIESEDELKSL.R
*	Jamie_Alpha_SPB_37.13344.13344.3	3.2973	0.2728	100.0	2028.7743	2031.2706	6696.2	1	5.38	40.6	1	L.NLENKLIESEDELKSLR.D
*	Jamie_Alpha_SPB_15.05156.05156.1	2.6152	6.0E-4	96.0	1077.3	1076.1888	9652.1	3	2.841	75.0	1	K.LIESEDELK.S
*	Jamie_Alpha_SPB_19.06823.06823.2	2.342	0.0652	94.6	1390.5322	1390.5358	5453.1	54	3.97	60.0	1	R.DSQKIEIENWK.R
*	Jamie_Alpha_SPB_19.06561.06561.3	3.1951	0.1495	95.8	1547.7544	1546.7233	6131.4	155	4.312	40.9	1	R.DSQKIEIENWKR.K
*	Jamie_Alpha_SPB_15.05396.05396.2	3.9507	0.2053	100.0	1367.5721	1366.4734	7206.5	1	5.395	90.0	1	R.KYNNLSLENDR.L
*	Jamie_Alpha_SPB_34.12295.12295.4	3.8175	0.2373	100.0	3552.8164	3551.8926	7655.7	1	4.323	22.4	1	K.YNNLSLENDRLLTEKESASDKEREISILNR.K
*	Jamie_Alpha_SPB_25.08707.08707.4	2.4709	0.07	57.9	2021.0966	2022.2806	5441.6	9	2.929	33.3	1	R.KLDEMDKEKWNLQESK.E
*	Jamie_Alpha_SPB_27.09558.09558.3	4.1308	0.3025	100.0	2279.8145	2279.57	7908.5	1	5.815	36.8	1	R.KLDEMDKEKWNLQESKEK.Y
*	Jamie_Alpha_SPB_27.09502.09502.2	4.0835	0.1352	100.0	2280.3123	2279.57	9285.5	1	4.798	58.8	1	R.KLDEMDKEKWNLQESKEK.Y
*	Jamie_Alpha_SPB_26.09337.09337.4	3.2962	0.0963	81.5	2281.3765	2279.57	4521.7	1	3.576	37.3	1	R.KLDEMDKEKWNLQESKEK.Y
*	Jamie_Alpha_SPB_15.05244.05244.2	3.157	0.2473	100.0	1745.5922	1745.8467	4102.9	1	4.588	65.4	1	R.REKEELNENSNNIR.I
*	Jamie_Alpha_SPB_28.10002.10002.3	2.5438	0.133	80.1	2053.5544	2054.1777	6576.4	1	3.707	35.3	1	R.KGEHSLNISLPDDDELDR.D
*	Jamie_Alpha_SPB_28.10042.10042.2	4.8793	0.265	100.0	2056.6921	2054.1777	10562.6	1	5.72	67.6	2	R.KGEHSLNISLPDDDELDR.D
*	Jamie_Alpha_SPB_37.13332.13332.4	4.865	0.3314	100.0	3352.0964	3353.5425	6570.8	1	5.624	32.7	1	R.KGEHSLNISLPDDDELDRDYYNSHVYTR.Y
*	Jamie_Alpha_SPB_37.13221.13221.3	5.3488	0.4874	100.0	3353.6343	3353.5425	9871.4	1	9.249	29.6	1	R.KGEHSLNISLPDDDELDRDYYNSHVYTR.Y
*	Jamie_Alpha_SPB_28.10050.10050.2	2.2285	0.1605	98.1	1924.9321	1926.0038	8075.1	8	4.85	37.5	1	K.GEHSLNISLPDDDELDR.D
*	Jamie_Alpha_SPB_25.08781.08781.3	2.4691	0.1905	11.8	2472.5645	2474.559	5485.0	66	4.234	28.9	1	I.SLPDDDELDRDYYNSHVYTR.Y
contaminant_KERATIN02	17	19	42.9%	622	61987	5.2	U	no description
*	Jamie_Alpha_SPB_80.28549.28549.2	1.6349	0.1191	22.8	1232.9722	1233.2833	3056.1	9	4.018	43.3	1	T.SGGGGGGGLGSGGSIR.S
*	Jamie_Alpha_SPB_13.04435.04435.1	2.3569	0.3012	100.0	1233.48	1233.2833	4788.0	1	6.584	50.0	1	T.SGGGGGGGLGSGGSIR.S
*	Jamie_Alpha_SPB_34.12118.12118.2	3.4216	0.3644	100.0	2707.7722	2706.7605	6954.4	1	6.907	33.9	1	R.GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR.G
*	Jamie_Alpha_SPB_61.21826.21826.2	1.5988	0.1868	13.6	2378.0522	2378.5193	8970.0	119	4.232	23.2	1	G.FGGGYGSGFGGLGGFGGGAGGGDGGILTA.N
*	Jamie_Alpha_SPB_17.06153.06153.2	2.341	0.0911	95.2	1587.2122	1587.6836	6128.0	1	3.27	65.4	1	K.VQALEEANNDLENK.I
*	Jamie_Alpha_SPB_60.21416.21416.3	3.9468	0.2698	100.0	3948.3542	3946.3167	8312.5	1	6.204	25.0	1	K.NYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTR.M
*	Jamie_Alpha_SPB_46.16420.16420.2	2.942	0.3669	100.0	3264.8323	3266.413	6492.8	1	7.085	30.4	1	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E
*	Jamie_Alpha_SPB_46.16452.16452.3	2.6531	0.1567	84.3	3264.9844	3266.413	10444.8	1	4.445	23.2	1	K.DIENQYETQITQIEHEVSSSGQEVQSSAK.E
*	Jamie_Alpha_SPB_36.12664.12664.2	5.1275	0.4687	100.0	1839.2922	1839.0557	9822.8	1	8.599	73.3	1	R.HGVQELEIELQSQLSK.K
*	Jamie_Alpha_SPB_33.11920.11920.2	2.7169	0.4425	100.0	1967.2522	1967.2297	6600.8	1	7.371	53.1	1	R.HGVQELEIELQSQLSKK.A
*	Jamie_Alpha_SPB_46.16327.16327.4	3.6555	0.2083	96.0	3169.7366	3169.4468	8544.4	1	4.246	24.1	1	K.MRLEKEIETYHNLLEGGQEDFESSGAGK.I
*	Jamie_Alpha_SPB_33.11588.11588.2	2.825	0.2845	100.0	2511.9521	2511.6177	5787.6	1	6.4	40.9	2	K.EIETYHNLLEGGQEDFESSGAGK.I
*	Jamie_Alpha_SPB_12.04194.04194.2	5.2402	0.3321	100.0	1792.4321	1792.7324	7701.8	1	9.567	59.1	2	R.GGSGGSYGGGGSGGGYGGGSGSR.G
*	Jamie_Alpha_SPB_12.04196.04196.2	3.6318	0.1911	100.0	1735.4922	1735.6805	7757.4	1	8.446	50.0	1	G.GSGGSYGGGGSGGGYGGGSGSR.G
*	Jamie_Alpha_SPB_12.04195.04195.2	2.0814	0.1104	32.1	2051.5522	2050.9663	4760.3	1	4.773	38.0	1	G.SGGNYGGGSGSGGGSGGGYGGGSGSR.G
*	Jamie_Alpha_SPB_31.11116.11116.2	1.6692	0.1443	10.2	1396.4922	1394.3597	6477.7	51	3.799	37.5	1	G.GYGGGSGSRGGSGGSHG.G
*	Jamie_Alpha_SPB_7.02326.02326.2	2.133	0.2278	82.9	1464.6522	1465.3922	6386.8	2	4.891	41.7	1	R.GGSGGSHGGGSGFGGESGG.S
YKL042W	17	17	38.6%	363	42271	7.9	U	SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" 
*	Jamie_Alpha_SPB_35.12553.12553.3	3.3625	0.3366	100.0	3435.2043	3435.6619	4656.1	12	5.322	22.2	1	R.LYDDYYNIPYQYSNPTPMNRDYNDVGSR.I
*	Jamie_Alpha_SPB_27.09620.09620.3	3.8306	0.2674	100.0	2482.9443	2482.7124	9852.7	2	5.216	32.5	1	R.DYNDVGSRINADKLVPEEYKR.N
*	Jamie_Alpha_SPB_20.07134.07134.3	2.6282	0.0253	50.0	1579.8844	1575.8052	6773.9	1	3.271	47.9	1	R.INADKLVPEEYKR.N
*	Jamie_Alpha_SPB_26.09236.09236.2	2.1661	0.1507	98.3	2165.112	2166.4417	5510.1	296	3.722	29.4	1	R.NTEFINKAVQQNKELNFK.L
*	Jamie_Alpha_SPB_28.09883.09883.3	3.8648	0.2668	100.0	2517.7444	2518.7546	8509.4	3	5.15	32.1	1	K.VKDPMVDDDPVSENYDQINVPK.H
*	Jamie_Alpha_SPB_28.09960.09960.2	4.8879	0.354	100.0	2518.392	2518.7546	5792.1	1	7.743	57.1	1	K.VKDPMVDDDPVSENYDQINVPK.H
*	Jamie_Alpha_SPB_41.14731.14731.3	3.7748	0.1317	13.6	2216.5444	2216.4966	5845.9	4	4.692	38.2	1	Y.ESAELKRVEEEIEELKRK.I
*	Jamie_Alpha_SPB_33.11905.11905.3	3.7804	0.2292	85.7	1800.7743	1801.05	6211.1	2	5.331	44.2	1	A.ELKRVEEEIEELKR.K
*	Jamie_Alpha_SPB_34.12024.12024.2	2.7675	0.2346	100.0	1801.0721	1801.05	6826.9	6	4.759	46.2	1	A.ELKRVEEEIEELKR.K
*	Jamie_Alpha_SPB_19.06828.06828.2	3.7017	0.3516	100.0	1430.0122	1430.6011	5375.1	1	7.117	85.0	1	K.RVEEEIEELKR.K
*	Jamie_Alpha_SPB_23.08142.08142.3	2.0501	9.0E-4	29.0	1559.4543	1558.7751	6134.3	67	2.706	40.9	1	K.RVEEEIEELKRK.I
*	Jamie_Alpha_SPB_16.05665.05665.1	2.9629	0.0598	100.0	1118.3	1118.2262	9274.7	13	3.808	75.0	1	R.VEEEIEELK.R
*	Jamie_Alpha_SPB_15.05376.05376.3	2.0575	0.0947	63.0	1274.3944	1274.4136	3254.3	248	3.713	41.7	1	R.VEEEIEELKR.K
*	Jamie_Alpha_SPB_32.11294.11294.2	1.958	0.1936	60.3	2412.872	2410.4421	5807.1	3	4.378	34.2	1	S.RDYSPSSDACLECSNDLYEK.N
*	Jamie_Alpha_SPB_26.09211.09211.2	4.2085	0.3696	100.0	2256.7122	2254.2546	7940.0	1	5.822	66.7	1	R.DYSPSSDACLECSNDLYEK.N
*	Jamie_Alpha_SPB_21.07280.07280.2	2.6864	0.2948	100.0	2523.2122	2524.546	5771.9	1	5.801	37.5	1	R.DYSPSSDACLECSNDLYEKNR.V
*	Jamie_Alpha_SPB_17.06050.06050.2	2.5445	0.0467	93.9	2149.0522	2148.355	6293.1	1	3.884	52.8	1	R.VKPENNMSETFATPTPNNR.-
YLR212C	8	8	36.6%	473	52628	4.7	U	TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" 
*	Jamie_Alpha_SPB_43.15438.15438.4	2.9408	0.0010	40.4	4595.9365	4596.9707	10571.9	21	3.135	15.4	1	K.FLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSR.N
*	Jamie_Alpha_SPB_31.10992.10992.3	3.1933	0.2712	100.0	3136.1343	3136.3152	7035.0	1	5.603	25.0	1	K.EHAIGTDGLSQLPDSSTERDDDTKPFFR.E
*	Jamie_Alpha_SPB_18.06379.06379.2	1.8984	0.1085	31.9	1527.0322	1527.6335	5891.2	8	3.791	50.0	1	S.TERDDDTKPFFR.E
*	Jamie_Alpha_SPB_58.20594.20594.3	4.9575	0.4268	100.0	4137.4146	4138.457	7775.1	1	7.829	25.7	1	K.IDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDR.Y
*	Jamie_Alpha_SPB_46.16614.16614.2	5.1096	0.4378	100.0	2321.9722	2322.5742	6314.2	1	9.838	64.3	1	R.LIEDSDATVVFDNASLLNISGK.V
*	Jamie_Alpha_SPB_17.05894.05894.2	1.6154	0.1025	16.7	1512.5322	1514.7239	6690.2	40	3.739	46.2	1	K.VFAKGAFLNNYNVG.D
*	Jamie_Alpha_SPB_78.28110.28110.4	3.9732	0.3188	100.0	6613.4966	6610.9644	10602.2	1	5.395	12.9	1	F.QSMQNVQDEFAESREVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHK.L
*	Jamie_Alpha_SPB_78.28110.28110.3	4.1816	0.4532	100.0	4960.3745	4960.224	10602.2	1	7.614	19.2	1	R.EVVQSLMEDYVAAEQDSYLDDVLVDDENMVGELEEDLDADGDHK.L
YBR109C	3	3	34.0%	147	16135	4.3	U	CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" 
*	Jamie_Alpha_SPB_70.24940.24940.3	2.6215	0.1884	94.1	4107.6543	4109.526	10187.8	1	4.042	18.8	1	R.SLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSR.Q
*	Jamie_Alpha_SPB_34.12208.12208.1	2.3532	0.1338	100.0	1509.6	1510.5975	6784.4	1	5.924	54.2	1	K.SNDSEQELLEAFK.V
*	Jamie_Alpha_SPB_34.12186.12186.2	4.0794	0.3851	100.0	1511.0322	1510.5975	10248.5	1	7.971	79.2	1	K.SNDSEQELLEAFK.V
Reverse_YER074W	2	2	31.9%	135	15329	10.5	U	RPS24A SGDID:S000000876, Chr V from 306319-306321,306788-307192, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" 
Reverse_YIL069C	2	2	31.9%	135	15329	10.5	U	RPS24B SGDID:S000001331, Chr IX from 232366-232364,231954-231550, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" 
	Jamie_Alpha_SPB_47.16668.16668.2	1.6485	0.0572	10.1	1355.0922	1352.6194	5081.6	206	3.237	50.0	1	R.VLRYTPEFKKA.E
	Jamie_Alpha_SPB_35.12424.12424.4	3.2269	0.0745	69.8	3687.0964	3687.2832	6861.9	236	3.524	18.8	1	K.ERLEDKSVNARNPHLVDVVFQKRALLPNSIVK.R
YER058W	2	2	31.8%	107	12281	9.4	U	PET117 SGDID:S000000860, Chr V from 271766-272089, Verified ORF, "Protein required for assembly of cytochrome c oxidase" 
*	Jamie_Alpha_SPB_37.13328.13328.4	2.2809	0.0501	44.9	3902.6165	3902.4495	9364.8	41	2.964	16.7	1	R.ETLHQGPIKDAKRVEEKRLRKTNGVASLDPTKER.K
*	Jamie_Alpha_SPB_20.07147.07147.2	1.3993	0.0254	67.1	1387.2722	1388.5205	7018.1	11	2.951	50.0	1	K.TNGVASLDPTKER.K
contaminant_gi|67568|pir||ELPG	8	8	31.6%	266	28821	8.1	U	pancreatic elastase (EC 3.4.21.36) I precursor - pig 
*	Jamie_Alpha_SPB_2.00705.00705.2	2.1037	0.2605	100.0	1029.6921	1031.1135	6014.8	12	5.749	66.7	1	R.VVGGTEAQRN.S
*	Jamie_Alpha_SPB_21.07359.07359.2	2.815	0.3551	100.0	1404.1122	1404.5345	8344.5	1	5.747	65.0	1	A.AHCVDRELTFR.V
*	Jamie_Alpha_SPB_24.08610.08610.2	2.6234	0.3967	100.0	2173.2722	2172.316	7143.2	1	5.924	39.5	1	R.VVVGEHNLNQNDGTEQYVGV.Q
*	Jamie_Alpha_SPB_17.06147.06147.2	2.987	0.3127	100.0	2427.7522	2428.6206	6922.8	1	6.589	40.5	1	R.VVVGEHNLNQNDGTEQYVGVQK.I
*	Jamie_Alpha_SPB_39.13956.13956.2	3.0218	0.3381	100.0	2119.892	2120.3257	5722.3	3	6.657	41.7	1	K.IVVHPYWNTDDVAAGYDIA.L
*	Jamie_Alpha_SPB_35.12654.12654.2	3.8324	0.4165	100.0	2007.2122	2007.1663	6218.9	2	7.684	47.1	1	I.VVHPYWNTDDVAAGYDIA.L
*	Jamie_Alpha_SPB_33.11796.11796.2	1.9946	0.1573	41.7	1459.4521	1460.7166	6515.3	74	4.389	45.8	1	V.TLNSYVQLGVLPR.A
*	Jamie_Alpha_SPB_16.05546.05546.1	1.4284	0.1461	29.4	1014.55	1015.1106	6178.4	3	4.702	56.2	1	S.SSYWGSTVK.N
YNL225C	18	18	31.2%	581	67400	6.0	U	CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" 
*	Jamie_Alpha_SPB_4.01103.01103.2	2.3023	0.1512	83.0	910.89215	911.00543	6523.2	1	4.672	78.6	1	W.LNENHVGK.S
*	Jamie_Alpha_SPB_17.05972.05972.2	3.8677	0.4428	100.0	2165.392	2166.2983	6682.8	1	7.013	55.9	1	R.DSYEENKSPSMDQMNYAR.N
*	Jamie_Alpha_SPB_19.06835.06835.2	1.8116	0.0292	83.2	1050.2522	1050.2432	5733.2	11	3.504	68.8	1	K.IFLQNSLSK.E
*	Jamie_Alpha_SPB_38.13682.13682.2	3.7813	0.3549	100.0	2803.0322	2803.1826	4843.5	1	6.925	37.0	1	K.SNDKTLDNKKKIEEQTVLIENLTK.D
*	Jamie_Alpha_SPB_31.10874.10874.3	3.0719	0.0549	67.1	1785.6543	1787.1069	6488.2	4	4.394	46.4	1	K.KKIEEQTVLIENLTK.D
*	Jamie_Alpha_SPB_30.10845.10845.2	4.1447	0.134	100.0	1788.8722	1787.1069	9027.5	1	5.026	71.4	1	K.KKIEEQTVLIENLTK.D
*	Jamie_Alpha_SPB_27.09571.09571.2	4.019	0.1741	100.0	1658.8322	1658.9329	8402.9	1	5.529	69.2	1	K.KIEEQTVLIENLTK.D
*	Jamie_Alpha_SPB_29.10176.10176.2	2.2781	0.1621	98.1	2193.0522	2192.4895	5200.7	4	3.935	38.9	1	K.DLSLNKEMLEKANDTIQTK.H
*	Jamie_Alpha_SPB_74.26420.26420.2	1.3648	0.1116	82.1	2327.0723	2327.6433	6472.5	15	3.682	27.5	1	K.ANDTIQTKHTALLSLTDSLRK.A
*	Jamie_Alpha_SPB_73.26001.26001.2	1.3852	0.0303	67.2	2905.392	2906.2585	10046.2	1	3.092	27.1	1	R.KAELFEIPIGILFFDLYDSEENSSK.L
*	Jamie_Alpha_SPB_78.27948.27948.2	2.6855	0.2666	100.0	2776.892	2778.0845	9219.0	1	7.07	39.1	1	K.AELFEIPIGILFFDLYDSEENSSK.L
*	Jamie_Alpha_SPB_33.11671.11671.2	2.8131	0.126	99.5	2120.392	2120.327	7183.2	1	5.042	47.1	1	R.FKNAKAEAEDLRNELENK.K
*	Jamie_Alpha_SPB_19.06790.06790.2	3.0797	0.1952	100.0	1659.7722	1659.7936	5690.2	1	4.223	57.7	1	A.KAEAEDLRNELENK.K
*	Jamie_Alpha_SPB_18.06312.06312.2	3.1527	0.2716	100.0	1530.3322	1531.6195	6266.6	1	5.052	75.0	1	K.AEAEDLRNELENK.K
*	Jamie_Alpha_SPB_31.10987.10987.3	3.7517	0.2336	100.0	2531.4844	2531.8438	7916.5	1	4.858	30.0	1	K.AEAEDLRNELENKKIEIQTMR.E
*	Jamie_Alpha_SPB_12.04191.04191.1	2.0355	0.2087	100.0	974.05	975.0898	3379.1	3	5.076	68.8	1	K.NNTLIGTNK.T
*	Jamie_Alpha_SPB_31.11088.11088.3	3.5873	0.1089	84.9	2416.6143	2414.7178	7129.0	1	3.864	34.2	1	R.LGSWEKSKEKYETSLKDKEK.M
*	Jamie_Alpha_SPB_14.04851.04851.1	1.6402	0.1002	95.0	1224.1	1224.2725	4315.8	9	3.521	50.0	1	R.FGNLEGNTSER.I
contaminant_KERATIN03	14	17	30.2%	593	59519	5.2	U	no description
*	Jamie_Alpha_SPB_26.09201.09201.3	3.4912	0.2325	58.8	2563.6743	2567.7776	8129.2	1	4.716	25.0	1	S.SLRISSSKGSLGGGFSSGGFSGGSFSR.G
*	Jamie_Alpha_SPB_24.08361.08361.2	2.0037	0.0385	85.4	2210.412	2211.3525	7097.5	92	4.484	26.1	1	R.ISSSKGSLGGGFSSGGFSGGSFSR.G
*	Jamie_Alpha_SPB_26.09201.09201.2	5.0675	0.5041	100.0	1709.4521	1708.7844	8129.2	1	10.061	66.7	4	K.GSLGGGFSSGGFSGGSFSR.G
*	Jamie_Alpha_SPB_27.09565.09565.2	1.8495	0.1532	30.3	1652.0721	1651.7324	5680.8	174	3.743	35.3	1	G.SLGGGFSSGGFSGGSFSR.G
*	Jamie_Alpha_SPB_20.07126.07126.2	2.939	0.4018	100.0	1451.4122	1451.4949	5733.4	1	7.02	56.7	1	L.GGGFSSGGFSGGSFSR.G
*	Jamie_Alpha_SPB_16.05664.05664.1	3.1105	0.276	100.0	1381.44	1382.4668	7991.8	1	5.996	63.6	1	R.ALEESNYELEGK.I
*	Jamie_Alpha_SPB_39.13939.13939.3	3.0904	0.2382	97.2	3459.9243	3459.713	9069.6	1	4.714	23.2	1	R.ALEESNYELEGKIKEWYEKHGNSHQGEPR.D
*	Jamie_Alpha_SPB_17.06126.06126.2	1.5901	0.0316	73.6	1236.4922	1235.4258	6253.9	234	2.778	50.0	1	R.LKYENEVALR.Q
*	Jamie_Alpha_SPB_38.13452.13452.2	1.8189	0.0663	11.2	2085.0122	2085.2292	8384.6	5	3.521	38.2	1	K.SKELTTEIDNNIEQISSY.K
*	Jamie_Alpha_SPB_35.12561.12561.2	2.8557	0.3177	100.0	2213.0322	2213.4033	7795.1	1	5.698	41.7	1	K.SKELTTEIDNNIEQISSYK.S
*	Jamie_Alpha_SPB_41.14791.14791.4	6.0372	0.3652	100.0	3197.6565	3198.5115	6565.7	1	7.124	35.9	1	K.SKELTTEIDNNIEQISSYKSEITELRR.N
*	Jamie_Alpha_SPB_65.23151.23151.4	3.0953	0.1744	15.6	3796.7766	3800.564	8469.6	26	3.529	15.0	1	G.GSSGGGYGGGSSSGGHGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSS.G
*	Jamie_Alpha_SPB_35.12368.12368.4	3.4319	0.156	17.8	3317.9365	3318.1106	3912.5	9	3.605	17.4	1	H.GGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGY.G
*	Jamie_Alpha_SPB_118.42234.42234.4	2.9414	0.1962	12.7	5123.0166	5117.9854	7465.0	39	4.177	12.4	1	G.GHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPR.Y
YBL027W	3	3	28.0%	189	21704	11.4	U	RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" 
YBR084C-A	3	3	28.0%	189	21704	11.4	U	RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" 
	Jamie_Alpha_SPB_60.21445.21445.4	3.385	0.1547	16.1	3271.4966	3266.728	6223.6	88	3.394	20.7	1	T.QKRLAASVVGVGKRKVWLDPNETSEIAQAN.S
	Jamie_Alpha_SPB_29.10152.10152.2	1.5947	0.0332	72.3	1931.5922	1931.0691	8653.8	1	3.283	43.8	1	K.VWLDPNETSEIAQANSR.N
	Jamie_Alpha_SPB_25.08704.08704.2	1.4007	0.1872	31.6	2595.7522	2593.0037	6907.1	116	3.707	22.5	1	A.KYRDAGKIDKHLYHVLYKESK.G
YIR018W	2	2	27.3%	245	28386	8.7	U	YAP5 SGDID:S000001457, Chr IX from 384606-385343, Verified ORF, "Basic leucine zipper (bZIP) transcription factor" 
*	Jamie_Alpha_SPB_16.05619.05619.4	1.8435	0.063	39.6	5395.6167	5399.17	7394.1	331	2.846	11.2	1	K.LNRLQNELQAKESENHALKQKLETLTLKQASVPAQDPILQNLIENFK.P
*	Jamie_Alpha_SPB_59.21194.21194.3	2.8468	0.2479	25.9	2287.0745	2283.3455	4840.2	149	4.773	26.3	1	H.QHSTELPSSVKCGFCNDNTT.C
YPL131W	8	10	26.9%	297	33715	6.8	U	RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" 
*	Jamie_Alpha_SPB_40.14186.14186.3	2.6784	0.2164	29.2	3868.2844	3870.2585	6618.0	1	4.785	18.9	1	T.LQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFK.V
*	Jamie_Alpha_SPB_36.12933.12933.2	1.9714	5.0E-4	74.6	2209.2322	2208.297	9869.0	92	3.109	28.9	1	K.GVEEVEGEYELTEAVEDGPR.P
*	Jamie_Alpha_SPB_40.14186.14186.2	3.9616	0.5005	100.0	2579.1921	2580.7644	6618.0	1	8.877	50.0	3	K.GVEEVEGEYELTEAVEDGPRPFK.V
*	Jamie_Alpha_SPB_45.15920.15920.2	2.1651	0.049	88.4	2589.2522	2591.7217	10213.1	17	3.892	28.6	1	R.SYIFGGHVSQYMEELADDDEER.F
*	Jamie_Alpha_SPB_44.15801.15801.3	2.7179	0.0626	57.7	2591.0044	2591.7217	6801.2	53	3.196	25.0	1	R.SYIFGGHVSQYMEELADDDEER.F
*	Jamie_Alpha_SPB_24.08401.08401.2	3.4796	0.3344	100.0	1829.2722	1829.8867	7629.4	2	7.674	50.0	1	H.VSQYMEELADDDEER.F
*	Jamie_Alpha_SPB_47.16766.16766.2	4.9026	0.4969	100.0	2655.0122	2654.8035	7616.4	1	9.208	50.0	1	K.GYLADDIDADSLEDIYTSAHEAIR.A
*	Jamie_Alpha_SPB_47.16792.16792.3	3.6145	0.1554	94.9	2655.6243	2654.8035	5586.0	1	4.621	37.0	1	K.GYLADDIDADSLEDIYTSAHEAIR.A
Reverse_YPL111W	3	3	26.7%	333	35662	5.6	U	CAR1 SGDID:S000006032, Chr XVI from 339943-340944, Verified ORF, "Arginase, responsible for arginine degradation, expression responds to both induction by arginine and nitrogen catabolite repression; disruption enhances freeze tolerance" 
*	Jamie_Alpha_SPB_100.35869.35869.4	2.74	0.1955	15.8	3281.2966	3281.78	5681.3	40	3.932	21.0	1	Y.KDLVASVTGIAISHDGGLTLPFRNAQVVKSVS.N
*	Jamie_Alpha_SPB_32.11258.11258.2	1.6186	0.0816	83.8	1652.7922	1653.845	6646.5	27	3.356	40.6	1	K.AKVGDIMVSSGGTTSDK.E
*	Jamie_Alpha_SPB_83.29829.29829.4	2.5939	0.1873	13.5	4439.5366	4437.1216	8490.0	3	3.633	15.8	1	L.GHKLMYKPGKEVGLKGQGGSFPALVISLERNKYYNYHPGT.E
Reverse_YGR235C	2	2	25.8%	233	26912	9.3	U	YGR235C SGDID:S000003467, Chr VII from 962065-961364, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; localizes to the mitochondrion" 
*	Jamie_Alpha_SPB_75.26804.26804.4	3.5165	0.1691	13.8	4013.3765	4008.4856	6339.9	399	4.365	17.7	1	V.DKNLWKKADYYYQVSATSLRKTEKWVRDQRET.F
*	Jamie_Alpha_SPB_38.13386.13386.4	3.3729	0.1508	13.5	2958.4565	2954.3936	5519.1	13	3.921	24.1	1	M.SAVLISLLGPILRENPDTHLSAITSTFS.E
YBR159W	2	2	25.6%	347	38708	9.5	U	YBR159W SGDID:S000000363, Chr II from 558679-559722, Uncharacterized ORF, "Microsomal beta-keto-reductase; contains oleate response element (ORE) sequence in the promoter region; mutants exhibit reduced VLCFA synthesis, accumulate high levels of dihydrosphingosine, phytosphingosine and medium-chain ceramides." 
*	Jamie_Alpha_SPB_41.14632.14632.4	3.3998	0.1713	16.1	5025.0967	5027.82	9316.2	5	4.449	14.7	1	M.AKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKE.S
*	Jamie_Alpha_SPB_36.12901.12901.4	3.2732	0.1663	15.7	5300.4565	5306.1836	7502.6	3	4.357	15.9	1	P.YWAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQV.K
YCR031C	2	2	25.5%	137	14537	10.7	U	RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" 
YJL191W	2	2	25.4%	138	14650	10.5	U	RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" 
	Jamie_Alpha_SPB_14.04857.04857.3	2.939	0.1339	85.0	1800.3243	1798.0121	5787.6	222	3.726	27.8	1	R.ATGGTRTKTPGPGGQAALR.A
	Jamie_Alpha_SPB_18.06260.06260.2	2.7081	0.3984	100.0	1742.1122	1742.9268	7857.4	1	6.736	53.3	1	R.IGRIEDVTPVPSDSTR.K
YNL067W	2	2	25.1%	191	21657	9.7	U	RPL9B SGDID:S000005011, Chr XIV from 499682-500257, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Ap and has similarity to E. coli L6 and rat L9 ribosomal proteins" 
*	Jamie_Alpha_SPB_62.22244.22244.2	1.4952	0.2024	13.1	2397.5723	2399.8484	9975.5	25	3.996	23.8	1	I.KVAVHNGDRKHVAALRTVKSLV.D
	Jamie_Alpha_SPB_82.29535.29535.4	3.2069	0.2109	45.7	2790.2566	2791.0874	5616.3	7	4.497	25.3	1	R.NVPVRDGVTIEFSTNVKDEIVLSGNS.V
YJL121C	2	2	24.4%	238	25967	6.3	U	RPE1 SGDID:S000003657, Chr X from 191010-190294, reverse complement, Verified ORF, "D-ribulose-5-phosphate 3-epimerase, catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway; mutants are sensitive to oxidative stress" 
*	Jamie_Alpha_SPB_36.12936.12936.4	2.5405	0.0764	57.5	3875.4966	3872.5942	7621.4	17	3.118	17.7	1	K.FMEDMMPKVETLRAKFPHLNIQVDGGLGKETIPK.A
*	Jamie_Alpha_SPB_16.05810.05810.2	1.6886	0.0877	11.4	2283.9922	2283.5461	5877.5	53	3.864	23.9	1	K.AAKAGANVIVAGTSVFTAADPHDV.I
YDR418W	2	2	24.2%	165	17823	9.4	U	RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
YEL054C	2	2	24.2%	165	17823	9.4	U	RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 
	Jamie_Alpha_SPB_54.19452.19452.3	2.6698	0.1759	92.7	2285.9043	2289.7239	5312.7	15	4.04	25.0	1	R.AVGGEVGASAALAPKIGPLGLSPKK.V
	Jamie_Alpha_SPB_91.32744.32744.2	1.6484	0.1108	21.3	1604.5721	1606.8595	6789.7	242	3.994	35.7	1	K.VGEDIAKATKEFKGI.K
Reverse_YHR189W	2	2	23.7%	190	21036	9.9	U	PTH1 SGDID:S000001232, Chr VIII from 484028-484600, Verified ORF, "One of two (see also PTH2) mitochondrially-localized peptidyl-tRNA hydrolases; dispensable for cell growth and for mitochondrial respiration" 
*	Jamie_Alpha_SPB_16.05690.05690.2	1.5467	0.1145	16.1	2177.7722	2176.53	5412.4	76	3.582	28.9	1	K.LLSRLGNHGRISTSPARLQV.K
*	Jamie_Alpha_SPB_107.38353.38353.2	1.229	0.1352	10.1	2819.9722	2821.3135	5889.8	46	3.377	16.7	1	K.GGTNPVPSYTRGQLGLRKRLLELMY.L
Reverse_YMR156C	2	2	23.5%	238	27383	8.8	U	TPP1 SGDID:S000004765, Chr XIII from 571015-570299, reverse complement, Verified ORF, "DNA 3'-phosphatase that functions in repair of endogenous damage of double-stranded DNA, activity is specific for removal of 3' phosphates at strand breaks; has similarity to the l-2-haloacid dehalogenase superfamily" 
*	Jamie_Alpha_SPB_76.27141.27141.3	2.1248	0.069	46.6	3376.3743	3376.716	7308.8	161	3.732	17.0	1	R.GAADGCYYIWNLKIPSIQESVRYASELDR.K
*	Jamie_Alpha_SPB_16.05785.05785.4	2.7371	0.0495	51.8	3151.5764	3151.5054	6585.7	329	3.008	18.6	1	K.PKIITHDLDFAYVNLGHEDHDISQPFK.P
YCR045C	3	3	23.2%	491	55068	5.4	U	YCR045C SGDID:S000000641, Chr III from 209605-208130, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_93.33351.33351.2	1.1827	0.1111	73.7	2454.2722	2454.9365	7957.3	298	3.502	23.8	1	K.FSIGSFRGVTMNLSKNLVNKLK.K
*	Jamie_Alpha_SPB_19.06769.06769.4	2.7816	0.2032	12.5	4956.0967	4961.519	5940.4	1	3.792	14.4	1	K.DGSGEASNVLSGLEFIVEHCTKVSRPQGKKCVANLSLGSFRSPIIN.M
*	Jamie_Alpha_SPB_85.30589.30589.4	2.7698	0.1751	12.6	4869.8965	4874.5264	9796.0	1	4.217	16.7	1	S.NWGPCVNIFAPGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAIL.L
YIL061C	2	2	23.0%	300	34447	10.0	U	SNP1 SGDID:S000001323, Chr IX from 245556-244654, reverse complement, Verified ORF, "Component of U1 snRNP required for mRNA splicing via spliceosome; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein" 
*	Jamie_Alpha_SPB_10.03358.03358.4	2.1262	0.097	55.2	2977.0566	2979.5505	5101.3	47	3.204	21.3	1	K.DKITQKSKGYAFIVFKDPISSKMAFK.E
*	Jamie_Alpha_SPB_40.14370.14370.4	3.0623	0.1957	14.4	4805.0967	4805.2437	10461.0	31	3.965	14.7	1	P.AERNYAPRLPRRETSSSAYSADRYGSSTLDARYRGNRPLLSAA.T
YDL177C	2	2	21.8%	170	19058	9.9	U	YDL177C SGDID:S000002336, Chr IV from 141722-141210, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_75.26810.26810.3	2.0939	0.0453	41.1	2099.6343	2099.438	4276.5	46	3.041	32.4	1	K.NVGKLVKIWNESEVLVDR.K
*	Jamie_Alpha_SPB_12.04044.04044.4	2.4204	0.1033	67.1	2196.4565	2198.7007	6030.1	19	3.674	34.3	1	R.LLTLLERANIFNVLVIVTR.W
YJL052W	2	2	21.7%	332	35750	8.3	U	TDH1 SGDID:S000003588, Chr X from 338187-339185, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 1, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " 
*	Jamie_Alpha_SPB_42.14911.14911.1	1.2679	0.1889	22.2	1386.71	1387.6396	3862.9	1	3.872	41.7	1	S.SAPMFVVGVNHTK.Y
*	Jamie_Alpha_SPB_60.21543.21543.4	1.4095	0.0428	24.6	6148.8564	6145.1396	7043.5	241	2.999	8.3	1	R.TASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLEKEATYDQIK.K
Reverse_YMR056C	2	2	21.0%	309	34121	9.7	U	AAC1 SGDID:S000004660, Chr XIII from 388243-387314, reverse complement, Verified ORF, "Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator" 
*	Jamie_Alpha_SPB_93.33352.33352.4	2.922	0.0479	55.0	3477.6565	3475.0986	6143.3	338	3.194	21.0	1	K.FKKGFMILQLQDYLSIVGAAAVGRFINAGCGK.F
*	Jamie_Alpha_SPB_102.36628.36628.4	3.1972	0.1568	12.9	3537.2566	3540.9597	5455.9	76	3.726	19.8	1	V.FLLSLGGAAGGSFLNGAFWKAYGDRERDYSLLS.K
Reverse_YOR008C	2	2	20.9%	378	39270	4.8	U	SLG1 SGDID:S000005534, Chr XV from 342414-341278, reverse complement, Verified ORF, "Sensor-transducer of the stress-activated PKC1-MPK1 kinase pathway involved in maintenance of cell wall integrity; involved in organization of the actin cytoskeleton; secretory pathway Wsc1p is required for the arrest of secretion response" 
*	Jamie_Alpha_SPB_28.09872.09872.4	3.0975	0.1928	14.7	3445.2566	3442.7214	8819.2	1	4.342	22.5	1	A.KKKHTKSGSTSDSGATGTASGSNQASATITNTVFI.T
*	Jamie_Alpha_SPB_41.14500.14500.3	2.234	0.231	15.4	4224.3545	4226.2993	9268.1	99	4.993	14.5	1	T.SISAAAQTSEPSNQVTSSSAMSSTTSSTTSSTTSTTSSTTSSTT.S
YJL063C	2	2	20.6%	238	26945	9.8	U	MRPL8 SGDID:S000003599, Chr X from 316391-315675, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" 
*	Jamie_Alpha_SPB_12.04297.04297.2	1.5575	0.0929	23.0	808.65216	807.9712	4279.1	2	3.443	80.0	1	G.YTRVLR.L
*	Jamie_Alpha_SPB_41.14628.14628.4	2.8856	0.0479	53.4	4943.1367	4941.843	6973.6	110	2.586	14.7	1	K.VAKFKAEAQLHGEIMLIKQVLLKEMSLPYDEALENERTQALLK.E
YBR107C	2	2	20.4%	245	28066	5.2	U	IML3 SGDID:S000000311, Chr II from 454524-453787, reverse complement, Verified ORF, "Protein with a role in kinetochore function, localizes to the outer kinetochore in a Ctf19p-dependent manner, interacts with Chl4p and Ctf19p" 
*	Jamie_Alpha_SPB_13.04738.04738.3	2.5341	0.2814	23.7	3497.9043	3495.965	7407.2	4	4.908	20.4	1	S.KMEVPMFLCYCGTDNRNEVVLQWLKAEY.G
*	Jamie_Alpha_SPB_99.35644.35644.2	1.5435	0.194	15.3	2467.912	2467.0063	5148.4	11	4.24	28.6	1	G.MAVERLPLTSVILAGHTKIMRE.S
YDL168W	2	2	20.2%	386	41042	6.8	U	SFA1 SGDID:S000002327, Chr IV from 159605-160765, Verified ORF, "Bifunctional enzyme containing both alcohol dehydrogenase and glutathione-dependent formaldehyde dehydrogenase activities, functions in formaldehyde detoxification and formation of long chain and complex alcohols, regulated by Hog1p-Sko1p" 
*	Jamie_Alpha_SPB_46.16492.16492.4	2.5754	0.1899	10.5	5546.9365	5547.31	7561.1	3	3.955	12.7	1	S.VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAK.L
*	Jamie_Alpha_SPB_53.19014.19014.4	3.3213	0.1721	14.1	2541.4165	2535.6924	4584.1	94	3.889	26.2	1	Q.YCSQFGATDFVNPKEDLAKDQT.I
Reverse_YGL235W	2	2	20.2%	178	19334	8.1	U	YGL235W SGDID:S000003204, Chr VII from 55279-55815, Uncharacterized ORF, "Protein of unknown function, potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_61.21669.21669.2	1.6355	0.1093	20.0	2655.152	2655.983	10393.7	3	3.678	29.5	1	V.GWLVISRTVVKADEHVENGKCTR.L
*	Jamie_Alpha_SPB_34.12274.12274.2	1.5434	0.1266	22.1	1478.7722	1477.7649	6667.7	13	3.427	41.7	1	P.TPLPMRTFSISAR.S
YCR107W	2	2	19.6%	363	40911	6.8	U	AAD3 SGDID:S000000704, Chr III from 313886-314977, Verified ORF, "Putative aryl-alcohol dehydrogenase with similarity to P. chrysosporium aryl-alcohol dehydrogenase; mutational analysis has not yet revealed a physiological role" 
	Jamie_Alpha_SPB_119.42570.42570.4	2.3504	0.0118	31.3	2989.7366	2990.5317	7821.6	55	2.798	22.4	1	R.DIIPMARHFGMALAPWDVMGGGRFQSK.K
*	Jamie_Alpha_SPB_4.01354.01354.4	1.127	0.0103	23.4	4619.6567	4622.1865	4167.8	1	2.67	7.4	1	R.SFVGASEQTDAEIKISEALAKIAEEHGTESVTAIAIAYVRSKAK.N
Reverse_YGR285C	3	3	19.4%	433	49020	8.3	U	ZUO1 SGDID:S000003517, Chr VII from 1063159-1061858, reverse complement, Verified ORF, "Cytosolic ribosome-associated chaperone, contains a DnaJ domain; together with Ssz1p, acts as a chaperone for nascent polypeptide chains" 
*	Jamie_Alpha_SPB_51.18082.18082.3	2.268	0.2075	15.2	3700.0745	3700.222	8237.0	3	4.588	16.4	1	S.SPLKGSDVITKASEKLVEKAGAANAKIKDATSVLEE.D
*	Jamie_Alpha_SPB_93.33456.33456.4	3.2375	0.1289	83.5	3538.7366	3544.0464	6249.1	171	3.648	17.2	1	K.KAAKAAEKAKKKDAKASANAKAESEAKAKAEAEAK.A
*	Jamie_Alpha_SPB_91.32623.32623.2	1.6322	0.0929	13.3	1660.2122	1659.9344	5242.2	237	3.238	37.5	1	H.NRLTRQAHQLFFK.G
Reverse_YCR088W	3	3	18.6%	592	65576	4.7	U	ABP1 SGDID:S000000684, Chr III from 265064-266842, Verified ORF, "Actin-binding protein of the cortical actin cytoskeleton, important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization" 
*	Jamie_Alpha_SPB_77.27700.27700.4	1.8545	0.0043	24.2	4853.7363	4859.234	8372.9	435	2.617	13.2	1	K.VDPEGEPEDEPVEPKPAEAKTEANGSNQKAKREAWLQAPSKENR.F
*	Jamie_Alpha_SPB_21.07514.07514.2	1.0246	0.0136	61.6	1077.0122	1077.2378	3767.9	216	3.117	50.0	1	K.LSSETMSPPK.T
*	Jamie_Alpha_SPB_94.33676.33676.4	1.943	0.0782	46.3	6315.4966	6314.055	9711.7	248	3.391	8.8	1	R.TKLPASDPCWGIIIIKEVDSGPPSVRALGYQVKTEDFLQLFDHFSSGTSEPEYEKK.A
Reverse_YMR315W	2	2	18.6%	349	38216	6.6	U	YMR315W SGDID:S000004932, Chr XIII from 902799-903848, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_18.06434.06434.2	1.887	0.0563	85.8	1777.8121	1777.975	5490.5	207	3.302	30.0	1	K.LQVTAFVIDDAGSRER.V
*	Jamie_Alpha_SPB_78.27831.27831.4	2.3238	0.229	12.5	5198.5767	5193.0923	5566.8	347	4.119	12.2	1	Y.LWNEAVGVPLPTSEAIKVIEKAQDLNAAIPKELIVPKGAKVAKEVIDAN.F
Reverse_YOR385W	2	2	18.6%	290	34064	8.8	U	YOR385W SGDID:S000005912, Chr XV from 1065039-1065911, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_56.20040.20040.4	2.9941	0.1661	13.4	5038.7764	5039.647	7782.2	241	3.974	13.3	1	T.EFFGQHAYIECYLIKCLRFVKDQCIVKCDSYLPPDQVGQLV.Y
*	Jamie_Alpha_SPB_84.30158.30158.2	1.7878	0.1116	93.4	1657.8922	1655.8569	4796.5	181	3.458	41.7	1	R.ERSFHLREPITNR.Q
YOR106W	2	2	18.4%	283	32498	7.0	U	VAM3 SGDID:S000005632, Chr XV from 519121-519972, Verified ORF, "Syntaxin-related protein required for vacuolar assembly; functions with Vam7p in vacuolar protein trafficking; member of the syntaxin family of proteins" 
*	Jamie_Alpha_SPB_99.35678.35678.3	1.7905	0.2343	11.1	4369.2544	4369.972	10760.2	475	4.149	14.2	1	Y.KIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKT.K
*	Jamie_Alpha_SPB_99.35499.35499.2	1.9134	0.0853	23.9	1769.2322	1766.9174	6499.4	47	3.814	38.5	1	A.NKQLTRADQHQRDR.N
YLR150W	4	4	18.3%	273	29995	9.7	U	STM1 SGDID:S000004140, Chr XII from 440468-441289, Verified ORF, "Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations" 
*	Jamie_Alpha_SPB_108.38821.38821.1	1.3621	0.0703	29.7	993.16	994.15045	5244.0	33	3.337	56.2	1	-.MSNPFDLLG.N
*	Jamie_Alpha_SPB_15.05268.05268.2	2.8347	0.1084	60.8	1717.0922	1715.8113	4982.5	1	4.264	59.4	1	A.AEIAEDAAEAEDAGKPK.T
*	Jamie_Alpha_SPB_15.05349.05349.2	2.868	0.2102	50.0	1888.2922	1887.9952	7056.8	2	4.935	47.2	1	A.AEIAEDAAEAEDAGKPKTA.Q
*	Jamie_Alpha_SPB_30.10627.10627.3	3.072	0.2176	96.3	2493.5344	2491.801	6970.6	7	4.515	29.8	1	K.KVELDAERIETAEKEAYVPATK.V
YKL054C	6	6	18.2%	738	83973	5.0	U	DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" 
*	Jamie_Alpha_SPB_46.16332.16332.4	3.2852	0.1617	17.9	4742.4966	4746.3774	7302.1	36	4.012	15.0	1	L.ETIIDKITSGAVTRWDEVKKPAKKEKYEKKEQQHSYVPQQ.H
*	Jamie_Alpha_SPB_58.20913.20913.4	2.6813	0.1899	13.5	4150.2563	4154.672	5594.5	59	4.134	18.2	1	V.KKPAKKEKYEKKEQQHSYVPQQHLPNPEDDITYK.S
*	Jamie_Alpha_SPB_18.06320.06320.3	2.5487	0.1674	10.2	2225.3342	2221.3916	5435.1	3	4.208	29.2	1	A.NTAAANLTSAAAAAAASPATAHAQP.Q
*	Jamie_Alpha_SPB_36.12891.12891.2	1.9844	0.3121	100.0	3092.892	3093.427	10063.9	1	5.76	30.0	1	A.HFYQQSFPYGQPQYGVAGQYPYQLPK.N
*	Jamie_Alpha_SPB_16.05524.05524.2	2.4593	0.3099	100.0	2811.5723	2811.8572	8451.1	1	6.043	43.5	1	K.NNYNYYQTQNGQEQQSPNQGVAQH.S
*	Jamie_Alpha_SPB_14.05048.05048.3	4.7458	0.3539	100.0	3615.9844	3614.653	9819.2	1	6.602	28.3	1	K.NNYNYYQTQNGQEQQSPNQGVAQHSEDSQQK.Q
Reverse_YDR058C	2	2	18.1%	326	37500	8.4	U	TGL2 SGDID:S000002465, Chr IV from 568700-567720, reverse complement, Verified ORF, "Protein with lipolytic activity towards triacylglycerols and diacylglycerols when expressed in E. coli; role in yeast lipid degradation is unclear" 
*	Jamie_Alpha_SPB_16.05522.05522.2	2.0169	0.0689	23.0	1540.5922	1540.8027	7160.3	2	2.937	58.3	1	-.FGKRALDDTIKLY.F
*	Jamie_Alpha_SPB_56.20152.20152.4	2.1039	0.0344	34.6	5372.8965	5369.201	7564.4	200	3.113	11.9	1	R.NKINCILYRCDLGGMSHAILNLSHRKDKSEIKKVEKQLQADLAMAR.E
YBR026C	2	2	17.9%	380	42067	9.0	U	ETR1 SGDID:S000000230, Chr II from 294019-292877, reverse complement, Verified ORF, "2-enoyl thioester reductase, member of the medium chain dehydrogenase/reductase family; localized to in mitochondria, where it has a probable role in fatty acid synthesis" 
*	Jamie_Alpha_SPB_73.25987.25987.4	3.1508	0.1575	12.9	3723.0964	3728.113	6626.8	374	3.241	17.2	1	G.SSKGDLKLGDRVIPLQANQGTWSNYRVFSSSSDL.I
*	Jamie_Alpha_SPB_87.31060.31060.3	2.1301	0.2401	13.6	3747.4744	3748.437	7331.5	9	4.323	16.7	1	A.RKLENNALMLTYGGMSKQPVTLPTSLHIFKGLTS.K
contaminant_NRL_1IKFL	2	2	17.8%	214	23527	6.5	U	owl|| Immunoglobulin igg1-kappa antibody fragment fab complexed With... 
contaminant_S68241	2	2	17.4%	218	23846	6.7	U	owl|S68241| immunoglobulin light chain (Mab13-1) - mouse (fragment) 
	Jamie_Alpha_SPB_39.14031.14031.2	2.311	0.1912	83.6	2546.2722	2545.8088	7548.0	29	3.994	24.0	1	L.RADAAPTVSIFPPSSEQLTSGGASVV.C
	Jamie_Alpha_SPB_16.05635.05635.2	2.8036	0.1472	84.1	1458.2922	1456.5927	7380.1	1	4.83	72.7	1	S.STLTLTKDEYER.H
Reverse_YLR029C	2	2	17.6%	204	24422	11.4	U	RPL15A SGDID:S000004019, Chr XII from 202591-201977, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl15Bp and has similarity to rat L15 ribosomal protein; binds to 5.8 S rRNA" 
Reverse_YMR121C	2	2	17.6%	204	24422	11.4	U	RPL15B SGDID:S000004728, Chr XIII from 510347-509733, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl15Ap and has similarity to rat L15 ribosomal protein; binds to 5.8 S rRNA" 
	Jamie_Alpha_SPB_51.18205.18205.2	1.3921	0.0223	66.2	2370.4321	2370.7285	5916.7	167	2.873	26.3	1	K.WTKRRGAKTNNFKHGKNIGR.S
	Jamie_Alpha_SPB_79.28310.28310.2	1.8453	0.1848	97.9	1955.6921	1955.3596	7477.1	283	4.07	30.0	1	R.VRYIVFGQKAKYGLRR.A
Reverse_contaminant_KERATIN09	4	4	17.5%	429	47927	5.5	U	no description
*	Jamie_Alpha_SPB_61.21780.21780.4	2.0399	0.0784	50.7	2324.7366	2323.661	4993.5	86	2.784	28.9	1	-.HRLVKTDNTESVVKGDVIRR.T
*	Jamie_Alpha_SPB_61.21871.21871.4	2.8111	0.0466	53.7	2438.6565	2436.7888	4564.9	493	3.338	26.7	1	K.RALEDYQARIDAMIKALDQSK.P
*	Jamie_Alpha_SPB_45.15955.15955.2	1.8125	0.1999	57.1	1203.5721	1205.3745	5105.9	131	4.818	42.3	1	G.AIGTALGGSGMGGR.F
*	Jamie_Alpha_SPB_56.20068.20068.3	2.3065	0.2071	16.6	1901.2743	1905.1179	3360.0	15	3.877	32.9	1	Y.VSAASSVPRAGYSPAQVSGL.S
YDR299W	3	3	17.4%	534	61203	4.8	U	BFR2 SGDID:S000002707, Chr IV from 1059621-1061225, Verified ORF, "Essential protein possibly involved in secretion; multicopy suppressor of sensitivity to Brefeldin A" 
*	Jamie_Alpha_SPB_43.15516.15516.2	1.5719	0.1112	16.4	2886.7722	2888.0276	6256.2	68	3.226	20.8	1	G.ESDLSDYGNSNTEETKKAHYLEVEK.S
*	Jamie_Alpha_SPB_89.31886.31886.3	2.0253	0.2407	15.6	4856.9043	4854.342	8278.7	1	4.318	14.0	1	A.HYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENED.E
*	Jamie_Alpha_SPB_84.30088.30088.3	1.6882	0.0078	23.7	3669.2644	3672.1326	7479.4	275	2.994	15.6	1	K.KNIDTKASKGRKLNYSVQDPIANYEAPITSGYK.W
YPL033C	2	2	17.1%	281	31925	7.4	U	YPL033C SGDID:S000005954, Chr XVI from 488205-487360, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_80.28645.28645.2	1.4856	0.1059	10.7	3159.0723	3156.6978	8887.8	27	3.781	23.1	1	K.KTIYKVLVSFYQYVGLGKKFHPSHDTV.L
*	Jamie_Alpha_SPB_20.06906.06906.2	1.6715	0.1046	20.3	2340.132	2339.7373	7578.7	52	3.723	30.0	1	A.EAQEKAKGFYIVNISSVLTLK.P
Reverse_YER107C	2	2	17.0%	365	40523	8.5	U	GLE2 SGDID:S000000909, Chr V from 374541-373444, reverse complement, Verified ORF, "Component of the nuclear pore complex required for polyadenylated RNA export but not for protein import, homologous to S. pombe Rae1p" 
*	Jamie_Alpha_SPB_77.27770.27770.2	1.3085	0.0277	65.2	2211.6921	2214.3284	9365.7	169	2.837	27.8	1	K.DWSGTVICETNSPGCQVFR.L
*	Jamie_Alpha_SPB_89.31999.31999.4	2.8373	0.203	16.0	4653.6167	4651.14	6350.2	24	4.445	15.5	1	V.KIPASHMGIQQTQGSAIDYLKLANDCGGSAVKTGDNSWRTCLV.P
YDR218C	2	2	16.8%	423	48193	5.9	U	SPR28 SGDID:S000002626, Chr IV from 905046-903775, reverse complement, Verified ORF, "Sporulation-specific homolog of the yeast CDC3/10/11/12 family of bud neck microfilament genes; meiotic septin expressed at high levels during meiotic divisions and ascospore formation" 
*	Jamie_Alpha_SPB_91.32679.32679.3	1.8408	0.2783	10.1	4466.4844	4467.053	8199.6	254	4.771	12.2	1	E.LNLHKDIVRQEISQNNIRVFDFKSDTLGETLALYDMDI.D
*	Jamie_Alpha_SPB_71.25556.25556.4	2.8589	0.0287	47.1	3815.4565	3812.311	5526.1	64	2.865	18.8	1	R.TYEWGSLVVEDQNTSDFIYLKAILLGSHLQELK.D
Reverse_YIL061C	2	2	16.7%	300	34447	10.0	U	SNP1 SGDID:S000001323, Chr IX from 245556-244654, reverse complement, Verified ORF, "Component of U1 snRNP required for mRNA splicing via spliceosome; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein" 
*	Jamie_Alpha_SPB_42.15135.15135.2	1.6546	0.122	24.2	2329.0522	2326.7126	9448.2	275	3.366	25.0	1	N.SYGRGGLGGGLRRPKFYKVTR.G
*	Jamie_Alpha_SPB_91.32762.32762.3	2.2538	0.3007	27.8	3603.2344	3606.1282	7827.5	288	4.955	17.9	1	V.NPNWNQLRRDLLQANKIKSLKIDEYRQLH.N
YNL178W	3	3	16.7%	240	26503	9.4	U	RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" 
*	Jamie_Alpha_SPB_39.13816.13816.3	3.1712	0.1293	83.1	4348.5845	4347.817	8544.1	5	3.845	16.0	1	K.ALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA.-
*	Jamie_Alpha_SPB_21.07282.07282.2	2.5672	0.2381	100.0	2502.0522	2501.7092	9428.5	1	5.616	36.4	1	I.LAPSVKDYRPAEETEAQAEPVEA.-
*	Jamie_Alpha_SPB_17.05997.05997.2	2.7396	0.344	100.0	1904.7922	1905.9696	4911.6	2	6.045	46.9	1	K.DYRPAEETEAQAEPVEA.-
Reverse_YJL183W	2	2	16.6%	422	47801	8.5	U	MNN11 SGDID:S000003719, Chr X from 84066-85334, Verified ORF, "Subunit of a Golgi mannosyltransferase complex that also contains Anp1p, Mnn9p, Mnn10p, and Hoc1p, and mediates elongation of the polysaccharide mannan backbone; has homology to Mnn10p" 
*	Jamie_Alpha_SPB_75.26978.26978.4	2.0273	0.2335	15.6	5534.1367	5528.49	9409.2	1	3.756	14.2	1	E.FHNYTKINSNAVVPVNKLLALDMIKPDLLYKQLSLDLNMLLADQDVFH.I
*	Jamie_Alpha_SPB_49.17619.17619.2	1.8865	0.2416	81.6	2533.7922	2535.9434	6338.8	59	4.242	23.8	1	N.EFDILTVVVVEPADNSKRYVLK.G
YJL118W	2	2	16.4%	219	25598	11.0	U	YJL118W SGDID:S000003654, Chr X from 191559-192218, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_87.31143.31143.2	1.5418	0.0859	10.0	2165.112	2167.601	8038.8	22	3.705	31.2	1	R.RRPHRIERPLSNMYPIM.E
*	Jamie_Alpha_SPB_18.06418.06418.2	1.6956	0.1582	30.4	2317.5923	2316.381	6540.5	16	3.87	30.6	1	H.HPWYDLSLSEEALSTCCCS.-
YJR123W	2	2	16.4%	225	25039	8.6	U	RPS5 SGDID:S000003884, Chr X from 651816-652493, Verified ORF, "Protein component of the small (40S) ribosomal subunit, the least basic of the non-acidic ribosomal proteins; phosphorylated in vivo; essential for viability; has similarity to E. coli S7 and rat S5 ribosomal proteins" 
*	Jamie_Alpha_SPB_28.10056.10056.2	1.7966	0.0724	12.0	1767.1122	1768.0696	7416.0	75	3.598	37.5	1	R.RVNQAIALLTIGAREAA.F
*	Jamie_Alpha_SPB_94.33704.33704.2	1.9055	0.1337	29.3	2089.392	2087.3782	9229.8	4	4.003	28.9	1	R.NIKTIAETLAEELINAAKGS.S
YOR275C	3	3	16.3%	661	75947	5.9	U	RIM20 SGDID:S000005801, Chr XV from 841066-839081, reverse complement, Verified ORF, "Protein involved in proteolytic activation of Rim101p in response to alkaline pH; member of the PalA/AIP1/Alix family; interacts with the ESCRT-III subunits Snf7p, suggesting a relationship between the response to pH and multivesicular body formation" 
*	Jamie_Alpha_SPB_59.21026.21026.4	3.4868	0.1754	13.7	2700.5764	2703.0642	5493.6	283	3.795	25.0	1	G.TLNWTLPESSTTNTAYYEKLKKL.R
*	Jamie_Alpha_SPB_78.27853.27853.3	1.6013	0.0255	24.5	4918.6743	4914.665	3885.1	349	3.543	8.8	1	R.NDYIDRTRRKSSEYRILPKIITSYKKNGTVDFEPIFIGHLK.Y
*	Jamie_Alpha_SPB_62.22118.22118.4	3.4652	0.2078	37.5	5045.5366	5048.445	9155.3	9	4.379	15.1	1	L.SAGTAFYENLITSTSNLYNEVQEYDTARRAEKARLDKSLTFEDQ.-
YNR041C	3	3	16.1%	372	41001	10.0	U	COQ2 SGDID:S000005324, Chr XIV from 701661-700543, reverse complement, Verified ORF, "Para hydroxybenzoate: polyprenyl transferase, catalyzes the second step in ubiquinone (coenzyme Q) biosynthesis" 
*	Jamie_Alpha_SPB_104.37215.37215.2	1.4172	0.1276	11.8	2456.0122	2453.8044	8646.1	3	3.609	26.1	1	R.SILGSGRVTVAGIIGSSRKRYTSS.S
*	Jamie_Alpha_SPB_53.19118.19118.2	1.6369	0.0697	10.2	1646.4321	1643.9272	8121.9	35	3.321	34.4	1	S.ILGSGRVTVAGIIGSSR.K
*	Jamie_Alpha_SPB_52.18481.18481.4	2.3681	0.3005	25.0	4279.6963	4281.9814	9996.0	12	4.473	16.7	1	A.CFNWGALLGFPAMGVMSWPTMIPLYLSSYLWCMTYD.T
YPL031C	2	2	16.1%	305	34906	8.2	U	PHO85 SGDID:S000005952, Chr XVI from 493035-493019,492916-492016, reverse complement, Verified ORF, "Cyclin-dependent kinase, with ten cyclin partners; involved in environmental stress response; in phosphate-rich conditions, Pho85p-Pho80p complex phosphorylates Pho4p which in turn represses PHO5" 
*	Jamie_Alpha_SPB_43.15304.15304.3	2.5842	0.2652	47.4	3205.3743	3204.691	6966.2	38	4.561	19.8	1	K.LGNGTYATVYKGLNKTTGVYVALKEVKLDS.E
*	Jamie_Alpha_SPB_110.39303.39303.2	1.1535	0.0198	62.9	2803.912	2805.2134	6306.0	8	3.382	18.8	1	K.EVKLDSEEGTPSTAIREISLMKELK.H
YEL002C	3	3	16.0%	430	49392	5.9	U	WBP1 SGDID:S000000728, Chr V from 150013-148721, reverse complement, Verified ORF, "Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum" 
*	Jamie_Alpha_SPB_114.41026.41026.1	1.6724	0.0262	92.9	1039.3	1039.2662	5136.5	19	3.041	62.5	1	K.NLARQIPVK.Q
*	Jamie_Alpha_SPB_103.36967.36967.2	1.6411	0.1738	12.9	1880.0322	1877.1527	6605.7	3	4.285	40.0	1	G.IYPSPKGHVIRDYFSP.S
*	Jamie_Alpha_SPB_45.16042.16042.4	3.1096	0.1269	11.1	5010.2163	5009.428	7202.1	262	3.34	13.6	1	K.CNSWTSGSQGFLVVGFQNLNNARLVWIGSSDFLKNKNQDSNQEF.A
YNL289W	2	2	15.8%	279	32095	9.3	U	PCL1 SGDID:S000005233, Chr XIV from 87897-88736, Verified ORF, "Pho85 cyclin of the Pcl1,2-like subfamily, involved in entry into the mitotic cell cycle and regulation of morphogenesis, localizes to sites of polarized cell growth" 
*	Jamie_Alpha_SPB_17.05895.05895.2	1.8535	0.1309	13.3	1522.6322	1522.7838	6292.1	430	4.188	36.4	1	A.RSSDQRKRINMM.M
*	Jamie_Alpha_SPB_25.08787.08787.3	2.065	0.0681	45.8	3727.6743	3729.1943	7519.2	103	3.707	17.7	1	R.FKLYEKQRNVSIASDLSSATLVDSCNDLRRLK.D
YGL215W	3	3	15.5%	452	51571	7.1	U	CLG1 SGDID:S000003183, Chr VII from 87980-89338, Verified ORF, "Cyclin-like protein that interacts with Pho85p; has sequence similarity to G1 cyclins PCL1 and PCL2" 
*	Jamie_Alpha_SPB_93.33414.33414.4	3.0839	0.1711	17.4	2765.4966	2763.212	6397.9	8	3.664	23.3	1	S.GYPISLPFPKGSATSAVNVARQLPKY.L
*	Jamie_Alpha_SPB_18.06313.06313.4	2.9361	0.1649	15.3	2168.6565	2171.2046	5389.5	64	3.753	28.9	1	I.RDGQQQPQQSNQVNGGVSEN.L
*	Jamie_Alpha_SPB_82.29239.29239.3	2.754	0.169	11.1	2772.4143	2770.074	7321.1	160	3.639	23.9	1	D.KTFTNNSWSQATGILINVINDFER.Q
Reverse_YER023W	2	2	15.4%	286	30132	5.5	U	PRO3 SGDID:S000000825, Chr V from 201075-201935, Verified ORF, "Delta 1-pyrroline-5-carboxylate reductase, catalyzes the last step in proline biosynthesis" 
*	Jamie_Alpha_SPB_69.24586.24586.2	1.5775	0.1037	11.9	2591.0923	2590.9336	8843.5	2	3.393	28.3	1	K.GVQSILENVLPKQEKSVDASYSVV.A
*	Jamie_Alpha_SPB_76.27386.27386.2	1.8175	0.1495	11.2	2071.132	2071.338	6516.4	81	3.954	36.8	1	F.PKTGLLVVSAEEVASVNHGY.T
contaminant_INT-STD1	5	5	15.3%	607	69271	6.1	U	BSA 
*	Jamie_Alpha_SPB_66.23749.23749.4	2.9283	0.0352	51.1	3397.8564	3392.6455	5448.3	129	3.192	20.7	1	K.TCVADESHAGCEKSLHTLFGDELCKVASLR.E
*	Jamie_Alpha_SPB_20.07080.07080.2	1.9132	0.0095	75.0	1901.7922	1903.0216	11002.7	42	3.282	36.7	1	R.NECFLSHKDDSPDLPK.L
*	Jamie_Alpha_SPB_118.42482.42482.2	1.5528	0.0821	11.0	1381.0122	1383.6744	8220.0	339	2.89	40.9	1	V.TKLVTDLTKVHK.E
*	Jamie_Alpha_SPB_36.12867.12867.2	1.8063	0.109	93.1	2458.4922	2459.6782	7076.5	371	3.475	26.2	1	K.DAIPENLPPLTADFAEDKDVCK.N
*	Jamie_Alpha_SPB_50.17702.17702.2	3.124	0.1722	100.0	1570.8121	1568.7258	9202.7	1	4.55	66.7	1	K.DAFLGSFLYEYSR.R
Reverse_YOR271C	2	2	15.3%	327	35414	9.8	U	YOR271C SGDID:S000005797, Chr XV from 832039-831056, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_24.08606.08606.2	1.6389	0.0892	10.7	1960.1921	1959.2125	5549.0	56	3.97	34.4	1	K.GDKDKKGHLEPELKNLH.I
*	Jamie_Alpha_SPB_116.41542.41542.2	1.2236	0.2449	14.6	3537.0122	3537.3062	3071.8	28	4.67	10.9	1	V.GRQLRVLILPPIVMTPTANIVRSLATEGVAMFA.A
Reverse_YJR047C	2	2	15.3%	157	17131	5.0	U	ANB1 SGDID:S000003808, Chr X from 525295-524822, reverse complement, Verified ORF, "Translation initiation factor eIF-5A, promotes formation of the first peptide bond; similar to and functionally redundant with Hyp2p; undergoes an essential hypusination modification; expressed under anaerobic conditions" 
	Jamie_Alpha_SPB_41.14738.14738.2	1.7144	0.1672	28.3	1460.4321	1460.5377	6055.8	39	3.708	42.3	1	M.SDGLEGEPAKVDDK.T
*	Jamie_Alpha_SPB_57.20536.20536.2	1.4896	0.0852	11.2	1238.4521	1239.2556	5174.7	302	3.315	50.0	1	A.NEFTHEEDSM.-
YJL171C	2	2	15.2%	396	43014	5.0	U	YJL171C SGDID:S000003707, Chr X from 100888-99698, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_96.34447.34447.3	1.8689	0.2508	15.7	3112.6143	3110.1975	7278.9	4	4.473	17.2	1	N.HGGEASPCLGNALSYASSNGTGSASEATVLADG.T
*	Jamie_Alpha_SPB_55.19533.19533.3	3.0318	0.2494	22.4	2780.4844	2784.1292	7870.0	115	4.801	22.1	1	Y.SSQLMSISATAPSTTSLSNGVRLTNMQ.N
Reverse_YBL099W	2	2	15.0%	545	58618	9.0	U	ATP1 SGDID:S000000195, Chr II from 37050-38687, Verified ORF, "Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" 
*	Jamie_Alpha_SPB_36.12681.12681.4	3.3508	0.129	10.3	4439.5366	4435.092	7276.7	20	3.5	15.4	1	G.ISAATFPALYQLPAAESATAAVIISYKMADHQELTQVLQAVT.S
*	Jamie_Alpha_SPB_68.24188.24188.4	3.2179	0.2495	19.4	4201.3364	4201.857	12689.7	9	4.46	17.1	1	L.ITDLAVATKGTQRDGIILERQGRGIPVLADVAKLGTQVPE.H
Reverse_YER101C	2	2	14.9%	430	48371	8.9	U	AST2 SGDID:S000000903, Chr V from 361790-360498, reverse complement, Verified ORF, "Protein that may have a role in targeting of plasma membrane [H+]ATPase (Pma1p) to the plasma membrane, as suggested by analysis of genetic interactions" 
*	Jamie_Alpha_SPB_97.34722.34722.4	2.8666	0.2509	11.1	4126.2964	4120.673	7217.4	263	4.457	17.2	1	E.KFNKWSYVKDVVCDVVGENLLKGCEHIWDNKKPI.I
*	Jamie_Alpha_SPB_54.19303.19303.4	3.1231	0.1693	17.3	3259.6965	3262.694	6346.5	133	3.938	20.1	1	I.LVNSETNLQDKEKLQALLNLATGLCFLSGA.A
YHR040W	2	2	14.8%	366	42334	6.1	U	BCD1 SGDID:S000001082, Chr VIII from 187917-189017, Verified ORF, "Essential protein required for the accumulation of box C/D snoRNA" 
*	Jamie_Alpha_SPB_103.36934.36934.4	1.7058	0.1038	47.0	5489.0166	5492.801	5964.3	105	3.51	9.6	1	R.CLVQTCSLECSKKHKTRDNCSGQTHDPKEYISSEALKQADDDKHER.N
*	Jamie_Alpha_SPB_19.06590.06590.2	1.7878	0.0461	12.3	1132.3722	1131.2896	5909.5	32	3.331	64.3	1	T.ECQRIIRR.G
YPR086W	2	2	14.8%	345	38200	8.6	U	SUA7 SGDID:S000006290, Chr XVI from 710099-711136, Verified ORF, "Transcription factor TFIIB, a general transcription factor required for transcription initiation and start site selection by RNA polymerase II" 
*	Jamie_Alpha_SPB_26.09169.09169.2	1.7629	0.1227	25.3	1499.2122	1500.6055	6147.0	1	3.729	50.0	1	R.VGEASNPLLDGNNLS.T
*	Jamie_Alpha_SPB_22.07864.07864.4	3.1191	0.1768	14.9	4127.8564	4132.858	6125.2	57	4.057	16.2	1	V.ARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDG.F
YML095C	2	2	14.8%	210	24311	8.8	U	RAD10 SGDID:S000004560, Chr XIII from 82113-81481, reverse complement, Verified ORF, "Single-stranded DNA endonuclease (with Rad1p), cleaves single-stranded DNA during nucleotide excision repair and double-strand break repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); homolog of human ERCC1 protein" 
*	Jamie_Alpha_SPB_62.22087.22087.4	2.8721	0.1367	81.2	3584.3765	3583.8125	6911.1	145	3.396	18.4	1	R.RINSNQVINAFNQQKPEEWTDSKATDDYNR.K
*	Jamie_Alpha_SPB_11.03679.03679.4	1.2915	0.0022	22.7	3707.2966	3711.9866	2110.9	238	2.835	8.3	1	R.RINSNQVINAFNQQKPEEWTDSKATDDYNRK.R
YNL126W	6	10	14.7%	846	98227	7.5	U	SPC98 SGDID:S000005070, Chr XIV from 387229-389769, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" 
*	Jamie_Alpha_SPB_31.11049.11049.2	1.8835	0.1266	32.2	1702.2922	1701.917	6304.2	15	3.588	42.9	1	R.YVPSSTYSSVTLRQL.S
*	Jamie_Alpha_SPB_84.30133.30133.4	3.3047	0.1115	81.3	3180.1765	3180.714	7308.0	18	3.785	22.2	1	K.IPNFESGLLHLIFEAGLLYQSLGYKVEK.F
*	Jamie_Alpha_SPB_63.22402.22402.2	3.6427	0.4262	100.0	2496.5923	2496.8193	9040.7	1	8.146	50.0	4	R.FTEHLEELSGDTFLIELNIFK.S
*	Jamie_Alpha_SPB_56.20058.20058.3	5.0916	0.4106	100.0	3886.3743	3885.1047	8742.8	1	7.661	29.7	2	R.ATYGEFFIAENTDTNGTDDDFIYHIPIEFNQER.V
*	Jamie_Alpha_SPB_56.20163.20163.2	1.5977	0.0522	75.9	1714.3522	1714.0183	7944.7	1	3.158	42.9	1	K.LTRVLQEAVQLSSLR.H
*	Jamie_Alpha_SPB_33.11744.11744.2	2.8344	0.2684	100.0	1379.6522	1380.4943	7715.9	2	5.19	63.6	1	K.NDGDEELFLLSK.S
Reverse_YOR255W	2	2	14.7%	278	32758	10.1	U	OSW1 SGDID:S000005781, Chr XV from 807270-808106, Verified ORF, "Protein of unknown function required for the construction of the outer spore wall layers" 
*	Jamie_Alpha_SPB_38.13650.13650.4	2.6905	0.0218	42.4	3104.0566	3109.507	6512.7	412	2.678	21.2	1	R.STEEEFLKGLLKSKGIEQNNRKEKSSK.K
*	Jamie_Alpha_SPB_18.06441.06441.2	1.6272	0.0831	10.6	1927.5922	1925.2118	7142.5	451	3.083	34.6	1	T.NYQHIHLKHVHWRR.K
YDR458C	4	4	14.6%	663	76377	7.8	U	YDR458C SGDID:S000002866, Chr IV from 1382036-1380045, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery" 
*	Jamie_Alpha_SPB_35.12464.12464.4	3.0695	0.0811	70.0	3429.8164	3426.9478	7507.2	14	3.109	20.6	1	R.QRLQSSPEASKVRTSIQKVVKSGAKNADRKK.T
*	Jamie_Alpha_SPB_46.16276.16276.4	3.2395	0.2471	23.1	5365.2964	5368.042	9809.6	37	4.561	13.0	1	D.RKKTLKSKKLESSSSESKTVKDENVETNKRKREQISTDNEAKMQIQ.E
*	Jamie_Alpha_SPB_75.26906.26906.2	1.312	0.1953	93.8	1321.7722	1320.4882	4800.5	42	4.044	50.0	1	K.SLAISAFPQTER.V
*	Jamie_Alpha_SPB_26.09268.09268.2	1.4286	0.1326	20.1	1286.4122	1288.4868	4914.8	5	3.794	60.0	1	K.LKDVKKNKGEE.P
YNL292W	2	2	14.4%	403	45273	6.6	U	PUS4 SGDID:S000005236, Chr XIV from 82806-84017, Verified ORF, "Pseudouridine synthase, catalyzes only the formation of pseudouridine-55 (Psi55), a highly conserved tRNA modification, in mitochondrial and cytoplasmic tRNAs; PUS4 overexpression leads to translational derepression of GCN4 (Gcd- phenotype)" 
*	Jamie_Alpha_SPB_55.19680.19680.4	2.7492	0.2368	44.8	3929.3765	3926.6626	5388.4	1	4.638	19.1	1	R.KQQYEKQTGKKASKRKLRKVSKVKMGHGGTLDPLA.S
*	Jamie_Alpha_SPB_86.31015.31015.2	1.3761	0.1228	11.1	2695.5923	2697.9646	8791.9	12	3.826	25.0	1	K.RDHDYPLLRPTTEEAVDTVKNLN.A
Reverse_YGL153W	2	2	14.4%	341	38420	4.9	U	PEX14 SGDID:S000003121, Chr VII from 216278-217303, Verified ORF, "Peroxisomal membrane protein that is a central component of the peroxisomal protein import machinery, interacts with PTS1 (Pex5p) and PTS2 (Pex7p) peroxisomal matrix protein signal recognition factors and membrane receptor Pex13p" 
*	Jamie_Alpha_SPB_38.13730.13730.3	2.7451	0.1923	13.7	3095.3943	3097.5103	8863.8	247	4.135	20.0	1	D.NDSVFKDITNQMNVVELKVIRFEDEI.K
*	Jamie_Alpha_SPB_94.33637.33637.4	3.352	0.0501	62.4	3278.2966	3279.672	6136.6	62	3.702	22.8	1	R.FEDEIKERSRTTQVLAQKLEAITDSLEK.L
YER022W	3	3	14.3%	687	78476	5.3	U	SRB4 SGDID:S000000824, Chr V from 198811-200874, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation" 
*	Jamie_Alpha_SPB_23.08007.08007.4	2.018	0.0040	25.1	4968.4565	4966.6265	7602.9	255	3.1	14.2	1	K.GWKLQSLNESKDLLRASFNKLSSILQNEHDYWNKIMQSISNK.D
*	Jamie_Alpha_SPB_32.11271.11271.4	2.5773	0.1657	10.2	5183.4165	5188.9507	9552.7	246	3.946	13.3	1	Y.KHDRGIANIRNNIESQNLDLIPHSSSVFKGTDFVHSVKKFLRVRI.F
*	Jamie_Alpha_SPB_28.10100.10100.2	1.2833	0.0341	65.9	1345.9722	1343.6151	6068.3	235	3.002	45.0	1	R.AFDKLLNIPRR.E
YOR009W	4	4	14.2%	487	47849	4.1	U	TIR4 SGDID:S000005535, Chr XV from 344334-345797, Verified ORF, "Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins; expressed under anaerobic conditions and required for anaerobic growth; transcription is also induced by cold shock" 
*	Jamie_Alpha_SPB_67.23998.23998.2	1.7491	0.1683	12.4	2450.9922	2449.557	9060.4	92	4.165	24.0	1	L.EAMDASLTTSSSAATSSSEVASSSIA.S
*	Jamie_Alpha_SPB_15.05224.05224.3	2.6827	0.2	16.5	2363.7844	2365.4211	6033.5	1	3.928	26.0	1	D.ASLTTSSSAATSSSEVASSSIASSTS.S
*	Jamie_Alpha_SPB_61.22020.22020.4	2.9856	0.1865	16.2	2663.2966	2658.7893	5991.3	492	4.065	20.2	1	V.SSSEAVSSSPVSSVVSSSAGPASSSVAPY.N
*	Jamie_Alpha_SPB_17.05928.05928.2	1.6585	0.0226	74.1	1007.21216	1006.14417	4526.3	20	3.137	72.2	1	K.SATVVSVQSK.T
YBR031W	3	3	14.1%	362	39092	10.6	U	RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" 
YDR012W	3	3	14.1%	362	39062	10.6	U	RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" 
	Jamie_Alpha_SPB_32.11298.11298.3	2.3466	0.0139	32.1	3409.4944	3405.888	6850.6	76	3.475	17.7	1	K.VNHNEKRYATASAIAATAVASLVLARGHRVEK.I
	Jamie_Alpha_SPB_31.11198.11198.2	1.6151	0.0947	86.0	2203.9321	2203.6357	7643.5	12	3.342	30.6	1	K.NKQVLLRLNPYAKVFAAEK.L
	Jamie_Alpha_SPB_89.31900.31900.2	1.8434	0.0818	21.1	1619.3522	1620.9352	6046.7	91	3.554	38.5	1	L.LRLNPYAKVFAAEK.L
YBR215W	3	3	14.0%	623	67517	9.2	U	HPC2 SGDID:S000000419, Chr II from 653441-655312, Verified ORF, "Highly charged, basic protein required for normal cell-cycle regulation of histone gene transcription; mutants display strong synthetic defects with subunits of FACT, a complex that allows RNA Pol II to elongate through nucleosomes" 
*	Jamie_Alpha_SPB_31.10940.10940.4	2.753	0.2096	13.9	2583.8965	2578.7644	5705.7	12	4.354	24.1	1	G.ASPSPIIISGSSSTSPSGPSSSSTNPMG.I
*	Jamie_Alpha_SPB_82.29374.29374.3	1.5949	0.0068	23.7	4152.7144	4154.453	11073.7	107	2.677	14.5	1	K.TLHINDTNGNKNSNAASNNIPSAYAELHTEGNSIESLIK.P
*	Jamie_Alpha_SPB_77.27649.27649.2	1.4664	0.1185	11.7	2301.8123	2304.669	8660.3	73	3.387	28.9	1	K.KSHPMKGKNLIGKYDVEDPF.I
Reverse_YBR199W	2	2	14.0%	464	54556	4.8	U	KTR4 SGDID:S000000403, Chr II from 618904-620298, Verified ORF, "Putative mannosyltransferase involved in protein glycosylation; member of the KRE2/MNT1 mannosyltransferase family" 
*	Jamie_Alpha_SPB_27.09771.09771.4	2.6712	0.1811	12.2	4947.6167	4945.4424	8420.5	167	3.793	14.2	1	A.PCTPCNTYPTHHYGIDRFWHISSKDAFLALALSRVPADGWRE.Y
*	Jamie_Alpha_SPB_83.29641.29641.2	1.8167	0.1501	12.5	2542.6921	2544.7063	6875.9	84	3.823	27.3	1	L.RDMISDLVEADHDPLEDASETKG.T
YHL034C	2	2	13.9%	294	32990	5.7	U	SBP1 SGDID:S000001026, Chr VIII from 34075-33191, reverse complement, Verified ORF, "Nucleolar single-strand nucleic acid binding protein; associates with small nuclear RNAs" 
*	Jamie_Alpha_SPB_65.23379.23379.2	1.8099	0.1549	14.1	1943.3522	1945.09	7030.5	38	3.857	31.2	1	E.EFGDEVSVEIPIKEHTD.G
*	Jamie_Alpha_SPB_46.16431.16431.4	2.7905	0.0857	67.6	2554.3364	2548.8408	4953.5	120	3.09	25.4	1	R.GGFRGRGGFRGRGGFRGGFRGGYR.G
Reverse_YPL253C	3	3	13.8%	647	75730	7.8	U	VIK1 SGDID:S000006174, Chr XVI from 73006-71063, reverse complement, Verified ORF, "Protein that forms a complex with Kar3p at the spindle pole body, possible regulator of Kar3p function in microtubule-mediated processes; required for sister chromatid cohesion; has similarity to Cik1p" 
*	Jamie_Alpha_SPB_39.13825.13825.4	3.3197	0.1593	16.0	4709.8164	4711.5493	9261.5	89	3.589	14.2	1	T.LLKNVNKSDNLNLLFFSKTDSILKKLVLAIPTECSEKKFIS.K
*	Jamie_Alpha_SPB_85.30345.30345.3	1.7627	0.0208	25.0	3153.4443	3157.5664	8057.8	218	2.764	18.3	1	K.ESESQLTAIQDLLERHKNTLNEMSKLK.A
*	Jamie_Alpha_SPB_67.23829.23829.2	1.6528	0.142	27.7	2499.152	2497.7334	7935.3	44	3.843	25.0	1	K.LQSIEETIEHDPEVNEMIQLE.N
YAL038W	6	6	13.8%	500	54545	7.7	U	CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" 
*	Jamie_Alpha_SPB_118.42423.42423.3	2.8443	0.1994	13.4	2468.1843	2467.7554	7249.2	166	4.311	26.2	1	V.DYPIPPNHEMIFTTDDKYAKA.C
*	Jamie_Alpha_SPB_37.13117.13117.2	3.4525	0.3768	100.0	1726.2722	1725.9365	6038.3	1	7.26	56.2	1	K.GVNLPGTDVDLPALSEK.D
*	Jamie_Alpha_SPB_17.05980.05980.2	1.6603	0.1362	94.7	1003.0722	1003.14355	4177.6	6	3.584	81.2	1	R.TANDVLTIR.E
*	Jamie_Alpha_SPB_48.17322.17322.2	3.2774	0.4865	100.0	2569.132	2570.8174	7012.8	1	8.74	50.0	1	R.GVFPFVFEKEPVSDWTDDVEAR.I
*	Jamie_Alpha_SPB_48.17318.17318.3	5.0563	0.466	100.0	2570.5745	2570.8174	7326.9	1	7.743	47.6	1	R.GVFPFVFEKEPVSDWTDDVEAR.I
*	Jamie_Alpha_SPB_24.08364.08364.2	3.6174	0.4066	100.0	1520.0521	1519.5646	8108.9	1	7.842	66.7	1	K.EPVSDWTDDVEAR.I
Reverse_YER028C	2	2	13.7%	394	43119	9.9	U	MIG3 SGDID:S000000830, Chr V from 211875-210691, reverse complement, Verified ORF, "Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes" 
*	Jamie_Alpha_SPB_94.33796.33796.3	1.4937	0.0387	24.6	3964.3145	3968.3477	8512.9	3	3.085	17.6	1	R.SFSKSPHSTQSLLSASSQNKSSSLSDPGSMAALNRRSK.S
*	Jamie_Alpha_SPB_54.19423.19423.2	1.7586	0.1557	12.7	1776.1322	1777.8113	8479.5	37	3.793	33.3	1	N.NGTNRINVDDCNQAVS.I
YJR053W	5	5	13.6%	574	66087	5.9	U	BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" 
*	Jamie_Alpha_SPB_22.07813.07813.2	3.1543	0.2646	100.0	2012.4722	2013.1687	6348.1	2	5.769	46.9	1	N.LALVNPAIREEEEDEER.E
*	Jamie_Alpha_SPB_21.07287.07287.2	2.6216	0.292	100.0	2672.9922	2672.7327	4901.1	2	5.87	34.8	1	F.EELEGEAIDETISSNDKESADHPR.F
*	Jamie_Alpha_SPB_20.07004.07004.3	2.1496	0.0983	67.8	1290.5343	1288.449	4054.0	138	3.68	40.0	1	K.HDELLTPGLHR.R
*	Jamie_Alpha_SPB_11.03841.03841.2	2.2014	0.1762	99.5	1153.0922	1153.237	6966.4	1	4.533	77.8	1	K.FSDVDTANRK.A
*	Jamie_Alpha_SPB_20.07246.07246.2	2.4615	0.1465	68.0	1785.1122	1784.8867	7566.3	1	5.005	43.3	1	I.SVDEETIMDESTVNSK.R
YGR241C	2	2	13.6%	568	64328	6.8	U	YAP1802 SGDID:S000003473, Chr VII from 976586-974880, reverse complement, Verified ORF, "Protein involved in clathrin cage assembly; binds Pan1p and clathrin; homologous to Yap1801p, member of the AP180 protein family" 
*	Jamie_Alpha_SPB_48.17042.17042.4	2.4044	0.0126	32.6	4248.1367	4248.826	7358.0	16	2.848	17.1	1	K.QKYVDPILSGTSSARGLQEITHALDIRLSDTAWTIVYK.A
*	Jamie_Alpha_SPB_1.00065.00065.4	1.1041	0.0188	23.1	4563.2964	4567.52	2856.4	46	3.362	5.3	1	K.RTLDLYKDFVDMTEYVVRYLKIGKAVGLKIPVIKHITTK.L
YLR314C	2	2	13.5%	520	60039	5.5	U	CDC3 SGDID:S000004306, Chr XII from 764137-762575, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM" 
*	Jamie_Alpha_SPB_45.16093.16093.2	1.7016	0.1607	28.6	2273.5522	2272.5347	9447.8	37	4.037	27.8	1	R.HSINDKRIHACLYFIEPTG.H
*	Jamie_Alpha_SPB_81.29163.29163.4	1.2064	0.0096	22.8	5853.9766	5859.805	5645.0	110	2.775	6.7	1	K.SETELFARHKEMKEKLTKQLKALEDKKKQLELSINSASPNVNHSPVPTKKK.G
YMR208W	3	3	13.5%	443	48460	5.6	U	ERG12 SGDID:S000004821, Chr XIII from 684466-685797, Verified ORF, "Mevalonate kinase, acts in the biosynthesis of isoprenoids and sterols, including ergosterol, from mevalonate" 
*	Jamie_Alpha_SPB_37.13052.13052.2	1.6236	0.1194	22.3	2611.3523	2609.1306	8203.3	377	4.517	21.7	1	L.ELIRINHGLLVSIGVSHPGLELIK.N
*	Jamie_Alpha_SPB_17.05919.05919.2	2.3631	0.0672	13.7	1418.9922	1419.6201	4328.3	6	3.878	55.0	1	S.FKKKLQDDFSY.E
*	Jamie_Alpha_SPB_76.27416.27416.3	2.0145	0.0566	42.0	3782.6643	3783.1128	7432.7	4	3.076	17.2	1	K.KLQDDFSYETFETDLGGTGCCLLSAKNLNKDLK.I
Reverse_YEL030W	2	2	13.4%	644	70085	6.3	U	ECM10 SGDID:S000000756, Chr V from 94644-96578, Verified ORF, "Heat shock protein of the Hsp70 family, localized in mitochondrial nucleoids, plays a role in protein translocation, interacts with Mge1p in an ATP-dependent manner; overexpression induces extensive mitochondrial DNA aggregations" 
*	Jamie_Alpha_SPB_38.13432.13432.4	2.0854	0.2378	14.5	5752.2964	5755.709	5135.9	72	3.75	10.6	1	A.AQIAAGLAVAEDPNVAKSADKGFLKKVTDAVKPMRSMGGVLLVDSIDSATIRADKL.A
*	Jamie_Alpha_SPB_73.26323.26323.3	2.2817	0.238	20.8	3370.1343	3372.9565	7760.9	8	4.14	19.8	1	K.VPDVTRDILPATINELQVRSFPMRIHKPGA.A
YHR018C	3	3	13.4%	463	51989	5.7	U	ARG4 SGDID:S000001060, Chr VIII from 141395-140004, reverse complement, Verified ORF, "Argininosuccinate lyase, catalyzes the final step in the arginine biosynthesis pathway" 
*	Jamie_Alpha_SPB_119.42675.42675.4	1.5314	0.04	25.1	4303.6963	4306.0605	8185.6	329	2.951	11.0	1	K.MYKADLEGTKVYTAGLQKLGLLTETELAKIHEGLAEIKK.E
*	Jamie_Alpha_SPB_16.05587.05587.2	1.8004	0.0339	82.2	1303.9321	1303.4177	6195.9	160	2.824	50.0	1	R.SRNDQVVTDLR.I
*	Jamie_Alpha_SPB_24.08553.08553.2	1.7932	0.0589	10.8	1113.7722	1112.2712	2917.1	22	3.325	54.5	1	R.LNQSPLGAGALA.G
YGL255W	2	2	13.3%	376	41582	5.8	U	ZRT1 SGDID:S000003224, Chr VII from 20978-22108, Verified ORF, "High-affinity zinc transporter of the plasma membrane, responsible for the majority of zinc uptake; transcription is induced under low-zinc conditions by the Zap1p transcription factor" 
*	Jamie_Alpha_SPB_25.08756.08756.3	2.6934	0.2133	13.7	3051.8643	3049.916	6107.4	41	4.378	18.5	1	V.SSENDNENGTANGSHDTKNGVEYYEDSD.A
*	Jamie_Alpha_SPB_35.12471.12471.4	2.5521	0.204	16.1	2371.2966	2375.776	7174.2	172	3.686	27.8	1	L.YPVLVFHQSFEGLGIGARLSAI.E
YKR052C	2	2	13.2%	304	33307	8.0	U	MRS4 SGDID:S000001760, Chr XI from 533106-532192, reverse complement, Verified ORF, "Mitochondrial iron transporter of the mitochondrial carrier family (MCF), very similar to and functionally redundant with Mrs3p; functions under low-iron conditions; may transport other cations in addition to iron" 
*	Jamie_Alpha_SPB_89.31917.31917.2	1.6836	0.0776	10.9	1639.5521	1638.9374	5786.0	80	3.305	39.3	1	K.ISTMEGSMALWKGVQ.S
*	Jamie_Alpha_SPB_96.34460.34460.2	1.4612	0.2557	60.2	2971.612	2970.3574	9394.9	30	4.883	18.8	1	R.LQLDTNLRVWNVTKQIYQNEGFAAF.Y
YPR088C	2	2	13.1%	541	59624	8.6	U	SRP54 SGDID:S000006292, Chr XVI from 713026-711401, reverse complement, Verified ORF, "Signal recognition particle (SRP) subunit (homolog of mammalian SRP54); contains the signal sequence-binding activity of SRP, interacts with the SRP RNA, and mediates binding of SRP to signal receptor; contains GTPase domain" 
*	Jamie_Alpha_SPB_74.26504.26504.3	1.7395	0.1029	48.7	4084.8245	4080.834	6833.8	42	3.52	17.1	1	K.AFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKR.G
*	Jamie_Alpha_SPB_31.11162.11162.4	3.6957	0.137	13.7	3670.9766	3675.3638	6212.5	14	3.578	18.6	1	Q.MMARMAQTATQQQPGAPGANARMPGMPNMPGMPNM.P
YHR179W	2	2	13.0%	400	45011	6.6	U	OYE2 SGDID:S000001222, Chr VIII from 462502-463704, Verified ORF, "Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye3p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism" 
*	Jamie_Alpha_SPB_90.32178.32178.3	2.52	0.2087	17.1	2408.7544	2407.6018	5545.3	45	3.954	26.1	1	E.YVQAAKNSIAAGADGVEIHSANGY.L
*	Jamie_Alpha_SPB_90.32192.32192.3	3.253	0.3117	25.0	2814.5942	2811.139	7751.8	1	5.633	25.0	1	V.DAIGPEKVGLRLSPYGVFNSMSGGAETG.I
YHR172W	6	14	12.9%	823	96825	6.4	U	SPC97 SGDID:S000001215, Chr VIII from 448335-450806, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" 
*	Jamie_Alpha_SPB_33.11618.11618.2	3.1042	0.3239	100.0	2093.612	2092.2227	8231.0	3	5.898	50.0	1	R.YFNDYEPSDPETPIEFK.I
*	Jamie_Alpha_SPB_23.08314.08314.2	2.3227	0.1596	99.5	1612.9922	1613.6844	6397.1	82	4.446	41.7	1	R.DCDSEEDKNLLFK.M
*	Jamie_Alpha_SPB_61.21874.21874.2	1.7215	0.021	73.1	1788.7922	1789.1277	7603.5	285	3.167	35.7	1	K.FDINIPYPLNIIISR.T
*	Jamie_Alpha_SPB_61.21984.21984.3	4.1366	0.3157	100.0	2470.0144	2470.8035	7067.9	1	6.778	36.4	1	R.NPTLAVAIQNELEGGLTNIMTNR.C
*	Jamie_Alpha_SPB_35.12384.12384.2	4.3514	0.2401	100.0	2395.4321	2393.5261	6111.3	1	5.611	54.8	7	R.TNNGGQEDVGYQEDAALELIQK.L
*	Jamie_Alpha_SPB_33.11888.11888.2	4.1373	0.4278	100.0	1780.7522	1779.8572	7273.4	1	7.789	73.3	3	K.FDFYDSSSVDAAGIER.V
YKL106W	2	2	12.9%	451	51795	8.9	U	AAT1 SGDID:S000001589, Chr XI from 237180-238535, Verified ORF, "Mitochondrial aspartate aminotransferase, catalyzes the conversion of oxaloacetate to aspartate in aspartate and asparagine biosynthesis" 
*	Jamie_Alpha_SPB_83.29860.29860.2	1.7982	0.1574	28.7	1891.3522	1894.2676	6137.6	191	3.525	27.8	1	L.SGTGALAVAAKFLALFISR.D
*	Jamie_Alpha_SPB_103.37041.37041.4	2.9639	0.1781	16.9	4470.7363	4468.177	8388.0	6	4.186	17.5	1	Q.QNIDSQLKKIVRGMYSSPPGYGSRVVNVVLSDFKLKQQW.F
YNL177C	2	2	12.9%	309	34931	10.0	U	MRPL22 SGDID:S000005121, Chr XIV from 304617-303688, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" 
*	Jamie_Alpha_SPB_80.28662.28662.3	1.8498	0.1014	51.0	4453.8843	4451.327	7526.5	74	3.646	13.5	1	K.ATLLLRLLGGLDVMKAISQCHFSNKKIAREVAELLQKGVK.D
*	Jamie_Alpha_SPB_115.41103.41103.1	1.3994	0.0598	92.6	929.07	930.08923	5396.4	212	2.969	50.0	1	R.EVAELLQK.G
YFL053W	2	2	12.7%	591	62135	5.9	U	DAK2 SGDID:S000001841, Chr VI from 23423-25198, Verified ORF, "Dihydroxyacetone kinase, required for detoxification of dihydroxyacetone (DHA); involved in stress adaptation" 
*	Jamie_Alpha_SPB_119.42687.42687.3	1.3434	0.0072	22.8	3349.4644	3345.957	3815.8	279	3.013	12.5	1	K.VELVAVGDDVSVGKKKGSLVGRRGLGATVLVHK.I
*	Jamie_Alpha_SPB_84.30110.30110.4	2.2289	0.0115	30.3	5898.2163	5899.6504	9155.5	281	3.137	11.8	1	K.GSLVGRRGLGATVLVHKIAGAAASHGLELAEVAEVAQSVVDNSVTIAASLDHCTVPGHK.P
YER006W	2	2	12.7%	520	57709	8.9	U	NUG1 SGDID:S000000808, Chr V from 162722-164284, Verified ORF, "GTPase that associates with nuclear 60S pre-ribosomes, required for export of 60S ribosomal subunits from the nucleus" 
*	Jamie_Alpha_SPB_57.20282.20282.4	1.9053	0.0241	26.6	4940.4565	4940.696	9683.9	44	2.798	14.0	1	K.SVIDASDVILYVLDARDPESTRSRKVEEAVLQSQGKRLILILNK.V
*	Jamie_Alpha_SPB_36.12848.12848.2	1.8891	0.0455	11.6	2231.5723	2232.4216	6760.0	171	3.47	26.2	1	R.GGQSKACPVGNEAGVTTSLREI.K
contaminant_KERATIN16	2	2	12.7%	534	57265	6.6	U	no description
*	Jamie_Alpha_SPB_56.20188.20188.4	2.2113	0.1707	80.8	4393.4565	4388.8506	8813.7	25	3.577	16.2	1	K.QLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKR.T
*	Jamie_Alpha_SPB_118.42219.42219.4	3.2182	0.1598	14.6	2791.8965	2790.921	7777.2	1	3.707	23.9	1	G.ECQSAVSISVVSGSTSTGGISGGLGSGSGFG.L
YDL097C	2	2	12.7%	434	49774	6.3	U	RPN6 SGDID:S000002255, Chr IV from 286695-285391, reverse complement, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome lid required for the assembly and activity of the 26S proteasome; the human homolog (S9 protein) partially rescues Rpn6p depletion" 
*	Jamie_Alpha_SPB_16.05565.05565.2	2.1647	0.0454	25.3	1283.5122	1282.5438	6389.1	21	3.438	55.0	1	L.YVTMGAKDKLR.E
*	Jamie_Alpha_SPB_21.07275.07275.4	1.8584	0.0401	30.1	5086.2563	5085.6724	8522.2	99	3.212	13.6	1	K.ETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTR.S
YOR230W	2	2	12.6%	437	48383	5.4	U	WTM1 SGDID:S000005756, Chr XV from 770800-772113, Verified ORF, "Transcriptional repressor involved in regulation of meiosis and silencing; contains WD repeats" 
*	Jamie_Alpha_SPB_64.23023.23023.3	2.105	0.0037	26.7	4661.9644	4658.2744	9806.5	22	3.256	15.0	1	K.SSTPSTYEHISSLRPKFVSRVDNVLHQRKSLTFSNVVVPDK.K
*	Jamie_Alpha_SPB_60.21463.21463.2	1.825	0.0542	84.6	1502.9122	1505.717	5803.0	195	3.291	38.5	1	R.TVHVPGTTVTHTVR.F
YPL154C	2	2	12.6%	405	44499	4.8	U	PEP4 SGDID:S000006075, Chr XVI from 260930-259713, reverse complement, Verified ORF, "Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; synthesized as a zymogen, self-activates" 
*	Jamie_Alpha_SPB_3.01024.01024.4	1.2491	0.2937	15.8	4088.1765	4091.9316	2459.9	324	4.865	3.7	1	M.FSLKALLPLALLLVSANQVAAKVHKAKIYKHELSDEM.K
*	Jamie_Alpha_SPB_30.10808.10808.2	1.7433	0.2225	67.1	1383.7322	1383.3679	4809.2	8	4.354	50.0	1	K.DTENGGEATFGGID.E
YCR090C	2	2	12.6%	182	20703	4.9	U	YCR090C SGDID:S000000686, Chr III from 272859-272311, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_20.06966.06966.2	2.0694	0.0135	87.1	961.39215	961.294	3473.2	166	3.075	64.3	1	-.MPLFLVLK.A
*	Jamie_Alpha_SPB_22.07647.07647.2	2.1221	0.0645	23.5	1831.8121	1833.0543	7296.3	16	3.143	46.4	1	T.DQSDDKWAKIKDVRK.K
Reverse_YNL166C	2	2	12.5%	448	49694	4.9	U	BNI5 SGDID:S000005110, Chr XIV from 323567-322221, reverse complement, Verified ORF, "Protein involved in organization of septins at the mother-bud neck, may interact directly with the Cdc11p septin, localizes to bud neck in a septin-dependent manner" 
*	Jamie_Alpha_SPB_40.14289.14289.3	2.016	0.0124	27.4	2006.7544	2010.2053	7389.0	48	2.757	30.3	1	K.AISGLESASTIPSSVPSDYK.N
*	Jamie_Alpha_SPB_47.16830.16830.4	3.7114	0.1666	15.1	3563.2566	3564.7551	8318.9	55	3.497	17.6	1	E.VQASDGPNSDAGDNGSFLATEAVKVADVVGTDKVND.E
Reverse_YMR243C	3	3	12.4%	442	48345	6.4	U	ZRC1 SGDID:S000004856, Chr XIII from 756165-754837, reverse complement, Verified ORF, "Vacuolar membrane zinc transporter, transports zinc from the cytosol into the vacuole for storage; also has a role in resistance to zinc shock resulting from a sudden influx of zinc into the cytoplasm" 
*	Jamie_Alpha_SPB_70.25178.25178.4	2.7688	0.1986	14.3	3754.2966	3749.9492	6709.2	2	3.756	20.8	1	S.SATTAGYATPSRKKRGHETNGHSDFAEQSSSPSGGAI.I
*	Jamie_Alpha_SPB_29.10459.10459.2	1.7411	0.095	23.0	1096.8722	1096.185	3359.2	9	3.437	60.0	1	S.ATTAGYATPSR.K
*	Jamie_Alpha_SPB_72.25963.25963.2	1.6649	0.0907	11.4	2115.612	2114.5327	8480.7	3	4.095	32.4	1	S.SFIIITIILSVIPDSYYR.W
YKR025W	3	3	12.4%	282	32142	4.5	U	RPC37 SGDID:S000001733, Chr XI from 487413-488261, Verified ORF, "RNA polymerase III subunit C37" 
*	Jamie_Alpha_SPB_93.33358.33358.2	1.4739	0.1318	20.8	1375.0721	1375.4778	4955.3	66	3.599	45.5	1	K.ISGEEESLHVFQ.Y
*	Jamie_Alpha_SPB_42.15175.15175.3	2.3066	0.2384	10.8	1672.6444	1670.9578	3483.2	3	4.748	38.5	1	S.LHVFQYANRPRLVG.R
*	Jamie_Alpha_SPB_15.05224.05224.2	1.8881	0.0025	73.6	1576.1921	1575.7184	6033.5	266	3.154	42.3	1	K.AESEWNGVNVQTLK.G
contaminant_gi|135017|sp|P07518|SUBT_BAC	3	3	12.4%	275	27656	6.8	U	SUBTILISIN (ALKALINE MESENTERICOPEPTIDASE) 
*	Jamie_Alpha_SPB_3.00868.00868.1	1.6166	0.2718	100.0	723.85	723.80695	3408.6	2	4.787	66.7	1	K.APALHSQ.G
*	Jamie_Alpha_SPB_13.04656.04656.2	2.8314	0.4455	100.0	1530.0521	1530.6805	4541.2	1	7.948	60.7	1	K.APALHSQGYTGSNVK.V
*	Jamie_Alpha_SPB_35.12534.12534.2	3.0774	0.4384	100.0	1859.7722	1861.1484	6755.8	1	6.747	61.1	1	L.NNSIGVLGVAPSSALYAVK.V
Reverse_YLR051C	2	2	12.4%	217	25636	9.5	U	YLR051C SGDID:S000004041, Chr XII from 246978-246325, reverse complement, Uncharacterized ORF, "Protein required for cell viability" 
*	Jamie_Alpha_SPB_75.27025.27025.3	1.8143	0.0369	28.8	3240.5344	3237.652	9808.2	6	3.305	23.1	1	K.EQIENYKRKFYKNSAEDGMLTELITSK.R
*	Jamie_Alpha_SPB_54.19420.19420.3	2.247	0.0343	41.1	2333.3342	2332.677	6766.7	20	2.648	28.9	1	K.RKFYKNSAEDGMLTELITSK.R
YDR432W	3	3	12.3%	414	45407	5.5	U	NPL3 SGDID:S000002840, Chr IV from 1328773-1330017, Verified ORF, "RNA-binding protein that carries poly(A)+ mRNA from the nucleus into the cytoplasm; phosphorylation by Sky1p in the cytoplasm may promote release of mRNAs" 
*	Jamie_Alpha_SPB_24.08371.08371.2	2.9636	0.293	100.0	1586.4922	1585.6677	6232.7	1	6.043	53.8	1	R.ENSLETTFSSVNTR.D
*	Jamie_Alpha_SPB_64.22836.22836.2	4.3244	0.4835	100.0	2438.3123	2438.6501	6144.1	1	8.577	54.8	1	R.DFDGTGALEFPSEEILVEALER.L
*	Jamie_Alpha_SPB_64.23092.23092.2	1.6367	0.1699	13.6	1706.9321	1707.8495	7509.6	2	3.508	39.3	1	E.RDDNPPPIRRSNRGG.F
Reverse_YLR270W	2	2	12.3%	350	40770	6.3	U	DCS1 SGDID:S000004260, Chr XII from 681188-682240, Verified ORF, "Non-essential hydrolase involved in mRNA decapping, may function in a feedback mechanism to regulate deadenylation, contains pyrophosphatase activity and a HIT (histidine triad) motif; interacts with neutral trehalase Nth1p" 
*	Jamie_Alpha_SPB_52.18686.18686.4	2.5648	0.0899	63.0	3752.2566	3755.2224	5238.6	193	3.63	18.3	1	K.PIGDRELQKTLEEELGRKWLDHNEGIAYTITK.N
*	Jamie_Alpha_SPB_27.09580.09580.2	1.3705	0.0057	64.8	1414.4521	1412.678	6138.0	98	2.836	45.0	1	R.IKNNLNILWQR.D
Reverse_YPR112C	4	4	12.2%	887	101120	6.6	U	MRD1 SGDID:S000006316, Chr XVI from 751917-749254, reverse complement, Verified ORF, "Essential conserved protein that associates with 35S precursor rRNA and is required for its initial processing at the A(0)-A(2) cleavage sites, shows partial nucleolar localization, contains five consensus RNA-binding domains" 
*	Jamie_Alpha_SPB_28.10006.10006.4	2.976	0.1876	15.8	4665.177	4660.235	5812.0	65	3.881	14.6	1	E.EDDVDLKKRGGGNRLAAMENTAVQKRVKKTMRAIEEEADVAD.E
*	Jamie_Alpha_SPB_37.13252.13252.2	1.6297	0.0783	10.6	2349.872	2350.5132	8255.4	467	3.257	22.5	1	A.STNNILDDAEAPKTFCDKPGR.E
*	Jamie_Alpha_SPB_58.20650.20650.2	1.6454	0.1641	10.5	2402.372	2402.8384	7091.7	40	4.306	26.3	1	A.ERRKEKMPQPVRPDAFSKAM.S
*	Jamie_Alpha_SPB_89.31890.31890.4	2.7443	0.1763	12.1	2789.6165	2786.1233	4951.5	139	3.29	24.3	1	N.RDRLIKVDTILDPGSGNVAQHSHKQ.R
YPL074W	3	3	12.2%	754	85300	9.6	U	YTA6 SGDID:S000005995, Chr XVI from 415760-418024, Verified ORF, "Putative ATPase of the CDC48/PAS1/SEC18 (AAA) family, localized to the cortex of mother cells but not to daughter cells" 
*	Jamie_Alpha_SPB_94.33691.33691.4	2.4853	0.1274	76.2	4074.2566	4071.805	6963.6	292	3.173	16.7	1	R.YKPTPPLKKRYDYKKPTVNRPIIKSPTLNRQNSK.S
*	Jamie_Alpha_SPB_84.30044.30044.3	1.7117	9.0E-4	24.0	3397.6443	3395.662	9122.9	29	2.779	16.9	1	R.SKSGTPDKESSASSSLDSRKEDILKSVQGVDR.N
*	Jamie_Alpha_SPB_30.10762.10762.3	3.0206	0.2067	40.9	2783.2744	2786.1416	7666.8	359	4.237	21.0	1	L.ITEMTEGFSGSDLTSLAKEAAMEPIR.D
YOR049C	2	2	12.1%	354	40396	7.6	U	RSB1 SGDID:S000005575, Chr XV from 423732-422668, reverse complement, Verified ORF, "Suppressor of sphingoid long chain base (LCB) sensitivity of an LCB-lyase mutation; putative integral membrane transporter or flippase that may transport LCBs from the cytoplasmic side toward the extracytoplasmic side of the membrane" 
*	Jamie_Alpha_SPB_65.23389.23389.3	2.6364	0.2008	17.0	2495.8743	2495.8398	4888.4	43	4.416	26.2	1	G.RTWSHSNVADMDAFLLNMICL.T
*	Jamie_Alpha_SPB_23.08029.08029.2	1.4996	0.1312	20.9	2326.9321	2329.5254	5215.5	22	3.395	28.6	1	R.STSIPITPGHVDPETLPHTDDV.E
YNR030W	2	2	12.0%	551	62673	7.1	U	ALG12 SGDID:S000005313, Chr XIV from 678801-680456, Verified ORF, "Alpha-1,6-mannosyltransferase localized to the ER; responsible for the addition of the alpha-1,6 mannose to dolichol-linked Man7GlcNAc2, acts in the dolichol pathway for N-glycosylation" 
*	Jamie_Alpha_SPB_50.17970.17970.4	3.0793	0.1402	10.3	5488.9365	5484.3135	10606.2	221	3.09	12.3	1	D.TVLLTVISFHLIQAPFTKVEESFNIQAIHDILTYSVFDISQYDHLKF.P
*	Jamie_Alpha_SPB_82.29528.29528.2	1.8368	0.058	85.4	1996.7322	1994.4252	7799.5	304	3.721	27.8	1	R.LEVSALSAGIALFSVIFKK.I
Reverse_YJL059W	2	2	12.0%	408	46383	7.2	U	YHC3 SGDID:S000003595, Chr X from 324880-326106, Verified ORF, "Vacuolar membrane protein involved in the ATP-dependent transport of arginine into the vacuole and possibly in balancing ion homeostasis; homolog of human CLN3 involved in Batten disease (juvenile onset neuronal ceroid lipofuscinosis)" 
*	Jamie_Alpha_SPB_85.30409.30409.4	2.8883	0.2003	13.9	2865.4165	2861.3691	5282.5	234	3.952	21.4	1	L.TLKVPVKFISTLFMYSAGGIIGAGGTGSS.W
*	Jamie_Alpha_SPB_42.14982.14982.2	1.8946	0.1474	15.5	2051.7522	2052.5054	8604.0	8	4.379	28.9	1	I.ALSPFIDALLVLSKPLTPGV.I
Reverse_YBR170C	2	2	11.9%	580	65782	5.7	U	NPL4 SGDID:S000000374, Chr II from 578081-576339, reverse complement, Verified ORF, "Endoplasmic reticulum and nuclear membrane protein, forms a complex with Cdc48p and Ufd1p that recognizes ubiquitinated proteins in the endoplasmic reticulum and delivers them to the proteasome for degradation" 
*	Jamie_Alpha_SPB_54.19309.19309.4	1.9156	0.0878	46.8	5155.4966	5156.7036	8277.8	132	3.136	11.4	1	K.VQEVDMTLGDQEDHQPPEYIAEVVAKIGLPTNDYKSYSGYMYGFR.Q
*	Jamie_Alpha_SPB_58.20934.20934.2	1.196	0.1447	10.4	2989.4321	2992.3235	9280.5	120	3.638	19.6	1	D.WPPLPSCYECMGRDGHKCLKSKQR.P
YHR019C	4	4	11.9%	554	62207	5.8	U	DED81 SGDID:S000001061, Chr VIII from 143551-141887, reverse complement, Verified ORF, "Cytosolic asparaginyl-tRNA synthetase, required for protein synthesis, catalyzes the specific attachment of asparagine to its cognate tRNA" 
*	Jamie_Alpha_SPB_67.24134.24134.4	3.534	0.1569	13.7	3636.2966	3631.0293	7144.9	41	3.39	19.4	1	E.VTPPCMVQTQVEGGSTLFKMNYYGEEAYLTQS.S
*	Jamie_Alpha_SPB_31.10975.10975.2	3.7402	0.3347	100.0	2142.172	2143.1846	9743.1	14	6.628	36.1	1	K.NEEGEDFKFGDDIAEAAER.K
*	Jamie_Alpha_SPB_18.06360.06360.2	2.2037	0.2345	100.0	1195.8922	1194.2432	4265.4	1	4.332	85.0	1	K.FGDDIAEAAER.K
*	Jamie_Alpha_SPB_79.28416.28416.2	1.7982	0.1394	94.7	1625.1322	1625.7039	5893.2	391	3.346	32.1	1	K.YGTCPHGGYGIGTER.I
Reverse_YLR399C	3	3	11.8%	686	76978	6.0	U	BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p" 
*	Jamie_Alpha_SPB_101.36314.36314.4	3.629	0.2354	98.5	3189.3765	3191.2627	5988.2	43	4.392	22.4	1	R.SGASTPSLSSADRTVGSTGDLGNSAGSSSEYQR.F
*	Jamie_Alpha_SPB_94.33718.33718.4	2.9804	0.0621	59.7	3853.1365	3847.3845	7093.1	428	3.451	17.7	1	K.SKPPHITRKPRGNHTQARRIVIPADEQASSRRGK.A
*	Jamie_Alpha_SPB_64.22870.22870.2	1.86	0.1192	11.5	1491.0521	1488.6407	5169.0	89	3.309	46.2	1	Q.KTGQGGEEKKLGQQ.E
YOR216C	3	3	11.8%	484	56069	4.9	U	RUD3 SGDID:S000005742, Chr XV from 748979-747525, reverse complement, Verified ORF, "Golgi matrix protein involved in the structural organization of the cis-Golgi; interacts genetically with COG3 and USO1" 
*	Jamie_Alpha_SPB_94.33787.33787.4	2.0254	0.0842	50.7	3984.8965	3987.431	8914.8	201	3.092	17.7	1	K.AGDEMKELREEIERLKLELSHKKDQETPNEDFK.N
*	Jamie_Alpha_SPB_61.21750.21750.2	1.8323	0.0594	87.2	1231.6522	1233.3237	3762.8	224	3.14	55.6	1	K.QDISDLRTER.D
*	Jamie_Alpha_SPB_45.16106.16106.2	1.5785	0.1174	21.1	1741.9521	1739.9653	5870.3	1	3.598	46.2	1	K.FEVLELLSNFLNWD.E
YCR012W	3	3	11.8%	416	44738	7.6	U	PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" 
*	Jamie_Alpha_SPB_116.41610.41610.1	1.4003	0.2032	20.0	1070.49	1071.2621	6248.0	185	4.235	40.9	1	E.AAVKASAPGSVI.L
*	Jamie_Alpha_SPB_15.05452.05452.2	2.0537	0.108	95.2	1149.0721	1148.4343	4498.9	428	3.781	50.0	1	R.KLFAATVAKAK.T
*	Jamie_Alpha_SPB_66.23710.23710.2	1.7019	0.174	13.4	2601.912	2603.9353	8607.1	24	4.922	24.0	1	A.GNTVIIGGGDTATVAKKYGVTDKISH.V
Reverse_YGR168C	2	2	11.7%	376	44301	10.3	U	YGR168C SGDID:S000003400, Chr VII from 834487-833357, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_17.06052.06052.2	1.9472	0.0512	19.9	1171.1721	1171.4258	5374.0	332	3.176	50.0	1	Q.INEGQLKKLK.W
*	Jamie_Alpha_SPB_6.02096.02096.4	1.1041	0.085	25.2	4150.177	4155.2417	2128.6	9	3.081	6.6	1	K.KVYFVLNIGYVQTIRKLIIVLQKRRKKNLLLLLR.R
Reverse_YJL046W	2	2	11.5%	409	47003	7.4	U	YJL046W SGDID:S000003582, Chr X from 352302-353531, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_12.04323.04323.2	1.8947	0.0689	23.2	1147.9122	1149.292	4656.7	59	3.756	61.1	1	I.KFGDQIIDGR.E
*	Jamie_Alpha_SPB_69.24680.24680.4	1.9989	0.0445	36.6	4446.6567	4447.0347	9031.4	410	2.51	14.8	1	K.LKALDVEQWLNQNKGIVACRDNIYFLLRCNDPGRKAR.P
Reverse_contaminant_A45063	2	2	11.4%	455	49926	4.7	U	owl|A45063| immunoglobulin binding protein LG - Peptostreptococcus magnus 
*	Jamie_Alpha_SPB_50.17908.17908.2	1.575	0.1098	15.2	2482.9521	2481.8262	10070.2	3	3.744	27.5	1	K.YTDMPEEPKEDVKKGAFRINI.T
*	Jamie_Alpha_SPB_72.25863.25863.4	3.57	0.0842	78.7	3462.3765	3458.8035	7713.1	333	3.85	18.9	1	K.PEEPTKEKGAFKINLTYGKDAVDVTYEGNDK.K
YNL309W	2	2	11.4%	420	45684	9.5	U	STB1 SGDID:S000005253, Chr XIV from 52661-53923, Verified ORF, "Protein with a role in regulation of MBF-specific transcription at Start, phosphorylated by Cln-Cdc28p kinases in vitro; unphosphorylated form binds Swi6p and binding is required for Stb1p function; expression is cell-cycle regulated" 
*	Jamie_Alpha_SPB_67.24087.24087.2	1.4176	0.0324	68.6	2053.9722	2056.119	7844.2	11	2.789	32.4	1	R.NNNNSSNHSNNNNNIKKK.A
*	Jamie_Alpha_SPB_47.16747.16747.4	3.4569	0.1804	12.2	3415.2966	3420.9062	5475.6	7	4.41	23.0	1	L.MYLATSPYNKSSHHGTPMAVRMPTTPRSYH.Y
Reverse_YLR244C	2	2	11.4%	387	43373	7.9	U	MAP1 SGDID:S000004234, Chr XII from 626333-625170, reverse complement, Verified ORF, "Methionine aminopeptidase, catalyzes the cotranslational removal of N-terminal methionine from nascent polypeptides; function is partially redundant with that of Map2p" 
*	Jamie_Alpha_SPB_54.19318.19318.4	3.3572	0.1666	14.3	3561.8965	3560.9465	7765.2	73	4.083	19.4	1	G.PKMVGPTRNKAYHPINPSCHFFEGVGHGCYT.R
*	Jamie_Alpha_SPB_65.23164.23164.2	1.9439	0.0291	10.6	1501.6322	1503.7844	5667.7	2	2.8	54.2	1	L.PYSAKVKGSYKFK.P
YBR068C	2	2	11.3%	609	67670	8.1	U	BAP2 SGDID:S000000272, Chr II from 375687-373858, reverse complement, Verified ORF, "High-affinity leucine permease, functions as a branched-chain amino acid permease involved in the uptake of leucine, isoleucine and valine; contains 12 predicted transmembrane domains" 
*	Jamie_Alpha_SPB_58.20641.20641.2	1.479	0.1743	11.2	2667.0122	2669.8674	8216.0	95	4.416	21.7	1	S.IRSFSAGNNFQSSSSEKTYSKQKS.G
*	Jamie_Alpha_SPB_51.18189.18189.3	1.4444	0.3028	10.7	5025.744	5027.5757	4703.3	402	4.889	6.2	1	D.SFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVV.M
YCR008W	2	2	11.3%	603	66666	9.2	U	SAT4 SGDID:S000000601, Chr III from 128467-130278, Verified ORF, "Ser/Thr protein kinase involved in salt tolerance; funtions in regulation of Trk1p-Trk2p potassium transporter; partially redundant with Hal5p; has similarity to Npr1p" 
*	Jamie_Alpha_SPB_68.24194.24194.2	1.3435	0.0149	64.5	1932.3522	1933.2822	8819.7	91	2.939	31.2	1	R.KHALSSKVMQLFRSGSR.S
*	Jamie_Alpha_SPB_85.30349.30349.4	2.2981	0.0715	50.6	5146.4165	5148.7017	9710.7	99	3.868	12.7	1	R.QGKASSNIQPPSNINTNVPSASKSAKFGLHTPTTATPRVVSNPSNTAGVSK.P
Reverse_YMR017W	3	3	11.3%	397	46622	9.2	U	SPO20 SGDID:S000004619, Chr XIII from 307488-308681, Verified ORF, "Meiosis-specific subunit of the t-SNARE complex, required for prospore membrane formation during sporulation; similar to but not functionally redundant with Sec9p; SNAP-25 homolog" 
*	Jamie_Alpha_SPB_22.07636.07636.2	1.5673	0.1022	11.3	2618.9321	2621.022	7717.0	5	3.444	29.5	1	L.VRKGTCRAEIAKELTRSTTKVSK.L
*	Jamie_Alpha_SPB_38.13724.13724.3	2.4115	0.0553	51.3	2322.2644	2321.6829	8002.1	221	3.555	27.6	1	K.ELTRSTTKVSKLKTSRIESR.L
*	Jamie_Alpha_SPB_32.11402.11402.2	1.762	0.0574	10.8	1606.9521	1607.7635	6956.3	176	3.298	41.7	1	P.QVNELNYQSEVKR.W
Reverse_YMR005W	2	2	11.3%	388	42336	9.7	U	TAF4 SGDID:S000004607, Chr XIII from 276045-277211, Verified ORF, "TFIID subunit (48 kDa), involved in RNA polymerase II transcription initiation; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_56.19878.19878.2	1.6678	0.1165	23.1	1515.0122	1516.7439	5945.2	451	3.099	35.7	1	Q.KKSGARLGATVNSAR.H
*	Jamie_Alpha_SPB_64.23068.23068.3	1.3981	0.036	23.8	3283.0745	3286.9043	7668.3	5	2.76	21.4	1	K.KQILAIARLAASVESRRGSNIKVAKRRHR.S
Reverse_YOR051C	2	2	11.2%	412	47352	4.8	U	YOR051C SGDID:S000005577, Chr XV from 426085-424847, reverse complement, Uncharacterized ORF, "Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" 
*	Jamie_Alpha_SPB_13.04604.04604.3	2.6679	0.1595	87.0	2213.8743	2216.5425	4675.2	93	3.291	25.0	1	K.ELYELAKKTHKLATEQANK.A
*	Jamie_Alpha_SPB_40.14368.14368.4	2.5114	0.0032	31.4	5150.5767	5155.7246	8300.1	116	2.834	14.1	1	K.ELYELAKKTHKLATEQANKAEKDSVKESGGDDYQLSLFVKSPEEAK.K
Reverse_YKR013W	2	2	11.2%	329	33780	4.6	U	PRY2 SGDID:S000001721, Chr XI from 463602-464591, Verified ORF, "Protein of unknown function, has similarity to Pry1p and Pry3p and to the plant PR-1 class of pathogen related proteins" 
*	Jamie_Alpha_SPB_117.42022.42022.3	1.6232	0.0133	23.6	3627.5044	3624.262	7601.2	35	3.362	14.6	1	R.VIGQVVVTAAQHVHQTVTVAVPASLAVSASAALLSVK.S
*	Jamie_Alpha_SPB_35.12330.12330.2	2.097	0.0458	16.4	1654.9722	1655.9756	6154.0	401	3.316	32.4	1	V.AVPASLAVSASAALLSVK.S
YNL330C	2	2	11.1%	433	48904	5.5	U	RPD3 SGDID:S000005274, Chr XIV from 19302-18001, reverse complement, Verified ORF, "Histone deacetylase; regulates transcription and silencing" 
*	Jamie_Alpha_SPB_14.04796.04796.4	3.4524	0.2033	38.7	3661.7366	3665.0493	5059.6	1	3.951	23.0	1	K.PATKQEMCQFHTDEYIDFLSRVTPDNLEMF.K
*	Jamie_Alpha_SPB_38.13557.13557.3	2.5113	0.1989	16.8	1800.5343	1801.0555	4321.0	5	4.159	36.8	1	I.GVGAGKNYAVNVPLRDGI.D
YGR159C	2	2	11.1%	414	44535	4.9	U	NSR1 SGDID:S000003391, Chr VII from 807661-806417, reverse complement, Verified ORF, "Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis" 
*	Jamie_Alpha_SPB_26.09151.09151.3	3.853	0.2221	98.6	3813.0544	3813.9324	8031.4	1	5.861	26.6	1	R.KSEDAEEEEDEESSNKKQKNEETEEPATIFVGR.L
*	Jamie_Alpha_SPB_32.11440.11440.2	1.557	0.1767	14.2	1177.8121	1178.2557	5218.2	7	3.803	54.2	1	G.RGGSRGFGGRGGG.R
YMR055C	2	2	11.1%	306	35028	8.6	U	BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" 
*	Jamie_Alpha_SPB_118.42361.42361.2	1.7128	0.0723	11.7	2249.412	2246.612	8948.4	36	3.583	28.9	1	S.IEDLISNPPLLLHSSLSQLR.Y
*	Jamie_Alpha_SPB_37.13161.13161.2	2.7264	0.0698	96.3	1577.7322	1577.8151	7686.3	1	3.844	65.4	1	R.YLILSEGLPISEDK.Q
Reverse_YGR042W	2	2	11.1%	271	31025	9.7	U	YGR042W SGDID:S000003274, Chr VII from 579480-580295, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_39.13766.13766.2	1.7429	0.0688	10.5	1472.8722	1472.6438	8136.1	2	3.028	50.0	1	K.QVSLNSPYARVHT.A
*	Jamie_Alpha_SPB_33.11600.11600.4	2.5479	0.0112	41.6	2198.0964	2193.3987	4089.5	272	3.243	30.2	1	K.YLQDTYQCEYEVIHSLM.-
YDR479C	3	3	11.0%	554	63543	6.2	U	PEX29 SGDID:S000002887, Chr IV from 1416864-1415200, reverse complement, Verified ORF, "Peroxisomal integral membrane protein, involved in regulation of peroxisome size and number; genetic interactions suggest that Pex28p and Pex29p act at steps upstream of those mediated by Pex30p, Pex31p, and Pex32p" 
*	Jamie_Alpha_SPB_56.20024.20024.3	2.3316	0.2134	16.6	3161.8145	3164.4612	9050.4	9	4.341	22.0	1	W.RPVGFSDDDYSLFSSLRIYQRRIEEN.S
*	Jamie_Alpha_SPB_84.30211.30211.2	1.5011	0.1654	30.0	2513.0322	2515.6306	8686.4	1	4.004	27.1	1	R.QGVHGVTKGSMSGGLTHSSDDDRAD.E
*	Jamie_Alpha_SPB_68.24198.24198.2	1.736	0.0914	21.0	1260.8922	1260.3	4696.5	194	3.449	45.5	1	R.ADEESINGTIPN.L
Reverse_YMR268C	2	2	11.0%	444	50849	9.3	U	PRP24 SGDID:S000004881, Chr XIII from 804221-802887, reverse complement, Verified ORF, "Splicing factor that reanneals U4 and U6 snRNPs during spliceosome recycling" 
*	Jamie_Alpha_SPB_121.43378.43378.4	1.0423	0.0308	22.6	4233.6167	4229.131	3216.3	155	3.145	5.9	1	R.IVKGQFQSGNLIMLMKAAFKSDRFIIIAGNFDSVLLIK.R
*	Jamie_Alpha_SPB_25.08755.08755.2	1.5348	0.1991	36.4	1253.5922	1251.5089	4535.0	10	4.173	50.0	1	S.VKTVLTYGEIK.L
YDL182W	2	2	11.0%	428	47099	7.3	U	LYS20 SGDID:S000002341, Chr IV from 133438-134724, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys21p" 
*	Jamie_Alpha_SPB_9.03120.03120.3	1.0514	0.0691	23.9	2912.9343	2909.2278	4192.5	235	3.005	8.0	1	K.PNPYAAKPGDYLSNVNNFQLIDSTLR.E
*	Jamie_Alpha_SPB_33.11896.11896.2	1.8854	0.1999	61.2	2357.0522	2356.6438	6487.8	7	4.209	35.0	1	K.NFHAEVSTPQVLSAKKNKKND.S
YLR117C	4	4	10.9%	687	82445	5.6	U	CLF1 SGDID:S000004107, Chr XII from 384535-382472, reverse complement, Verified ORF, "Essential splicesome assembly factor; contains multiple tetratricopeptide repeat (TPR) protein-binding motifs and interacts specifically with many spliceosome components, may serve as a scaffold during splicesome assembly" 
*	Jamie_Alpha_SPB_69.24812.24812.4	2.5639	0.0939	65.9	3820.7366	3817.2534	8948.9	198	3.506	18.9	1	K.ARGSTNIDILDLEELREYQRRKRTEYEGYLK.R
*	Jamie_Alpha_SPB_16.05568.05568.2	2.7575	0.069	11.5	1908.1721	1907.2627	3334.2	10	3.49	50.0	1	I.FERALLVDSSFIPLWI.R
*	Jamie_Alpha_SPB_22.07950.07950.2	1.5751	0.1169	25.4	1029.3322	1028.1997	3701.6	1	3.525	68.8	1	M.NRAISTLPR.V
*	Jamie_Alpha_SPB_27.09567.09567.2	1.6539	0.084	10.5	2252.392	2250.5186	7147.7	183	3.229	27.8	1	S.LEPGVNAWNSFVDFEIRQK.N
YDL229W	3	3	10.9%	613	66602	5.4	U	SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" 
YNL209W	3	3	10.9%	613	66595	5.5	U	SSB2 SGDID:S000005153, Chr XIV from 252060-253901, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; homolog of SSB1" 
	Jamie_Alpha_SPB_15.05212.05212.2	3.3107	0.3346	100.0	1552.3722	1552.7739	5921.6	1	6.753	64.3	1	R.LIGDAAKNQAALNPR.N
	Jamie_Alpha_SPB_57.20500.20500.2	2.0072	0.2381	99.5	2964.7322	2965.1511	7271.5	2	5.521	25.0	1	R.TLSSVTQTTVEVDSLFDGEDFESSLTR.A
	Jamie_Alpha_SPB_46.16310.16310.2	1.9562	0.0028	74.7	2816.4722	2816.1091	8195.1	1	3.176	31.2	1	R.LSSEEIEKMVNQAEEFKAADEAFAK.K
Reverse_contaminant_A46507	3	3	10.9%	585	61487	4.7	U	owl|A46507| immunoglobulin alpha heavy chain - chicken 
*	Jamie_Alpha_SPB_71.25542.25542.2	1.7684	0.1522	14.0	2364.872	2362.6938	8271.4	1	4.361	31.0	1	N.VHSAKGANKDISKHIFNLPIGD.H
*	Jamie_Alpha_SPB_99.35614.35614.2	1.5947	0.023	71.2	1408.3121	1408.4215	4746.5	219	3.322	42.3	1	R.DETQSVDLGGGSSR.S
*	Jamie_Alpha_SPB_67.24000.24000.4	3.6651	0.173	11.2	3081.2566	3085.4504	5546.8	19	4.35	22.2	1	W.QIAAGASPLGEVLCVLLVRREFDEQTPD.S
Reverse_YOR334W	2	2	10.9%	470	54203	9.4	U	MRS2 SGDID:S000005861, Chr XV from 944591-946003, Verified ORF, "Mitochondrial inner membrane Mg(2+) channel, required for maintenance of intramitochondrial Mg(2+) concentrations at the correct level to support splicing of group II introns" 
*	Jamie_Alpha_SPB_39.14011.14011.3	2.2903	0.0243	35.5	3768.3245	3771.3044	6491.4	34	2.993	17.2	1	R.LSNFNKKTIYLASVISFVAVSTFGWESEEIFNK.L
*	Jamie_Alpha_SPB_71.25611.25611.2	1.4961	0.0286	68.7	1984.3922	1984.1765	10405.0	71	2.971	29.4	1	K.RLITSNTNAATSTDAYKR.L
Reverse_YOR184W	2	2	10.9%	395	43416	6.5	U	SER1 SGDID:S000005710, Chr XV from 679357-680544, Verified ORF, "3-phosphoserine aminotransferase, catalyzes the formation of phosphoserine from 3-phosphohydroxypyruvate, required for serine and glycine biosynthesis; regulated by the general control of amino acid biosynthesis mediated by Gcn4p" 
*	Jamie_Alpha_SPB_49.17602.17602.2	1.4795	0.1271	19.2	3034.3523	3035.4788	5344.3	40	3.55	20.4	1	I.FDVLNQVAKVSLANYISARFGGVSRHGK.L
*	Jamie_Alpha_SPB_69.24600.24600.2	1.9233	0.0682	19.4	1621.4521	1618.8271	6160.8	37	3.508	39.3	1	I.EGIGLGIDNFNILDK.A
YOR324C	2	2	10.8%	602	67293	9.4	U	FRT1 SGDID:S000005851, Chr XV from 925035-923227, reverse complement, Verified ORF, "Tail-anchored endoplasmic reticulum membrane protein that is a substrate of the phosphatase calcineurin, interacts with homolog Frt2p, promotes cell growth in conditions of high Na+, alkaline pH, and cell wall stress" 
*	Jamie_Alpha_SPB_74.26692.26692.2	1.407	0.2235	33.3	2993.1921	2991.198	11072.6	125	4.251	17.9	1	R.NSSGSSTAPGTDTLGFKYLLNRQKSADSS.T
*	Jamie_Alpha_SPB_39.13994.13994.3	2.9276	0.2067	11.9	3813.8643	3812.9536	3649.4	302	3.964	16.4	1	V.LKVNNNNGSAATPDSSSNSISKSNSNLNDNIDELNY.Y
YOL132W	2	2	10.8%	471	53813	4.9	U	GAS4 SGDID:S000005492, Chr XV from 71299-72714, Verified ORF, "Putative 1,3-beta-glucanosyltransferase, has similarity to Gas1p; localizes to the cell wall" 
*	Jamie_Alpha_SPB_36.12754.12754.3	2.8344	0.188	14.4	3122.8442	3123.6218	7057.4	67	4.372	22.1	1	H.TIQIKDKHFVDTVTGKPFFIKGVDYQP.G
*	Jamie_Alpha_SPB_48.17131.17131.2	1.5146	0.1921	12.8	2807.4521	2806.119	6347.2	7	4.246	26.1	1	Q.QTMQTSGYDTLVDAYRSYSKPVFF.S
Reverse_YCR063W	2	2	10.8%	157	18447	9.4	U	BUD31 SGDID:S000000659, Chr III from 228313-228786, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern" 
*	Jamie_Alpha_SPB_98.35130.35130.2	1.5552	0.0598	79.4	1346.4122	1345.5413	4861.6	16	3.176	50.0	1	K.IKEFGDPAPKSR.R
*	Jamie_Alpha_SPB_33.11803.11803.2	1.6994	0.0734	10.9	1424.2722	1425.6772	6897.6	25	3.333	45.5	1	G.DPAPKSRRTKIR.P
Reverse_YAL005C	2	2	10.7%	642	69767	5.1	U	SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" 
	Jamie_Alpha_SPB_59.21270.21270.2	1.476	0.1019	11.2	2497.8123	2496.78	7087.4	22	3.332	27.3	1	D.IGEFLSDIEVSTQASSSLTRKAR.E
*	Jamie_Alpha_SPB_63.22483.22483.4	2.8802	0.168	10.8	5290.0166	5293.948	9844.8	95	4.075	12.6	1	L.DKKNKRKFEQIFHNVLRNDFDEGGLHTDGATAKVEFIGDEIFLLSV.D
YDR353W	2	2	10.7%	319	34238	5.9	U	TRR1 SGDID:S000002761, Chr IV from 1183290-1184249, Verified ORF, "Cytoplasmic thioredoxin reductase, key regulatory enzyme that determines the redox state of the thioredoxin system, which acts as a disulfide reductase system and protects cells against both oxidative and reductive stress" 
*	Jamie_Alpha_SPB_28.09877.09877.2	1.9171	0.1168	11.1	2222.0322	2222.608	3912.8	146	3.758	29.4	1	T.IMQKRAEKNEKIEILYNT.V
*	Jamie_Alpha_SPB_62.22106.22106.3	2.2258	0.0665	47.2	2889.5044	2887.3494	7831.1	185	3.233	21.0	1	K.NEKIEILYNTVALEAKGDGKLLNALR.I
YFL028C	2	2	10.7%	289	33090	6.7	U	CAF16 SGDID:S000001866, Chr VI from 80211-79342, reverse complement, Verified ORF, "Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation; putative ABC ATPase; interacts with Ssn2p, Ssn3p, and Ssn8p" 
*	Jamie_Alpha_SPB_26.09132.09132.3	1.4286	0.0046	24.0	1260.6543	1264.386	2977.8	275	3.11	30.6	1	K.SIGFDHFRER.G
*	Jamie_Alpha_SPB_74.26577.26577.3	2.2401	0.0653	50.4	2561.2444	2564.9214	6412.8	77	2.789	26.2	1	K.WPNQVYHMKSGKIVDNLDYQK.D
YPL180W	4	4	10.6%	799	88845	8.1	U	TCO89 SGDID:S000006101, Chr XVI from 205247-207646, Verified ORF, "Subunit of TORC1 (Tor1p or Tor2p-Kog1p-Lst8p-Tco89p), a complex that regulates growth in response to nutrient availability; cooperates with Ssd1p in the maintenance of cellular integrity; deletion strains are hypersensitive to rapamycin" 
*	Jamie_Alpha_SPB_50.17767.17767.4	2.6417	0.0777	59.3	2830.5764	2834.1184	4948.7	12	3.251	24.7	1	R.GRTLKSDTDVTSLNASTVSHQSKPFR.Q
*	Jamie_Alpha_SPB_72.25678.25678.4	3.1507	0.2013	10.7	2420.7766	2424.4558	4096.4	146	4.05	29.4	1	N.NYFGESSHSIEHQKDGETSPSS.I
*	Jamie_Alpha_SPB_67.24121.24121.2	1.5994	0.158	10.5	2454.5122	2454.6934	9395.6	3	4.077	29.5	1	E.EDLIKPDDISSAGTKDIEGHSLL.E
*	Jamie_Alpha_SPB_100.35959.35959.2	1.7526	0.1505	13.0	1508.6721	1507.6462	5703.0	240	3.525	38.5	1	T.IANIGSKDNNVPQH.N
Reverse_YLR335W	3	3	10.6%	720	77881	7.2	U	NUP2 SGDID:S000004327, Chr XII from 797430-799592, Verified ORF, "Protein involved in nucleocytoplasmic transport, binds to either the nucleoplasmic or cytoplasmic faces of the nuclear pore complex depending on Ran-GTP levels; also has a role in chromatin organization" 
*	Jamie_Alpha_SPB_103.36907.36907.4	3.3543	0.1539	10.8	2988.6165	2987.4692	5243.3	196	3.62	22.0	1	K.ADEIAKTFSRGEEKQKFKVIYTVLKG.D
*	Jamie_Alpha_SPB_84.30279.30279.2	1.8473	0.1883	47.8	1699.9521	1702.7747	5885.7	353	3.811	33.3	1	K.TGFTFSAEAKSNNDVN.T
*	Jamie_Alpha_SPB_32.11570.11570.4	3.3952	0.1537	15.4	3662.6565	3665.9873	7269.7	40	3.372	17.2	1	P.KADITFKPGEVKVEDESSSDSSKQVDEVKAPKAD.N
YER165W	3	4	10.6%	577	64344	6.0	U	PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" 
*	Jamie_Alpha_SPB_12.04086.04086.1	1.0415	0.0264	80.0	836.64	835.97864	2458.7	12	2.96	50.0	1	K.GSGNIFIK.N
*	Jamie_Alpha_SPB_39.14095.14095.2	3.803	0.5067	100.0	2787.4922	2787.9478	8269.9	1	8.202	33.3	2	K.NLDDSVDDEKLEEEFAPYGTITSAK.V
*	Jamie_Alpha_SPB_20.07244.07244.3	2.2974	0.0232	35.5	3314.5444	3313.6572	7172.2	96	2.746	20.4	1	R.NANDNNQFYQQKQRQALGEQLYKKVSAK.T
YCR098C	3	3	10.6%	518	57322	8.5	U	GIT1 SGDID:S000000695, Chr III from 298601-297045, reverse complement, Verified ORF, "Plasma membrane permease, mediates uptake of glycerophosphoinositol and glycerophosphocholine as sources of the nutrients inositol and phosphate; expression and transport rate are regulated by phosphate and inositol availability" 
*	Jamie_Alpha_SPB_52.18762.18762.2	1.794	0.1501	12.8	1546.4521	1546.8099	5309.7	79	3.495	42.9	1	S.TRVSNAALVGIIFGQ.F
*	Jamie_Alpha_SPB_99.35394.35394.3	2.7982	0.1812	16.6	2187.7744	2188.4602	4346.9	45	4.51	31.0	1	P.GDMLGVISSEASATAVRGVFYG.L
*	Jamie_Alpha_SPB_88.31602.31602.2	1.7316	0.086	14.0	2126.2922	2123.3323	8377.1	7	4.235	35.3	1	M.KQDVEFHNYLVSNGWTGK.M
YFR016C	4	4	10.5%	1233	137698	4.5	U	YFR016C SGDID:S000001912, Chr VI from 180735-177034, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_97.34744.34744.4	1.7369	0.0769	42.3	5163.4966	5167.528	12485.3	320	2.944	12.7	1	K.HQLEPHGLEAGDENGQASTKDVESESLTKNGFNFKENESKHLKAGEK.Q
*	Jamie_Alpha_SPB_35.12390.12390.2	2.0786	0.0566	20.2	1601.9521	1602.7565	8087.1	1	3.817	46.4	1	T.TQKDMGDVGSTTSFK.E
*	Jamie_Alpha_SPB_82.29456.29456.2	1.91	0.05	11.2	1492.2322	1494.6445	5899.7	140	3.367	45.8	1	K.RFEITQEGDKITG.K
*	Jamie_Alpha_SPB_66.23709.23709.4	3.0436	0.1046	78.3	6236.5767	6233.7305	8125.2	331	3.965	11.0	1	K.IAEALKDVTGDQEIDDINISDEFQRTVELPELEKQDIKDNKGEDKELEVEETEK.E
YFL055W	3	3	10.4%	558	61052	7.5	U	AGP3 SGDID:S000001839, Chr VI from 17004-18680, Uncharacterized ORF, "Low-affinity amino acid permease, may act to supply the cell with amino acids as nitrogen source in nitrogen-poor conditions; transcription is induced under conditions of sulfur limitation" 
*	Jamie_Alpha_SPB_18.06398.06398.2	1.9588	0.1328	12.4	2044.4521	2045.3118	7673.6	3	3.612	39.5	1	M.ESIGEMITLYPSGGGFTTLA.R
*	Jamie_Alpha_SPB_40.14110.14110.2	1.7039	0.0681	10.7	2616.172	2617.9622	7031.9	6	3.345	28.0	1	F.YSGTESVALAATESKNPGKAVPLAVR.Q
*	Jamie_Alpha_SPB_78.28070.28070.2	1.6912	0.1354	11.6	1411.9321	1414.6971	4953.0	132	3.613	50.0	1	A.HLVNAFILITCI.S
YPR119W	2	2	10.4%	491	56247	6.7	U	CLB2 SGDID:S000006323, Chr XVI from 771651-773126, Verified ORF, "B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome" 
*	Jamie_Alpha_SPB_115.41254.41254.3	2.2374	0.0126	30.2	3463.0144	3466.876	5426.8	244	2.674	16.1	1	R.LALNNVTNTTFQKSNANNPALTNFKSTLNSVK.K
*	Jamie_Alpha_SPB_66.23558.23558.2	1.636	0.1008	15.3	2115.1921	2117.1506	7472.7	199	3.673	25.0	1	H.FASETDGACTEDEIKEGEK.F
Reverse_YLR163C	2	2	10.4%	462	51084	7.0	U	MAS1 SGDID:S000004153, Chr XII from 493256-491868, reverse complement, Verified ORF, "Smaller subunit of the mitochondrial processing protease, essential processing enzyme that cleaves the N-terminal targeting sequences from mitochondrially imported proteins" 
*	Jamie_Alpha_SPB_25.08955.08955.4	3.2066	0.1597	15.4	4037.4565	4043.4138	8873.7	17	3.607	16.7	1	S.TSFSMYSNALSGNQSAAVALPSPSNTGTGIARDWNGVIAQ.T
*	Jamie_Alpha_SPB_13.04410.04410.2	1.5483	0.066	11.5	896.9522	898.1368	3480.4	99	3.025	71.4	1	N.KIPGLITR.G
YDL014W	2	2	10.4%	327	34465	10.2	U	NOP1 SGDID:S000002172, Chr IV from 427361-428344, Verified ORF, "Nucleolar protein, component of the small subunit processome complex, which is required for processing of pre-18S rRNA; has similarity to mammalian fibrillarin" 
*	Jamie_Alpha_SPB_18.06462.06462.2	2.452	0.1856	99.5	2260.912	2260.5059	7081.4	3	3.874	36.8	1	R.ISVEEPSKEDGVPPTKVEYR.V
*	Jamie_Alpha_SPB_30.10669.10669.2	3.8203	0.3581	100.0	1729.9722	1730.0142	7784.4	1	6.429	73.1	1	R.IKPLEQLTLEPYER.D
Reverse_YMR275C	3	3	10.3%	976	109174	8.7	U	BUL1 SGDID:S000004888, Chr XIII from 818580-815650, reverse complement, Verified ORF, "Ubiquitin-binding component of the Rsp5p E3-ubiquitin ligase complex, functional homolog of Bul2p, disruption causes temperature-sensitive growth, overexpression causes missorting of amino acid permeases" 
*	Jamie_Alpha_SPB_117.41959.41959.4	1.9206	0.2623	27.1	6431.4165	6433.9824	6656.9	33	4.616	6.7	1	K.HVIQDTFKLSTSSSGSPLFLSSKSSSTVPTLSASSPSSSSGNGTHSISDESLAHKSHQKLTSV.Q
*	Jamie_Alpha_SPB_73.26246.26246.2	1.874	0.1665	37.7	2007.2922	2006.507	6671.6	226	4.139	33.3	1	L.DVMRLFRKITRKSKVK.D
*	Jamie_Alpha_SPB_33.11623.11623.2	2.207	0.1019	13.5	2277.672	2277.3665	7182.1	6	3.996	28.6	1	L.NELNSTSSSRTAGLADTSLSQH.S
YLR324W	2	2	10.3%	523	59462	5.8	U	PEX30 SGDID:S000004316, Chr XII from 779215-780786, Verified ORF, "Peroxisomal integral membrane protein, involved in negative regulation of peroxisome number; partially functionally redundant with Pex31p; genetic interactions suggest action at a step downstream of steps mediated by Pex28p and Pex29p" 
*	Jamie_Alpha_SPB_89.31761.31761.3	2.0454	0.0652	46.3	2014.8243	2017.2468	4730.5	453	3.276	29.2	1	K.KLASTENSNGVLSDSKPIR.F
*	Jamie_Alpha_SPB_40.14222.14222.3	2.6155	0.1768	91.8	3914.9944	3917.1396	6393.1	239	4.223	16.2	1	K.VGEPTTEETKEFAEASNINEGEFERISSTDEEVLK.S
Reverse_YMR093W	3	3	10.3%	513	57686	9.3	U	UTP15 SGDID:S000004699, Chr XIII from 454014-455555, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_86.30870.30870.2	1.493	0.1343	89.0	2427.1921	2426.7002	8535.5	6	3.725	29.5	1	R.NGQATSPSVACSLVPGSFKWGFK.V
*	Jamie_Alpha_SPB_21.07429.07429.2	1.5858	6.0E-4	67.0	2163.3323	2161.3794	5656.7	4	2.581	33.3	1	R.TVRDDSATALIKNDQTHFK.T
*	Jamie_Alpha_SPB_73.26113.26113.2	1.543	0.084	11.2	1214.6522	1213.3329	4445.4	210	3.387	45.0	1	R.SSFIQVRTSST.V
YBR078W	2	2	10.3%	468	48237	5.1	U	ECM33 SGDID:S000000282, Chr II from 393118-393175,393506-394854, Verified ORF, "GPI-anchored protein of unknown function, has a possible role in apical bud growth; GPI-anchoring on the plasma membrane crucial to function; similar to Sps2p and Pst1p" 
*	Jamie_Alpha_SPB_76.27282.27282.4	2.9306	0.19	15.2	2888.4565	2883.1792	5291.6	176	3.684	21.4	1	L.TITGDLGSAALASIQEIDGSLTIFNSSSL.S
*	Jamie_Alpha_SPB_12.04332.04332.4	2.3636	0.0015	30.6	1872.2965	1872.9811	5002.8	47	3.005	30.6	1	K.NGATSTSVKLSSTSTESSK.S
YGL023C	2	2	10.2%	635	70617	7.8	U	PIB2 SGDID:S000002991, Chr VII from 452109-450202, reverse complement, Verified ORF, "Protein binding phosphatidylinositol 3-phosphate, involved in telomere-proximal repression of gene expression; similar to Fab1 and Vps27" 
*	Jamie_Alpha_SPB_70.24940.24940.2	1.5986	0.0268	72.4	2738.7722	2738.181	10187.8	471	3.509	21.7	1	R.QKNLTTQALRKLSSFKMNASSNLR.L
*	Jamie_Alpha_SPB_39.13906.13906.4	2.0715	0.2212	14.4	5965.2563	5963.5747	8820.1	254	4.463	9.1	1	L.RKLSSFKMNASSNLRLSKENKAKESSSSSTSSVSSSSTSKVENIVDKLTTTNSSSM.S
YOR310C	3	3	10.2%	511	56956	8.9	U	NOP58 SGDID:S000005837, Chr XV from 898355-896820, reverse complement, Verified ORF, "Protein involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_70.25257.25257.2	1.7662	0.0718	11.6	1471.9922	1469.6317	5805.5	12	3.318	50.0	1	K.IYKSSSLIQDLDS.S
*	Jamie_Alpha_SPB_34.12008.12008.2	3.381	0.4406	100.0	2174.412	2176.339	8641.7	1	7.27	44.4	1	R.SKASETDLSEILPEEIEER.V
*	Jamie_Alpha_SPB_22.07802.07802.3	3.622	0.2205	68.8	2255.5144	2254.3318	6428.3	1	5.612	40.8	1	L.RYDALAEDRDDSGDIGLESR.A
Reverse_YDR181C	2	2	10.2%	481	55410	9.5	U	SAS4 SGDID:S000002589, Chr IV from 827350-825905, reverse complement, Verified ORF, "Subunit of the SAS complex (Sas2p, Sas4p, Sas5p), which acetylates free histones and nucleosomes and regulates transcriptional silencing; required for the HAT activity of Sas2p" 
*	Jamie_Alpha_SPB_32.11330.11330.4	3.0941	0.1681	15.2	3488.4966	3486.963	6001.1	11	3.532	19.5	1	T.ETVSIEEAKVNLKMSKQTDQRIDRIVEPEV.E
*	Jamie_Alpha_SPB_6.01944.01944.3	1.8559	0.0622	42.0	2202.9243	2204.725	5813.9	233	3.524	20.8	1	K.ILYPKRLPEAVIAFRTMGK.Q
Reverse_YDR429C	2	2	10.2%	274	30501	6.8	U	TIF35 SGDID:S000002837, Chr IV from 1325291-1324467, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), which is essential for translation" 
*	Jamie_Alpha_SPB_98.34989.34989.2	2.011	0.0279	10.1	1691.8121	1693.7762	5808.1	36	3.383	42.9	1	S.DRYADSSPDRAGARR.S
*	Jamie_Alpha_SPB_13.04734.04734.2	1.7405	0.1227	27.3	1522.8121	1522.785	4296.9	1	3.434	58.3	1	Y.KVGDEIKYTIISR.S
YLR436C	5	5	10.1%	1274	145052	7.6	U	ECM30 SGDID:S000004428, Chr XII from 1011241-1007417, reverse complement, Verified ORF, "Non-essential protein of unknown function" 
*	Jamie_Alpha_SPB_73.26331.26331.4	3.2041	0.1601	15.9	2494.0566	2489.828	4295.4	1	3.925	27.3	1	N.LSIFKLDSGPDVEALFSDKPNVP.L
*	Jamie_Alpha_SPB_80.28699.28699.4	3.0016	0.1923	13.2	2748.7366	2749.223	5107.5	84	3.567	28.0	1	K.AQDNVITIFLTQLQREYDLKLIL.S
*	Jamie_Alpha_SPB_51.18126.18126.4	2.356	0.068	50.8	3751.2566	3752.2273	8335.2	16	3.385	17.8	1	K.IFKYPIDLAIEQESNIFNFTNNKHIDASRRR.A
*	Jamie_Alpha_SPB_104.37429.37429.3	2.7001	0.2193	10.8	3041.1843	3038.3416	8562.2	20	4.831	20.5	1	I.LTSSHKNDDSHDDLILLSAKKKSASPSAA.T
*	Jamie_Alpha_SPB_95.34093.34093.2	1.7052	0.2044	10.3	2529.152	2526.8242	9008.0	21	4.704	27.3	1	Q.SITHQINDSINSISKALDMNPNL.N
YLR341W	2	2	10.1%	477	55138	5.0	U	SPO77 SGDID:S000004333, Chr XII from 807385-808818, Verified ORF, "Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensable for both nuclear divisions during meiosis" 
*	Jamie_Alpha_SPB_69.24688.24688.2	1.3208	0.1348	10.6	2877.9321	2880.1895	9092.8	358	3.622	18.0	1	K.KKSSIGFFPLDDSLFTSKNNSGHHKS.E
*	Jamie_Alpha_SPB_56.19908.19908.4	2.7423	0.0113	41.8	2414.0166	2418.669	3785.8	5	3.068	28.6	1	R.GNAETIRSQFGTDAVPIRIDEK.E
Reverse_YMR114C	2	2	10.1%	368	42901	7.7	U	YMR114C SGDID:S000004720, Chr XIII from 497448-496342, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_50.17847.17847.3	2.3187	0.0159	37.1	2153.4844	2157.4587	5195.5	101	2.773	30.9	1	K.QNGLMNVINRKERNGERK.P
*	Jamie_Alpha_SPB_36.12865.12865.2	2.1192	0.1217	15.0	2301.5923	2300.7734	10065.8	68	3.627	27.8	1	V.FMLRGDRRSIFYPTKKKGV.T
YMR056C	2	2	10.0%	309	34121	9.7	U	AAC1 SGDID:S000004660, Chr XIII from 388243-387314, reverse complement, Verified ORF, "Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator" 
*	Jamie_Alpha_SPB_78.27962.27962.2	1.7781	0.0993	23.3	1676.4122	1674.8558	5794.5	96	3.266	34.6	1	R.ERDGYAKWFAGNLF.S
*	Jamie_Alpha_SPB_27.09590.09590.2	2.3703	0.0677	31.5	2013.2122	2013.3042	8644.4	77	3.378	34.4	1	S.KSTSQRQFNGLLDVYKK.T
Reverse_YCL063W	2	2	9.9%	423	47843	8.5	U	VAC17 SGDID:S000000568, Chr III from 17290-18561, Verified ORF, "Protein involved in vacuole inheritance; acts as a vacuole-specific receptor for myosin Myo2p" 
*	Jamie_Alpha_SPB_92.33007.33007.3	1.59	0.0011	23.6	3687.7744	3692.1855	11215.9	21	2.812	18.8	1	K.KSKNLGTDHSKAARLTRNRAPQKKPSCPLSNTK.S
*	Jamie_Alpha_SPB_20.07081.07081.2	1.6953	0.0473	11.0	1056.7322	1058.2229	4778.5	18	2.987	62.5	1	D.LQLIAEQSR.I
YER028C	2	2	9.9%	394	43119	9.9	U	MIG3 SGDID:S000000830, Chr V from 211875-210691, reverse complement, Verified ORF, "Probable transcriptional repressor involved in response to toxic agents such as hydroxyurea that inhibit ribonucleotide reductase; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genes" 
*	Jamie_Alpha_SPB_92.33122.33122.2	1.5083	0.1986	15.2	2144.9922	2147.4795	8504.0	113	4.025	25.0	1	T.GNNNGIVETQAPAILVPVINI.P
*	Jamie_Alpha_SPB_65.23347.23347.2	1.5582	0.1054	11.8	2130.6921	2132.3591	5905.9	3	3.77	38.2	1	K.ACRSNHKYKVNAVSRGRQ.H
contaminant_KERATIN22	4	4	9.8%	645	65865	8.0	U	no description
*	Jamie_Alpha_SPB_15.05124.05124.1	1.3164	0.0536	90.0	831.53	831.9878	4153.7	215	4.393	43.8	1	R.SLVGLGGTK.S
*	Jamie_Alpha_SPB_63.22464.22464.3	2.9268	0.1669	12.2	2306.6042	2304.4026	5130.3	3	4.039	23.3	1	S.VAGGGGGFGAAGGFGGRGGGFGGGSGFGGG.S
	Jamie_Alpha_SPB_18.06228.06228.2	2.771	0.1894	100.0	1476.0922	1476.6726	7594.0	2	4.958	72.7	1	R.FLEQQNQVLQTK.W
*	Jamie_Alpha_SPB_15.05330.05330.3	4.0457	0.2712	100.0	1392.6244	1392.5083	3202.6	1	5.751	52.3	1	R.SKEEAEALYHSK.Y
YMR120C	2	2	9.8%	592	65263	6.6	U	ADE17 SGDID:S000004727, Chr XIII from 509279-507501, reverse complement, Verified ORF, "Enzyme of 'de novo' purine biosynthesis containing both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities, isozyme of Ade16p; ade16 ade17 mutants require adenine and histidine" 
*	Jamie_Alpha_SPB_82.29343.29343.3	2.5095	0.2072	15.2	2222.6643	2219.5425	5368.4	184	3.904	26.2	1	V.SPAGAAVGIPLSDVEKQVYFVA.D
*	Jamie_Alpha_SPB_49.17556.17556.4	2.1057	0.1341	70.4	4219.4165	4217.7705	9099.6	13	3.676	17.6	1	K.PFTPEERKEWLSKLTNVSLSSDAFFPFPDNVYRAVK.S
Reverse_YDL224C	3	3	9.7%	649	70690	7.0	U	WHI4 SGDID:S000002383, Chr IV from 56347-54398, reverse complement, Verified ORF, "Putative RNA binding protein and partially redundant Whi3p homolog that regulates the cell size requirement for passage through Start and commitment to cell division" 
*	Jamie_Alpha_SPB_9.03062.03062.3	1.0299	0.1405	37.9	4364.1846	4363.9204	2682.9	12	3.536	5.8	1	K.RQSITELGFPDNFSFRLSRESLLSPRPKAASPGLPSSSTK.G
*	Jamie_Alpha_SPB_21.07440.07440.2	2.1501	0.0377	18.6	1732.9922	1733.8351	7212.9	348	3.349	38.5	1	V.VVKENDNFPERDDR.K
*	Jamie_Alpha_SPB_12.04359.04359.2	1.7247	0.0475	84.3	1049.0721	1049.1289	5471.7	1	3.278	81.2	1	R.KINTESNSR.V
Reverse_YNR011C	3	3	9.6%	876	99813	8.4	U	PRP2 SGDID:S000005294, Chr XIV from 646952-644322, reverse complement, Verified ORF, "RNA-dependent ATPase in the DEAH-box family, required for activation of the spliceosome before the first transesterification step in RNA splicing" 
*	Jamie_Alpha_SPB_75.26790.26790.2	1.687	0.1587	10.9	2342.372	2342.6208	9650.4	56	3.83	27.5	1	T.LSTEAINTALVVKRCNEPTPQ.F
*	Jamie_Alpha_SPB_26.09159.09159.2	1.679	0.1107	89.6	2183.8123	2186.5376	8098.3	1	3.45	35.0	1	K.GLVVNMEDAVRAAVSTAAVRR.P
*	Jamie_Alpha_SPB_121.43280.43280.4	1.3635	0.074	28.1	4662.1367	4657.1025	3850.3	161	3.197	6.9	1	K.TENESDGLLGKKTTLENNSTIKEDYKSSKKQSGLQEGKLNNK.E
Reverse_YJL156C	3	3	9.6%	687	76178	6.5	U	SSY5 SGDID:S000003692, Chr X from 128870-126807, reverse complement, Verified ORF, "Component of the SPS plasma membrane amino acid sensor system (Ssy1p-Ptr3p-Ssy5p), which senses external amino acid concentration and transmits intracellular signals that result in regulation of expression of amino acid permease genes" 
*	Jamie_Alpha_SPB_99.35503.35503.4	2.7423	0.1562	10.4	4412.3364	4417.2705	9202.8	37	3.699	16.7	1	V.DPFLSYLVKIMEYHEHQLNPLGFMITLISSKPTIGRLI.P
*	Jamie_Alpha_SPB_62.22105.22105.3	1.6042	0.0246	24.4	3125.9944	3127.69	7670.0	1	2.996	23.1	1	K.IMEYHEHQLNPLGFMITLISSKPTIGR.L
*	Jamie_Alpha_SPB_79.28204.28204.4	2.8705	0.1483	10.2	2980.2166	2978.1333	5934.5	69	3.617	21.6	1	T.MRGRSFISSSQISSGFTTSADDNNANEP.N
YLL061W	2	2	9.6%	583	64218	7.9	U	MMP1 SGDID:S000003984, Chr XII from 17956-19707, Verified ORF, "High-affinity S-methylmethionine permease, required for utilization of S-methylmethionine as a sulfur source; has similarity to S-adenosylmethionine permease Sam3p" 
*	Jamie_Alpha_SPB_62.22033.22033.3	2.49	0.2385	11.5	4181.6943	4186.145	8527.3	1	4.566	18.1	1	L.SMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVL.I
*	Jamie_Alpha_SPB_117.42044.42044.2	1.5009	0.1703	10.8	1989.9521	1989.2048	9114.5	30	3.917	30.6	1	Y.SFSGTEMVVLTSTEARSVS.S
YKR023W	2	2	9.6%	530	60799	6.9	U	YKR023W SGDID:S000001731, Chr XI from 483062-484654, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and mitochondrion" 
*	Jamie_Alpha_SPB_102.36592.36592.4	2.4581	0.0377	43.7	3835.5366	3839.2163	7930.6	3	3.633	21.9	1	K.TKNVHLEHTAPTSWKNESKQPTNNYINKKGDEK.P
*	Jamie_Alpha_SPB_23.07996.07996.2	1.667	0.0808	10.1	2132.7322	2133.2388	6147.3	454	3.219	29.4	1	K.ERQASEHDHKAEENPELL.A
YPL255W	2	2	9.6%	385	45384	6.5	U	BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" 
*	Jamie_Alpha_SPB_33.11835.11835.2	2.3936	0.243	100.0	2395.0522	2394.5415	5412.0	2	4.616	38.9	1	Q.MDLNSRDLEDLCEDVREQR.E
*	Jamie_Alpha_SPB_17.05892.05892.2	2.3705	0.1775	99.5	1926.6522	1926.9945	5656.3	41	4.008	41.2	1	R.NNERKDTSAGSNIFSTGQ.-
YGR268C	2	2	9.6%	198	22435	9.2	U	HUA1 SGDID:S000003500, Chr VII from 1026659-1026063, reverse complement, Uncharacterized ORF, "Cytoplasmic protein containing a zinc finger domain with sequence similarity to that of Type I J-proteins; computational analysis of large-scale protein-protein interaction data suggests a possible role in actin patch assembly" 
*	Jamie_Alpha_SPB_46.16368.16368.2	1.38	0.1091	11.4	1193.4722	1192.1809	5032.3	3	3.695	55.6	1	K.DTHDDELPSY.E
*	Jamie_Alpha_SPB_30.10718.10718.2	2.4451	0.2827	100.0	2318.372	2320.385	7752.9	1	5.396	44.4	1	K.DTHDDELPSYEDVIKEEER.L
YEL061C	4	4	9.5%	1000	113311	8.1	U	CIN8 SGDID:S000000787, Chr V from 39537-36535, reverse complement, Verified ORF, "Kinesin motor protein involved in mitotic spindle assembly and chromosome segregation" 
*	Jamie_Alpha_SPB_63.22508.22508.4	2.0154	0.067	45.1	3824.0964	3822.403	5653.4	367	2.84	17.6	1	K.EAGSINQSLLTLGRVINALVDKSGHIPFRESKLTR.L
*	Jamie_Alpha_SPB_41.14464.14464.3	2.3104	0.2509	10.5	4556.8745	4557.1187	8861.3	22	4.611	14.3	1	E.SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA.K
*	Jamie_Alpha_SPB_84.30050.30050.4	2.7031	0.2051	15.2	5188.6567	5191.898	9985.7	5	4.493	13.5	1	T.RLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL.G
*	Jamie_Alpha_SPB_66.23469.23469.2	1.666	0.0678	83.4	1687.1921	1686.0067	5193.2	34	3.1	37.5	1	K.IDIIRVDFQKFYK.N
YMR268C	2	2	9.5%	444	50849	9.3	U	PRP24 SGDID:S000004881, Chr XIII from 804221-802887, reverse complement, Verified ORF, "Splicing factor that reanneals U4 and U6 snRNPs during spliceosome recycling" 
*	Jamie_Alpha_SPB_19.06579.06579.4	2.371	0.0061	33.1	2158.1365	2163.5222	4868.3	406	2.786	25.9	1	K.IEGYTLVTKVSNPLEKSKR.T
*	Jamie_Alpha_SPB_35.12618.12618.2	1.3744	0.0281	66.8	2583.9521	2584.1133	6763.5	6	3.02	27.3	1	R.DSKFAAKMLMILNGSQFQGKVIR.S
YPL028W	2	2	9.5%	398	41729	7.4	U	ERG10 SGDID:S000005949, Chr XVI from 498094-499290, Verified ORF, "Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA thiolase), cytosolic enzyme that transfers an acetyl group from one acetyl-CoA molecule to another, forming acetoacetyl-CoA; involved in the first step in mevalonate biosynthesis" 
*	Jamie_Alpha_SPB_38.13648.13648.3	2.7912	0.1932	16.5	2293.8542	2295.6902	7040.8	12	4.284	27.3	1	E.IIFGNVLSANLGQAPARQVALAA.G
*	Jamie_Alpha_SPB_104.37170.37170.2	1.8185	0.1289	10.6	1470.4521	1469.6836	5723.8	155	3.364	35.7	1	P.SKVNVYGGAVALGHP.L
Reverse_YPL188W	2	2	9.4%	414	46247	9.0	U	POS5 SGDID:S000006109, Chr XVI from 191405-192649, Verified ORF, "Mitochondrial NADH kinase, phosphorylates NADH; also phosphorylates NAD(+) with lower specificity; required for the response to oxidative stress" 
*	Jamie_Alpha_SPB_53.18848.18848.3	1.539	0.0057	23.8	3875.8145	3875.3887	9846.8	136	3.08	14.1	1	R.KTLRFSSNFGLLENIGRIWDNETKAVCYIGSRK.P
*	Jamie_Alpha_SPB_10.03550.03550.1	1.2434	0.0034	83.3	820.68	821.00977	5348.8	132	3.126	50.0	1	R.YWKVPK.N
Reverse_YKL047W	2	2	9.3%	516	58895	5.4	U	YKL047W SGDID:S000001530, Chr XI from 349107-350657, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" 
*	Jamie_Alpha_SPB_24.08662.08662.4	3.3466	0.1465	11.0	3422.1365	3418.7307	5453.7	45	3.447	20.4	1	E.LDLPTAKNQEGSATLIEVEKEPSEEITSSSTL.K
*	Jamie_Alpha_SPB_17.06009.06009.2	2.1195	0.1865	69.6	1821.2922	1821.1882	4740.4	5	4.138	43.3	1	N.QVDIIVGLSFMQVKSR.D
YLR197W	3	3	9.3%	504	56864	8.9	U	SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" 
*	Jamie_Alpha_SPB_59.21030.21030.2	1.5549	0.047	73.8	1871.5322	1871.1339	8366.8	114	3.006	33.3	1	K.GRISRYLANKCSMASR.I
*	Jamie_Alpha_SPB_30.10622.10622.2	2.1945	0.2998	100.0	1913.5122	1914.0789	9054.2	175	4.91	31.2	1	I.DNYSEEPSNVFGSVLKK.Q
*	Jamie_Alpha_SPB_38.13480.13480.2	3.9962	0.411	100.0	1666.6921	1666.8866	8195.9	1	6.933	73.1	1	K.NELAIQEAMELYNK.D
YNL071W	2	2	9.3%	482	51818	7.8	U	LAT1 SGDID:S000005015, Chr XIV from 491524-492972, Verified ORF, "Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex, which catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA" 
*	Jamie_Alpha_SPB_13.04724.04724.2	2.1084	0.0413	14.0	1595.8322	1594.8112	5403.6	4	3.554	53.6	1	L.EKGISLKDVHGTGPR.G
*	Jamie_Alpha_SPB_78.27966.27966.4	3.2789	0.1692	14.3	3341.0166	3337.6714	5795.6	47	3.889	19.9	1	G.PRGRITKADIESYLEKSSKQSSQTSGAAAATP.A
Reverse_YER111C	3	3	9.2%	1093	123806	8.8	U	SWI4 SGDID:S000000913, Chr V from 385872-382591, reverse complement, Verified ORF, "DNA binding component of the SBF complex (Swi4p-Swi6p), a transcriptional activator that in concert with MBF (Mbp1-Swi6p) regulates late G1-specific transcription of targets including cyclins and genes required for DNA synthesis and repair" 
*	Jamie_Alpha_SPB_93.33213.33213.4	2.303	0.2	10.8	5025.9766	5020.693	6037.8	183	4.288	12.9	1	V.ITALKLAQSKELSQIFNQKESNLKSSTEKIRSQLDSISNIPTKNS.V
*	Jamie_Alpha_SPB_86.30681.30681.2	1.8881	0.1622	36.7	2106.372	2105.3977	8559.5	19	4.058	32.4	1	K.KRRKKSNGNTISDMMSHN.F
*	Jamie_Alpha_SPB_61.21684.21684.4	2.851	0.0771	63.8	3902.1365	3902.3108	5951.9	404	3.387	14.9	1	K.GKKNAATTTASTSSSSNKKRPTKNYSSPSTIKTGPSTK.R
YLR153C	4	4	9.2%	683	75492	6.7	U	ACS2 SGDID:S000004143, Chr XII from 447576-445525, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform, required for growth on glucose; expressed under anaerobic conditions" 
*	Jamie_Alpha_SPB_24.08398.08398.2	4.0879	0.5753	100.0	2460.2522	2461.6038	8921.3	1	10.521	42.9	1	R.HAFANPDKPALIYEADDESDNK.I
*	Jamie_Alpha_SPB_23.08274.08274.2	2.3022	0.3028	100.0	1334.9722	1335.4178	6323.8	1	6.071	72.2	1	R.DYWWHEEAAK.Q
*	Jamie_Alpha_SPB_43.15184.15184.2	2.5443	0.2673	100.0	2341.9922	2342.6128	7427.9	3	5.352	31.6	1	R.VLGSVGEPISPDLWEWYHEK.V
	Jamie_Alpha_SPB_14.04741.04741.2	2.6746	0.2408	100.0	1196.7922	1197.2932	3541.9	4	5.093	75.0	1	R.VDDVVNVSGHR.L
Reverse_YOR067C	2	2	9.2%	577	67385	9.5	U	ALG8 SGDID:S000005593, Chr XV from 453463-451730, reverse complement, Verified ORF, "Glucosyl transferase, involved in N-linked glycosylation; adds glucose to the dolichol-linked oligosaccharide precursor prior to transfer to protein during lipid-linked oligosaccharide biosynthesis; similar to Alg6p" 
*	Jamie_Alpha_SPB_105.37762.37762.2	1.6207	0.0888	10.3	1918.0122	1920.2266	6525.0	22	3.42	33.3	1	N.PAWYAHTLGRSFPFLR.S
*	Jamie_Alpha_SPB_34.12223.12223.4	2.9502	0.1798	16.2	4309.8564	4312.965	8893.4	1	3.586	18.5	1	V.TLRQFVITPLGFKGIEVIDLCGDDRVSKPVFQSLFWE.F
YNL317W	2	2	9.2%	465	53143	8.1	U	PFS2 SGDID:S000005261, Chr XIV from 40618-42015, Verified ORF, "Integral subunit of the pre-mRNA cleavage and polyadenylation factor (CPF) complex; plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex" 
*	Jamie_Alpha_SPB_74.26625.26625.3	2.2856	0.251	11.8	3692.9043	3696.0132	7405.6	2	4.546	21.0	1	F.SLWNASSFTFETLMQAHDSAVTTMKYSHDSDW.M
*	Jamie_Alpha_SPB_107.38442.38442.1	1.1893	0.0413	14.1	1234.59	1235.3922	9122.2	313	3.056	35.0	1	P.RSGNCISSILK.F
Reverse_YGR109C	2	2	9.2%	380	44145	8.1	U	CLB6 SGDID:S000003341, Chr VII from 706505-705363, reverse complement, Verified ORF, "B-type cyclin involved in DNA replication during S phase; activates Cdc28p to promote initiation of DNA synthesis; functions in formation of mitotic spindles along with Clb3p and Clb4p; most abundant during late G1" 
*	Jamie_Alpha_SPB_35.12350.12350.2	2.0051	0.13	13.4	1772.0721	1771.1199	6222.1	50	3.125	39.3	1	I.CLLQLKNLKVVNQSL.F
*	Jamie_Alpha_SPB_47.16844.16844.4	3.6581	0.2251	20.0	3357.5366	3359.9458	6793.6	197	4.113	21.6	1	N.LKVVNQSLFRDLLNIALFLTEPLCHFKE.H
Reverse_YDR200C	2	2	9.1%	604	67284	7.4	U	VPS64 SGDID:S000002608, Chr IV from 856088-854274, reverse complement, Verified ORF, "Cytoplasmic protein required for cytoplasm to vacuole targeting of proteins; forms a complex with Far3p, Far7p, Far10p, and Far11p that is involved in pheromone-induced cell cycle arrest; also localized to the endoplasmic reticulum membrane" 
*	Jamie_Alpha_SPB_72.25671.25671.3	1.8317	0.0679	40.8	4323.9243	4320.763	10579.8	155	3.371	14.5	1	K.RHEFKSDIDTGLDVTDGVKLEVDNQRIKVGNVFTGNSSK.L
*	Jamie_Alpha_SPB_35.12319.12319.2	1.8647	0.1101	25.0	1756.3522	1755.0453	7464.5	102	3.839	33.3	1	R.ARGMPRKPPSTEPTKT.M
Reverse_YOL055C	2	2	9.1%	551	61269	6.2	U	THI20 SGDID:S000005416, Chr XV from 226073-224418, reverse complement, Verified ORF, "Hydroxymethylpyrimidine phosphate kinase, involved in the last steps in thiamine biosynthesis; member of a gene family with THI21 and THI22; functionally redundant with Thi21p" 
*	Jamie_Alpha_SPB_60.21566.21566.2	1.5491	0.0226	70.3	1360.5521	1360.6456	5517.9	254	3.032	40.9	1	R.SYARLAPGRKIK.Q
*	Jamie_Alpha_SPB_41.14548.14548.3	3.1745	0.1677	16.3	4359.264	4360.019	5128.4	133	3.85	15.5	1	I.KALDKAIQFIDQLGNVKREEGLLKYCEPINPTLIDAFP.A
Reverse_YAR002W	2	2	9.1%	539	59039	9.3	U	NUP60 SGDID:S000000063, Chr I from 152259-153878, Verified ORF, "Subunit of the nuclear pore complex (NPC), functions to anchor Nup2p to the NPC in a dynamic process that is controlled by the nucleoplasmic concentration of Gsp1p-GTP; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_100.35846.35846.2	1.8301	0.1136	25.0	1828.5922	1829.0599	5834.2	331	3.36	31.2	1	K.YKTFSDKSPASPSIKTA.N
*	Jamie_Alpha_SPB_104.37455.37455.3	2.5578	0.2786	26.2	3672.2043	3671.1187	5570.5	15	5.061	18.5	1	S.YRYVTTKYPSPLSSYNFSYKRSGISGLTTNMS.A
YER025W	2	2	9.1%	527	57866	6.8	U	GCD11 SGDID:S000000827, Chr V from 205250-206833, Verified ORF, "Gamma subunit of the translation initiation factor eIF2, involved in the identification of the start codon; binds GTP when forming the ternary complex with GTP and tRNAi-Met" 
*	Jamie_Alpha_SPB_28.10038.10038.2	2.2763	0.2508	36.4	1372.4521	1373.5989	6716.7	6	4.214	50.0	1	G.LIGVGTKVDPTLC.R
*	Jamie_Alpha_SPB_99.35479.35479.4	3.579	0.2284	22.2	3872.8965	3877.628	6812.2	1	5.374	19.6	1	F.LLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGSTA.T
Reverse_YBR108W	2	2	9.0%	947	103835	9.2	U	YBR108W SGDID:S000000312, Chr II from 454816-457659, Uncharacterized ORF, "Protein interacting with Rsv167p" 
*	Jamie_Alpha_SPB_40.14170.14170.4	2.7901	0.1017	72.9	4417.5767	4422.0586	8596.8	5	3.868	16.7	1	R.KYREFPNLNDDAASIDGSYAREMEIPRPELSKLLPKKK.P
*	Jamie_Alpha_SPB_101.36199.36199.4	1.7747	0.0242	25.6	5225.6567	5228.9263	7222.6	21	2.782	12.7	1	K.KGSKRERRAKSNNYHKKSAKYGTKAVYKTGQYGYKGASKLGSTISDK.N
YMR100W	2	2	9.0%	620	72251	6.9	U	MUB1 SGDID:S000004706, Chr XIII from 466299-468161, Verified ORF, "Protein of unknown function, deletion causes multi-budding phenotype; has similarity to Aspergillus nidulans samB gene" 
*	Jamie_Alpha_SPB_83.29715.29715.4	2.414	0.0894	59.7	4614.4165	4615.446	9316.5	50	3.237	15.8	1	R.KKVVMSGVLSVLVTVLDNYLLYHKNYDFIKDQTMTFDFK.G
*	Jamie_Alpha_SPB_106.37972.37972.2	1.7236	0.1605	13.0	1989.6522	1991.1235	7353.8	7	3.619	34.4	1	T.DFSDIWGRFADLASNFE.P
YIL036W	2	2	9.0%	587	65264	8.0	U	CST6 SGDID:S000001298, Chr IX from 285665-287428, Verified ORF, "Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family, activates transcription of genes involved in utilization of non-optimal carbon sources" 
*	Jamie_Alpha_SPB_89.31833.31833.2	1.4955	0.0828	80.8	2523.5723	2521.7185	5947.6	11	3.493	25.0	1	K.IPHSVSDTSAAATTTSTMNNSALSR.S
*	Jamie_Alpha_SPB_35.12554.12554.4	3.2591	0.148	12.0	3092.5366	3087.515	6982.5	207	3.971	20.4	1	G.SHLNLAANTQGNPIPGTTAWKRARLLER.N
YOL123W	2	2	9.0%	534	59650	5.6	U	HRP1 SGDID:S000005483, Chr XV from 87843-89447, Verified ORF, "Subunit of cleavage factor I, a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences" 
*	Jamie_Alpha_SPB_99.35530.35530.4	3.4088	0.2404	21.6	2885.6565	2891.0874	4724.5	435	4.358	22.9	1	S.QSPPQQQVTQTKEERSKADLSKESC.K
*	Jamie_Alpha_SPB_59.21204.21204.4	2.7881	0.0111	41.1	2670.8167	2674.0322	4096.6	102	2.847	25.8	1	K.TQHILDGKVIDPKRAIPRDEQDK.T
Reverse_YNL152W	2	2	9.0%	409	46226	7.3	U	YNL152W SGDID:S000005096, Chr XIV from 346315-347544, Uncharacterized ORF, "Protein required for cell viability" 
*	Jamie_Alpha_SPB_41.14487.14487.2	1.5814	0.0808	11.2	1392.3922	1394.5297	5657.0	126	3.239	40.9	1	R.LNAFHFKTNSTN.S
*	Jamie_Alpha_SPB_68.24469.24469.3	1.8987	0.0828	46.9	2920.7043	2921.312	7796.1	54	3.46	21.9	1	K.ELYHFVPNQGARHLTNSARTMHAIR.L
contaminant_UBIQUITIN03	4	4	8.9%	1011	111720	5.9	U	no description
*	Jamie_Alpha_SPB_24.08443.08443.2	1.503	0.0405	72.2	1930.0922	1931.1149	7072.6	16	3.045	35.3	1	R.GSRYDGQIAVFGAGFQEK.L
*	Jamie_Alpha_SPB_25.08748.08748.4	3.0444	0.1939	10.2	5051.177	5054.671	6114.8	6	4.2	13.8	1	R.PKAEVAAAAARGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAA.L
*	Jamie_Alpha_SPB_16.05634.05634.2	2.2759	0.0069	10.8	1465.2722	1464.8813	4834.0	164	2.849	41.7	1	L.TLLKPVLGVLRVR.P
*	Jamie_Alpha_SPB_19.06861.06861.2	1.6982	0.1454	11.2	1422.8121	1423.6727	6559.0	3	3.789	55.0	1	L.HLAENYLIRYM.P
YLR381W	2	2	8.9%	733	84252	8.7	U	CTF3 SGDID:S000004373, Chr XII from 879723-881924, Verified ORF, "Outer kinetochore protein that forms a complex with Mcm16p and Mcm22p; may bind the kinetochore to spindle microtubules" 
*	Jamie_Alpha_SPB_14.04838.04838.4	1.9835	0.0572	41.0	4989.2964	4990.611	5174.1	393	3.382	11.5	1	R.LQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDVDYMMK.P
*	Jamie_Alpha_SPB_76.27244.27244.3	2.4738	0.197	14.3	2541.6543	2545.9165	6705.5	174	3.582	27.4	1	T.LLHDMQSLLTLDKIFNNATSNR.F
YOR317W	2	2	8.9%	700	77866	7.6	U	FAA1 SGDID:S000005844, Chr XV from 909338-911440, Verified ORF, "Long chain fatty acyl-CoA synthetase with a preference for C12:0-C16:0 fatty acids; involved in the activation of imported fatty acids; not required for growth on nonfermentable carbon sources; essential for stationary phase" 
*	Jamie_Alpha_SPB_51.18262.18262.2	1.5149	0.0616	75.1	1622.1322	1622.865	6083.9	398	2.833	34.4	1	K.HSNVVAGVGGASLNVLK.F
*	Jamie_Alpha_SPB_92.32882.32882.4	2.2329	0.0501	43.4	4854.4565	4856.573	7715.4	163	3.248	14.4	1	K.AVYSDLLKTGKDQGLVGIELLAGIVFFDGEWTPQNGFVTSAQKLK.R
YER122C	2	2	8.9%	493	55094	8.2	U	GLO3 SGDID:S000000924, Chr V from 404348-402867, reverse complement, Verified ORF, "ADP-ribosylation factor GTPase activating protein (ARF GAP), involved in ER-Golgi transport; shares functional similarity with Gcs1p" 
*	Jamie_Alpha_SPB_16.05802.05802.2	1.6174	0.1708	12.2	1876.2122	1875.1001	7574.7	16	4.152	36.7	1	G.GNHKARDFFLKNNGKQ.L
*	Jamie_Alpha_SPB_92.32925.32925.4	2.7492	0.0924	67.7	3180.6965	3177.7646	4887.0	77	3.283	21.6	1	R.KKPVLNSQDKKKHSILSSSRKPTRLTAK.K
Reverse_YOL065C	2	2	8.9%	384	43799	7.6	U	INP54 SGDID:S000005426, Chr XV from 205884-204730, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase with a role in secretion, localizes to the endoplasmic reticulum via the C-terminal tail; lacks the Sac1 domain and proline-rich region found in the other 3 INP proteins" 
*	Jamie_Alpha_SPB_35.12543.12543.2	1.8234	0.0532	11.4	1605.1721	1604.8467	5611.2	187	2.926	35.7	1	K.EIHLSLPVPTGTSRP.L
*	Jamie_Alpha_SPB_91.32562.32562.2	1.6503	0.0755	10.8	2141.9321	2142.4463	7764.1	53	3.605	30.6	1	R.TMQFSILTGGKLHTGFWGC.K
YLR017W	2	2	8.9%	337	37857	7.8	U	MEU1 SGDID:S000004007, Chr XII from 177607-178620, Verified ORF, "Methylthioadenosine phosphorylase (MTAP), catalyzes the initial step in the methionine salvage pathway; affects polyamine biosynthesis through regulation of ornithine decarboxylase (Spe1p) activity; regulates ADH2 gene expression" 
*	Jamie_Alpha_SPB_16.05502.05502.2	1.7973	0.0914	27.5	897.0122	895.04645	3826.6	436	3.345	71.4	1	I.KNTFSVAK.R
*	Jamie_Alpha_SPB_37.13327.13327.2	1.9235	0.2649	22.7	2471.912	2472.893	5091.9	256	4.113	23.8	1	S.AVGSLQPHIKPRDFVLPQQIID.R
YOR355W	2	2	8.8%	522	57048	8.7	U	GDS1 SGDID:S000005882, Chr XV from 1005133-1006701, Verified ORF, "Protein of unknown function, required for growth on glycerol as a carbon source" 
*	Jamie_Alpha_SPB_35.12560.12560.2	2.0004	0.0425	85.9	3131.632	3132.4475	6064.4	415	3.208	20.0	1	K.SKNNNKKRNYMDEDTNESMTEPKKTK.T
*	Jamie_Alpha_SPB_27.09664.09664.2	1.9999	0.1143	32.2	2098.4521	2099.3457	7735.4	186	3.967	31.6	1	R.SSSELAAIHKVISTQTPIES.S
Reverse_YLR116W	2	2	8.8%	476	53034	9.7	U	MSL5 SGDID:S000004106, Chr XII from 380823-382253, Verified ORF, "Component of the commitment complex, which defines the first step in the splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA" 
*	Jamie_Alpha_SPB_117.41869.41869.2	1.1432	0.2187	24.6	2849.4922	2849.1729	8212.6	390	4.459	14.3	1	P.PPAIGPVGSSFSSSTLGPPPTPTVNQAQR.S
*	Jamie_Alpha_SPB_104.37404.37404.2	1.6406	0.104	20.0	1574.3722	1575.7716	8906.2	277	3.421	41.7	1	G.RIAIKCNSDEQLK.R
YAR071W	2	2	8.8%	467	52758	5.2	U	PHO11 SGDID:S000000094, Chr I from 225451-226854, Verified ORF, "One of three repressible acid phosphatases, a glycoprotein that is transported to the cell surface by the secretory pathway; induced by phosphate starvation and coordinately regulated by PHO4 and PHO2" 
YHR215W	2	2	8.8%	467	52700	5.2	U	PHO12 SGDID:S000001258, Chr VIII from 552099-553502, Verified ORF, "One of three repressible acid phosphatases, a glycoprotein that is transported to the cell surface by the secretory pathway; nearly identical to Pho11p; upregulated by phosphate starvation" 
	Jamie_Alpha_SPB_27.09470.09470.4	3.5429	0.1726	15.4	3472.0166	3470.8613	6100.3	90	3.9	18.4	1	W.DDDVNDDILKKYDTKYLSGIAKRLNKENKG.L
	Jamie_Alpha_SPB_80.28530.28530.2	1.7584	0.1622	15.9	1740.2922	1739.8798	6283.8	3	3.908	40.0	1	N.KENKGLNLTSSDANTF.F
YDR055W	2	2	8.8%	444	45777	9.2	U	PST1 SGDID:S000002462, Chr IV from 563524-564858, Verified ORF, "Cell wall protein that contains a putative GPI-attachment site; secreted by regenerating protoplasts; up-regulated by activation of the cell integrity pathway, as mediated by Rlm1p; upregulated by cell wall damage via disruption of FKS1" 
*	Jamie_Alpha_SPB_37.13215.13215.2	1.7872	0.0637	10.9	1841.0721	1842.0227	7059.6	2	3.347	41.2	1	F.VCKNGASSTSVKLSSTSK.S
*	Jamie_Alpha_SPB_23.08156.08156.2	1.2085	0.0332	64.2	2230.1921	2227.4338	6308.3	2	2.719	32.5	1	K.SQSSQTTAKVSKSSSKAEEKK.F
YJL084C	4	4	8.7%	1046	117216	6.9	U	YJL084C SGDID:S000003620, Chr X from 277918-274778, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function that interacts with Pcl7p, phosphorylated in vitro; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_95.34116.34116.4	3.5158	0.1737	14.9	3516.9365	3518.7788	5878.7	46	4.005	20.4	1	E.SNNAANNFLTKESGASLYRTLSDNETITSRKN.S
*	Jamie_Alpha_SPB_84.29997.29997.2	1.5545	0.0933	84.6	2437.0723	2438.8296	10024.6	77	3.695	28.6	1	K.FLLTEQKGPKLPNLPNDANLSK.A
*	Jamie_Alpha_SPB_28.10030.10030.2	2.1669	0.109	12.2	2665.2722	2663.9463	7851.1	20	3.636	29.5	1	S.DDNINLYHNSNIFFPKEVLSSPV.L
*	Jamie_Alpha_SPB_15.05264.05264.2	1.82	0.0773	19.6	1594.3322	1593.7343	6193.3	20	3.192	42.3	1	N.KNSDKNSSETLNKK.E
YPR104C	3	3	8.7%	936	103502	5.9	U	FHL1 SGDID:S000006308, Chr XVI from 736431-733621, reverse complement, Verified ORF, "Putative transcriptional regulator with similarity to DNA-binding domain of Drosophila forkhead; required for rRNA processing" 
*	Jamie_Alpha_SPB_92.33038.33038.4	2.2242	0.233	14.8	5077.8965	5074.311	10031.3	395	4.401	12.3	1	Q.PRQNARATSSVAATSVPAAASQNVDAQPKPKPAQDNDLESESGTSSSSSSS.S
*	Jamie_Alpha_SPB_85.30513.30513.3	2.4017	0.2304	13.6	3403.4944	3404.095	7096.4	6	5.14	19.3	1	A.QDNDLESESGTSSSSSSSSESGSESDSGSDDGSASG.S
*	Jamie_Alpha_SPB_46.16560.16560.3	2.7596	0.2044	12.8	3637.7043	3641.2642	7027.9	102	4.628	15.4	1	E.SGTSSSSSSSSESGSESDSGSDDGSASGSGDNSSTSSESE.S
YJL034W	3	3	8.7%	682	74468	4.9	U	KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" 
contaminant_GR78_YEAST	3	3	8.7%	682	74468	4.9	U	owl|P16474| 78 KD GLUCOSE REGULATED PROTEIN HOMOLOG PRECURSOR (GRP 78) (IMMUNOGLOBULIN... 
	Jamie_Alpha_SPB_12.04044.04044.2	1.5757	0.1599	94.7	1098.7322	1099.1454	6030.1	32	3.836	61.1	1	K.HGIDVSDNNK.A
	Jamie_Alpha_SPB_77.27680.27680.2	1.694	0.1449	10.8	1970.7722	1973.3385	7452.4	34	4.094	36.1	1	L.GIETTGGVMTPLIKRNTAI.P
	Jamie_Alpha_SPB_37.13340.13340.2	3.5103	0.5131	100.0	3271.0122	3272.1096	8816.3	1	9.635	36.2	1	K.LYGGADGSGAADYDDEDEDDDGDYFEHDEL.-
contaminant_KERATIN13	7	8	8.7%	643	65494	6.6	U	no description
	Jamie_Alpha_SPB_18.06228.06228.2	2.771	0.1894	100.0	1476.0922	1476.6726	7594.0	2	4.958	72.7	1	R.FLEQQNQVLQTK.W
	Jamie_Alpha_SPB_15.05442.05442.3	1.729	0.0095	26.2	1310.7244	1309.4215	6033.0	1	3.067	50.0	1	R.NKYEDEINKR.T
*	Jamie_Alpha_SPB_28.10000.10000.2	3.914	0.4554	100.0	2501.392	2502.7405	8045.9	1	8.564	45.2	2	K.SKAEAESLYQSKYEELQITAGR.H
*	Jamie_Alpha_SPB_29.10159.10159.3	3.8691	0.2752	100.0	2502.5942	2502.7405	7982.3	1	6.182	33.3	1	K.SKAEAESLYQSKYEELQITAGR.H
*	Jamie_Alpha_SPB_27.09769.09769.2	2.008	0.2084	99.5	2285.672	2287.4883	5371.1	82	4.045	34.2	1	K.AEAESLYQSKYEELQITAGR.H
*	Jamie_Alpha_SPB_17.06165.06165.2	2.8747	0.0648	98.2	1180.6921	1180.303	6790.9	1	5.603	94.4	1	K.YEELQITAGR.H
*	Jamie_Alpha_SPB_19.06643.06643.2	2.7065	0.2721	100.0	1454.5322	1454.5797	7029.3	1	5.36	63.6	1	A.TYRTLLEGEESR.M
contaminant_KERATIN21	2	2	8.7%	357	39219	5.2	U	no description
	Jamie_Alpha_SPB_15.05442.05442.3	1.729	0.0095	26.2	1310.7244	1309.4215	6033.0	1	3.067	50.0	1	K.NKYEDEINKR.T
*	Jamie_Alpha_SPB_84.29983.29983.2	1.8996	0.0908	24.8	1913.0122	1915.1075	5927.2	11	3.723	30.0	1	R.AIGGGLSSVGGGSSTIKYTTT.S
YKL104C	3	4	8.6%	717	80047	6.4	U	GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" 
*	Jamie_Alpha_SPB_44.15847.15847.2	2.5382	0.0191	90.9	2375.7722	2373.6213	8055.6	1	3.042	40.0	2	K.VDFVDVEFPEENAGQPEIPLK.S
*	Jamie_Alpha_SPB_44.15772.15772.2	1.7096	0.0625	82.7	2519.9922	2521.7917	6891.6	15	4.343	27.5	1	K.VLFLEDDDLAHIYDGELHIHR.S
*	Jamie_Alpha_SPB_19.06884.06884.3	2.3601	0.1711	10.5	2364.3542	2367.7278	5475.3	135	3.695	26.3	1	L.QLMSYWLAVNKGIDVDFPRN.L
YKR099W	3	3	8.5%	811	89604	8.2	U	BAS1 SGDID:S000001807, Chr XI from 635489-637924, Verified ORF, "Myb-related transcription factor involved in regulating basal and induced expression of genes of the purine and histidine biosynthesis pathways" 
*	Jamie_Alpha_SPB_120.42993.42993.2	1.4	0.2119	13.4	1340.5521	1338.457	6897.0	2	4.223	45.5	1	E.LGYENGLEDVKT.I
*	Jamie_Alpha_SPB_80.28612.28612.3	1.6316	0.0656	33.0	4614.3545	4615.1685	8242.8	227	3.49	11.3	1	R.IAHFNYLPPTIRPHLGSSDATRGADLNKLLNPSPNSVRSNGSK.T
*	Jamie_Alpha_SPB_32.11241.11241.2	1.958	0.0437	10.6	1658.0521	1655.7678	5799.0	155	3.191	38.5	1	K.KEKRKSESSQHHSS.S
YBR198C	2	2	8.5%	798	88968	7.4	U	TAF5 SGDID:S000000402, Chr II from 618518-616122, reverse complement, Verified ORF, "Subunit (90 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification" 
*	Jamie_Alpha_SPB_31.11112.11112.2	1.3443	0.0011	64.9	901.5122	899.096	2293.0	90	2.894	58.3	1	K.YRITMSK.T
*	Jamie_Alpha_SPB_84.30237.30237.4	1.81	0.2377	14.3	6821.3364	6823.7446	5340.7	201	4.242	7.2	1	E.PSAEPDEPFIGYLGDVTASINQDIKEYGRRRTVIPTSDLVASFYTKKTPVFKVKFSRSNLA.L
YDR419W	2	2	8.5%	632	71515	8.2	U	RAD30 SGDID:S000002827, Chr IV from 1303164-1305062, Verified ORF, "DNA polymerase eta, involved in the predominantly error-free bypass replication of DNA lesions, catalyzes the efficient and accurate synthesis of DNA opposite cyclobutane pyrimidine dimers; homolog of human POLH and bacterial DinB proteins" 
*	Jamie_Alpha_SPB_33.11719.11719.2	1.7123	0.0735	10.9	1748.6322	1748.8151	6197.7	219	3.746	35.7	1	W.QYHDGCGSWVQDPAK.Q
*	Jamie_Alpha_SPB_45.16047.16047.4	2.042	0.2528	14.5	4379.4565	4382.7847	6570.4	208	4.478	13.6	1	E.TWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAE.K
contaminant_KERATIN14	3	3	8.5%	638	65871	8.1	U	no description
*	Jamie_Alpha_SPB_16.05517.05517.1	1.1559	0.1864	33.3	1263.83	1263.4368	3970.0	212	4.113	25.0	1	N.KSISISVAAGSSR.A
*	Jamie_Alpha_SPB_119.42580.42580.3	2.2803	0.2236	16.5	2703.7144	2704.9531	10332.2	22	4.417	27.4	1	L.VEDFKKKYEDEINKRTAAENEF.V
*	Jamie_Alpha_SPB_87.31281.31281.2	2.3026	0.1383	48.4	1733.9922	1735.82	6151.0	32	5.107	33.3	1	H.SGMGSSSGSIQTSGGSGYK.S
contaminant_SPA2_STAAU	7	9	8.5%	508	55439	5.7	U	owl|P38507| IMMUNOGLOBULIN G BINDING PROTEIN A PRECURSOR (PROTEIN A). - STAPHYLOCOCCUS... 
	Jamie_Alpha_SPB_20.07136.07136.1	1.5461	0.1492	94.1	1458.47	1459.5529	3851.6	52	3.902	38.5	1	K.DDPSQSANLLAEAK.K
	Jamie_Alpha_SPB_20.07224.07224.2	4.1179	0.3058	100.0	1461.0721	1459.5529	6302.9	1	5.909	84.6	1	K.DDPSQSANLLAEAK.K
	Jamie_Alpha_SPB_20.07177.07177.1	1.2843	0.0713	23.0	1229.11	1229.3757	8323.4	5	3.572	50.0	1	D.PSQSANLLAEAK.K
	Jamie_Alpha_SPB_20.07188.07188.1	2.246	0.1052	100.0	758.87	758.8931	4323.8	4	3.258	83.3	1	A.NLLAEAK.K
	Jamie_Alpha_SPB_46.16352.16352.2	3.992	0.5155	100.0	2485.9922	2486.7031	6098.7	1	7.926	44.7	2	K.EQQNAFYEILHLPNLNEEQR.N
	Jamie_Alpha_SPB_47.16899.16899.3	2.6563	0.0598	54.8	2487.3245	2486.7031	7346.8	7	3.516	26.3	2	K.EQQNAFYEILHLPNLNEEQR.N
	Jamie_Alpha_SPB_7.02234.02234.2	3.0985	9.0E-4	96.3	985.09216	985.12823	4596.4	4	4.613	87.5	1	K.KLNDAQAPK.A
YKR003W	2	2	8.5%	448	51588	8.5	U	OSH6 SGDID:S000001711, Chr XI from 445024-446370, Verified ORF, "Member of an oxysterol-binding protein family with overlapping, redundant functions in sterol metabolism and which collectively perform a function essential for viability; GFP-fusion protein localizes to the cell periphery" 
	Jamie_Alpha_SPB_36.12696.12696.2	1.5953	0.1035	20.8	1332.8121	1331.6415	6253.5	325	3.483	45.0	1	T.RITLPTFILEK.K
*	Jamie_Alpha_SPB_33.11781.11781.4	4.0249	0.2212	31.4	3185.7366	3179.812	5713.2	105	4.141	21.2	1	E.KYVLTQPNVYVRGILFGKMRIELGDHM.I
YGL243W	2	2	8.5%	400	45947	8.2	U	TAD1 SGDID:S000003212, Chr VII from 43307-44509, Verified ORF, "tRNA-specific adenosine deaminase, deaminates adenosine-37 to inosine in tRNA-Ala" 
*	Jamie_Alpha_SPB_78.27824.27824.3	3.1334	0.2784	55.6	2191.7944	2193.4763	4473.9	11	4.928	33.8	1	N.FNRRNVVRTKPGRYDSNI.T
*	Jamie_Alpha_SPB_53.18908.18908.2	1.3854	0.0142	64.9	2054.2122	2052.2659	6944.2	86	3.058	33.3	1	K.HCQSQVSRFAQWELFK.K
YKL164C	3	3	8.5%	341	34622	6.5	U	PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" 
*	Jamie_Alpha_SPB_111.39837.39837.1	1.2313	0.0816	23.5	1001.14	1002.1154	7566.8	305	3.49	38.9	1	K.RAAAISQIGD.G
*	Jamie_Alpha_SPB_36.12703.12703.2	1.718	0.1835	37.2	1498.2122	1499.667	6727.8	16	3.998	42.9	1	K.RAAAISQIGDGQIQA.T
*	Jamie_Alpha_SPB_93.33346.33346.2	1.9437	0.1115	10.3	1479.4122	1476.5464	4808.8	171	3.631	42.3	1	A.PITNGTDPVTAETC.K
Reverse_YPL009C	4	4	8.4%	1038	119069	5.7	U	YPL009C SGDID:S000005930, Chr XVI from 538933-535817, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_15.05425.05425.3	2.1593	0.1162	68.8	1718.3944	1719.2107	5292.6	20	3.234	37.5	1	K.SLLLKHISPVKVKKK.K
*	Jamie_Alpha_SPB_88.31735.31735.3	2.5444	0.1819	12.4	2477.8743	2477.8633	5664.2	146	3.904	27.5	1	I.NLQKIVTIDSEYKAQVAKIWE.N
*	Jamie_Alpha_SPB_30.10831.10831.2	1.996	0.2523	21.7	2254.172	2256.356	4957.9	48	5.45	33.3	1	S.EDASENNTTFLSEDFMEYI.Q
*	Jamie_Alpha_SPB_16.05572.05572.4	3.4038	0.1575	17.0	3654.0964	3657.163	3757.6	43	3.696	18.8	1	V.NGASFFELVLYFHGDAFQLVLIRDQDVQKLAT.L
Reverse_YHR032W	2	2	8.4%	581	64209	6.1	U	YHR032W SGDID:S000001074, Chr VIII from 173337-175082, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_25.08936.08936.2	2.6003	0.1449	69.2	1736.6921	1736.9688	8959.0	2	4.125	50.0	1	G.NGHQSLLKNDILLDR.E
*	Jamie_Alpha_SPB_104.37159.37159.4	3.2756	0.1618	17.0	3710.3364	3712.8672	6045.3	4	3.885	19.7	1	P.EEESGEQEEGEILNEESEQPIYDAPTFLGAKGVS.T
Reverse_YFR051C	3	3	8.4%	546	60628	5.2	U	RET2 SGDID:S000001947, Chr VI from 251790-250150, reverse complement, Verified ORF, "Delta subunit of the coatomer complex (COPI), which coats Golgi-derived transport vesicles; involved in retrograde transport between Golgi and ER" 
*	Jamie_Alpha_SPB_69.24591.24591.2	1.7747	0.0874	20.3	1627.4922	1625.8625	5660.2	341	3.921	35.7	1	L.TLPILSDDEAPAVKR.W
*	Jamie_Alpha_SPB_57.20250.20250.2	1.9546	0.2872	18.2	1710.5721	1712.9272	6579.8	82	4.529	30.6	1	A.AGARRGAGGGLKMGGTASH.G
*	Jamie_Alpha_SPB_92.33118.33118.2	1.7684	0.0523	11.6	1543.6122	1541.8434	4250.5	136	3.255	40.9	1	H.EKRAIEKARRKR.E
Reverse_YPR125W	2	2	8.4%	454	52175	9.3	U	YPR125W SGDID:S000006329, Chr XVI from 787957-789321, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_40.14174.14174.2	2.5139	0.0195	21.3	2358.7322	2358.7	11307.7	151	3.02	25.0	1	-.KEKIAAAEGIPKTDHPKVDPAAA.D
*	Jamie_Alpha_SPB_76.27134.27134.2	2.0843	0.1195	12.4	1840.5322	1842.1841	6644.6	1	4.066	50.0	1	I.RYRLMVDTGFPQLNM.Y
Reverse_YNL054W	3	3	8.3%	1165	128140	6.0	U	VAC7 SGDID:S000004999, Chr XIV from 526087-529584, Verified ORF, "Integral vacuolar membrane protein involved in vacuole inheritance and morphology; may function to regulate Fab1p kinase activity" 
*	Jamie_Alpha_SPB_48.17283.17283.2	1.6886	0.1174	24.5	2595.112	2595.9214	7191.2	53	3.994	22.7	1	D.FILEDSSSIVNDMVVVDVDQLEK.N
*	Jamie_Alpha_SPB_99.35665.35665.3	2.7298	0.1555	10.1	2519.0942	2522.5647	5045.2	23	4.153	26.1	1	N.NPELEQSNTAVNPCSITNGNSSTS.S
*	Jamie_Alpha_SPB_50.17773.17773.4	2.9269	0.1757	12.0	5392.2163	5386.706	6287.9	22	4.022	13.6	1	K.NKKMKNNNENDDANSHNPIRLGDNAVPGNDHTTSNAPANKAKTDDLLNEG.L
YLR299W	2	2	8.3%	660	73181	5.9	U	ECM38 SGDID:S000004290, Chr XII from 726071-728053, Verified ORF, "Gamma-glutamyltranspeptidase, major glutathione-degrading enzyme; expression induced mainly by nitrogen starvation" 
*	Jamie_Alpha_SPB_60.21606.21606.2	1.8262	0.163	10.3	2491.4722	2492.0962	7785.3	1	4.678	29.5	1	I.LHIFTLLTLGVLVSGMPSKMVSF.A
*	Jamie_Alpha_SPB_84.30268.30268.3	1.7371	0.0387	27.8	3435.6543	3438.7522	10986.8	114	2.721	17.7	1	K.GMVNFFNSGIGGGGYVVFSGKDDEDHLSIDFR.E
Reverse_YNL227C	2	2	8.3%	590	68783	6.2	U	JJJ1 SGDID:S000005171, Chr XIV from 222432-220660, reverse complement, Uncharacterized ORF, "Protein that contains a 70 amino acid J-domain, may function as a co-chaperone to recruit Hsp70-like activity to specific sites; mutation causes defects in fluid-phase endocytosis" 
*	Jamie_Alpha_SPB_68.24200.24200.3	1.7128	0.064	35.0	3340.0444	3337.5352	10040.7	73	3.148	18.1	1	K.AKTSWDEDDDTQLGKDGLSALLDDLENSRK.D
*	Jamie_Alpha_SPB_84.30178.30178.3	2.1872	0.0027	28.3	2270.5444	2272.7148	5380.0	313	2.616	26.4	1	K.LKRQEEAIKAGEKMRKDLK.K
Reverse_YBR227C	2	2	8.3%	520	57946	7.8	U	MCX1 SGDID:S000000431, Chr II from 675129-673567, reverse complement, Verified ORF, "Mitochondrial ATP-binding protein, possibly a mitochondrial chaperone with non-proteolytic function; similar to bacterial ClpX proteins" 
*	Jamie_Alpha_SPB_19.06888.06888.3	2.6957	0.1937	15.6	2294.9644	2294.6157	8367.3	65	3.777	27.8	1	Y.QDLLANKPEKLIHFLDDRQ.L
*	Jamie_Alpha_SPB_47.16862.16862.2	1.3451	0.15	87.3	2842.3323	2845.3176	6203.8	259	3.336	19.6	1	R.QLEGKKQKDNIRLYHNYVAVSLVK.K
Reverse_YLR187W	2	2	8.2%	1026	114111	8.3	U	SKG3 SGDID:S000004177, Chr XII from 524867-527947, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery, cytoplasm, bud, and bud neck; potential Cdc28p substrate; similar to Caf120p and Skg4p" 
*	Jamie_Alpha_SPB_82.29534.29534.4	2.6207	0.1976	15.3	4671.4565	4665.496	7575.0	37	4.102	14.2	1	D.VQLYYIHPLTPLAFLLSDPDTRNAILGKPRGYLYFANMAPI.L
*	Jamie_Alpha_SPB_106.38042.38042.4	3.0248	0.0072	42.5	4557.4966	4554.114	8321.8	37	3.88	15.9	1	R.HAQASLLTVIPVLEPSIDGNISHEQPLDLTPSGPTSISNSFLR.S
Reverse_YKR050W	3	3	8.2%	889	101086	9.5	U	TRK2 SGDID:S000001758, Chr XI from 527457-530126, Verified ORF, "Component of the Trk1p-Trk2p potassium transport system" 
*	Jamie_Alpha_SPB_32.11448.11448.3	1.7043	0.2545	15.4	1601.0343	1603.6012	2457.3	484	4.647	28.8	1	Y.KHPAGDFYDHDGED.R
*	Jamie_Alpha_SPB_55.19708.19708.3	2.0394	0.0379	35.3	2265.6843	2267.5872	7166.8	9	2.956	26.1	1	K.TALGGQTSAGAALFLVDIFATNK.C
*	Jamie_Alpha_SPB_43.15304.15304.4	2.8329	0.1628	88.3	4273.4966	4274.1104	6966.2	61	4.001	17.6	1	K.CPYLLISGIISLTILYIYHVVIFNPFVYKAIPRCSK.L
YDR014W	3	3	8.2%	647	74722	5.9	U	RAD61 SGDID:S000002421, Chr IV from 474043-475986, Verified ORF, "Protein of unknown function; mutation confers radiation sensitivity" 
*	Jamie_Alpha_SPB_67.24078.24078.4	3.1949	0.1955	10.6	3531.5764	3533.735	8669.8	95	3.836	18.7	1	G.LPSSSDVEFSDDDVNSVIPDVSSTISSSIADHPI.E
*	Jamie_Alpha_SPB_89.31992.31992.2	1.4741	0.1056	10.7	1542.6522	1544.7627	5214.2	19	3.226	45.0	1	K.RKRRRTYQKHD.A
*	Jamie_Alpha_SPB_116.41679.41679.1	1.402	0.0677	20.6	988.78	988.13135	6465.4	223	3.784	50.0	1	K.KLSHLNFE.D
YEL015W	2	2	8.2%	551	61340	6.4	U	EDC3 SGDID:S000000741, Chr V from 126629-128284, Verified ORF, "Non-essential conserved protein of unknown function, plays a role in mRNA decapping by specifically affecting the function of the decapping enzyme Dcp1p; localizes to cytoplasmic mRNA processing bodies" 
*	Jamie_Alpha_SPB_75.26703.26703.4	3.0071	0.1809	13.1	3606.0566	3605.1016	6244.9	146	3.666	18.8	1	S.INDKTKGTVINDKDQVLAKLGQMIISQSRSNST.S
*	Jamie_Alpha_SPB_91.32691.32691.2	1.452	0.0531	72.3	1691.6322	1689.8662	5054.8	252	3.369	30.0	1	R.SNSTSLPAANKQTTIR.S
YLR424W	2	2	8.1%	708	83049	5.3	U	YLR424W SGDID:S000004416, Chr XII from 973391-975517, Uncharacterized ORF, "Essential protein present in native splicing complexes; identified as a suppressor of prp38-1, a spliceosomal maturation mutation; cold sensitive alleles accumulate pre-mRNA" 
*	Jamie_Alpha_SPB_78.27876.27876.2	1.6742	0.0961	20.0	1279.8522	1277.5065	4426.2	18	3.102	45.5	1	Q.NIPLGKVSSSFK.D
*	Jamie_Alpha_SPB_104.37216.37216.4	2.309	0.0527	45.9	5324.6167	5328.0737	8740.5	59	3.359	14.0	1	R.YTQLPYGRDQDCIVPLFEIRNGKKKMEVALKHDILWVEDSSGTFK.P
YLR180W	2	2	8.1%	382	41818	5.2	U	SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" 
	Jamie_Alpha_SPB_31.11104.11104.2	2.8162	0.0299	10.2	2083.5522	2082.4163	8196.6	10	3.604	41.7	1	I.MFGYATDETPEGLPLTILL.A
*	Jamie_Alpha_SPB_25.08876.08876.2	2.1963	0.1374	98.2	1360.3722	1359.5248	5701.5	31	3.446	50.0	1	R.DGSLAWLRPDTK.T
Reverse_YJR095W	2	2	8.1%	322	35340	9.8	U	SFC1 SGDID:S000003856, Chr X from 609690-610658, Verified ORF, "Mitochondrial succinate-fumarate transporter, transports succinate into and fumarate out of the mitochondrion; required for ethanol and acetate utilization" 
*	Jamie_Alpha_SPB_22.07929.07929.2	1.7259	0.087	21.8	1084.6322	1085.3127	3784.5	4	3.238	55.6	1	V.AQGPAVRMVR.P
*	Jamie_Alpha_SPB_33.11704.11704.2	2.0829	0.0195	10.8	1822.1122	1821.1425	7186.9	6	2.747	40.0	1	K.KMGSQKELSISKDKQL.R
YKL179C	2	2	8.0%	679	77514	6.1	U	COY1 SGDID:S000001662, Chr XI from 112508-110469, reverse complement, Verified ORF, "Golgi membrane protein with similarity to mammalian CASP; genetic interactions with GOS1 (encoding a Golgi snare protein) suggest a role in Golgi function" 
*	Jamie_Alpha_SPB_53.18871.18871.3	2.3578	0.0025	30.4	3706.7644	3704.209	5978.5	238	2.716	15.6	1	K.VLFDVYEKLSEAPDPQPLLQSSLEKLGKIDDSK.E
*	Jamie_Alpha_SPB_73.26044.26044.2	1.2974	0.0199	64.0	2446.6921	2448.6926	9098.1	5	3.216	30.0	1	R.SKSTAQEEERNELKKSVDQLK.Q
YER052C	2	2	8.0%	527	58110	6.7	U	HOM3 SGDID:S000000854, Chr V from 257957-256374, reverse complement, Verified ORF, "Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis" 
*	Jamie_Alpha_SPB_15.05426.05426.2	1.8275	0.1557	15.7	2249.0122	2251.5132	5437.3	181	3.662	28.9	1	D.RGCKAKYVDLSHIVPSDFSA.S
*	Jamie_Alpha_SPB_90.32396.32396.2	1.4319	0.0042	65.0	2397.632	2397.78	8498.0	359	3.134	23.8	1	R.IKNVQNPLGNGTIIYPDNVAKK.G
YAL034C	2	2	8.0%	413	47068	9.9	U	FUN19 SGDID:S000002134, Chr I from 81952-80711, reverse complement, Verified ORF, "Non-essential protein of unknown function" 
*	Jamie_Alpha_SPB_21.07413.07413.2	2.0194	0.1269	12.7	1555.7922	1557.5769	6229.7	19	3.768	46.4	1	N.GNGCFSGSIDSLVDE.H
*	Jamie_Alpha_SPB_16.05575.05575.2	1.5713	0.0437	73.4	2157.4521	2159.449	4639.9	27	3.232	35.3	1	R.LFQAFEKVGWLQDSNFTK.Y
Reverse_YDL145C	5	5	7.9%	1201	135607	6.0	U	COP1 SGDID:S000002304, Chr IV from 198177-194572, reverse complement, Verified ORF, "Alpha subunit of COPI vesicle coatomer complex, which surrounds transport vesicles in the early secretory pathway" 
*	Jamie_Alpha_SPB_94.33790.33790.2	1.5612	0.1779	13.1	2832.892	2832.1768	11767.0	96	4.337	20.8	1	D.KETIVYKSGTLPDSVSPTDEYIPKY.T
*	Jamie_Alpha_SPB_15.05274.05274.2	1.8499	0.1279	12.5	1196.7522	1196.3892	3794.9	202	3.468	61.1	1	E.LIKHALKEDE.A
*	Jamie_Alpha_SPB_82.29400.29400.4	3.2282	0.1853	15.8	4103.2563	4100.7124	6916.6	211	4.224	16.7	1	F.ADWPQGIGKLSAYPLSAVRKQFNFSQIQKEANVFFL.Q
*	Jamie_Alpha_SPB_113.40677.40677.1	1.0432	0.2457	37.5	1203.14	1204.328	7557.5	4	4.275	44.4	1	R.WLKVQRDDSG.S
*	Jamie_Alpha_SPB_43.15278.15278.2	1.7184	0.0746	10.1	1591.7522	1588.8102	5663.4	427	3.774	38.5	1	R.THGELIFKVVCDGL.S
Reverse_YKR021W	3	3	7.9%	915	102540	6.0	U	YKR021W SGDID:S000001729, Chr XI from 478877-481624, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" 
*	Jamie_Alpha_SPB_51.18328.18328.2	2.0239	0.1313	27.9	1816.3722	1816.983	6698.3	495	3.6	32.1	1	H.NKSVEWDFKSDSSMR.P
*	Jamie_Alpha_SPB_71.25597.25597.2	1.9422	0.1289	12.4	1847.6921	1846.8151	6712.2	273	3.734	34.4	1	L.KFNFGSAIDGDNDDEDS.L
*	Jamie_Alpha_SPB_63.22477.22477.4	2.3454	0.2006	13.8	4390.4966	4387.7114	8055.0	23	3.768	15.0	1	S.SLSNREYADLSLNSNDKPPEATPPIYVSAGSKELLYDEDS.M
YMR078C	3	3	7.8%	741	84373	8.3	U	CTF18 SGDID:S000004683, Chr XIII from 424727-422502, reverse complement, Verified ORF, "Subunit of a complex with Ctf8p that shares some subunits with Replication Factor C and is required for sister chromatid cohesion; may have overlapping functions with Rad24p in the DNA damage replication checkpoint" 
*	Jamie_Alpha_SPB_29.10274.10274.2	1.3672	0.1912	32.1	2890.5522	2889.4265	7788.5	128	4.011	20.8	1	I.RILVDIMQSDIKATNKLLYGQPDKK.D
*	Jamie_Alpha_SPB_34.12042.12042.4	2.507	0.0141	42.1	2010.2565	2004.3402	3484.6	147	3.061	29.2	1	K.ATNKLLYGQPDKKDKKR.K
*	Jamie_Alpha_SPB_44.15658.15658.3	2.4759	0.1933	14.5	3462.5645	3458.7808	9441.4	59	3.956	17.9	1	Q.ADDCNQTVKIWVKYNEGFSNAVRKNVTWN.N
YOL156W	2	2	7.8%	567	62733	8.5	U	HXT11 SGDID:S000005516, Chr XV from 25272-26975, Verified ORF, "Putative hexose transporter that is nearly identical to Hxt9p, has similarity to major facilitator superfamily (MFS) transporters and is involved in pleiotropic drug resistance" 
*	Jamie_Alpha_SPB_44.15756.15756.2	1.4702	0.2014	95.2	2732.0122	2729.3403	8293.4	2	4.256	26.9	1	R.IISGLGVGGIAVLSPMLISEVAPKHIR.G
	Jamie_Alpha_SPB_28.10102.10102.3	1.9625	0.0247	30.3	1962.0243	1966.242	6108.4	5	2.618	34.4	1	R.YLIEVGKDEEAKRSLSK.S
YBR030W	2	2	7.8%	552	62594	4.7	U	YBR030W SGDID:S000000234, Chr II from 298292-299950, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_71.25333.25333.2	1.2046	0.1436	11.0	2682.6921	2681.075	10778.1	161	3.39	22.5	1	Y.ETTVFRNSSHWYPFLRTIRIR.D
*	Jamie_Alpha_SPB_45.16114.16114.3	2.812	0.1833	16.3	2341.0144	2343.6416	4846.5	5	3.7	33.3	1	S.SGEPSPSTWALANLLTLTAVQW.E
Reverse_YBR248C	2	2	7.8%	552	61068	5.5	U	HIS7 SGDID:S000000452, Chr II from 716460-714802, reverse complement, Verified ORF, "Imidazole glycerol phosphate synthase (glutamine amidotransferase:cyclase), catalyzes the fifth and sixth steps of histidine biosynthesis and also produces 5-aminoimidazole-4-carboxamide ribotide (AICAR), a purine precursor" 
*	Jamie_Alpha_SPB_82.29433.29433.2	1.9299	0.1457	36.6	1446.8322	1447.6056	4599.9	13	3.601	50.0	1	R.RTLGYNSYDNML.L
*	Jamie_Alpha_SPB_67.23857.23857.3	1.5517	0.0121	23.6	3312.7444	3314.8306	7558.5	436	2.756	15.8	1	K.FDIYNLGTSKPSEVSGAFLAQLGVCIGMIPK.G
Reverse_YOR091W	2	2	7.8%	345	39514	9.3	U	YOR091W SGDID:S000005617, Chr XV from 493433-494470, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_62.22138.22138.2	1.3429	0.0602	69.8	2336.6921	2338.6526	8846.2	61	3.117	27.8	1	K.QENTKLVFGEPLSHRYMCK.D
*	Jamie_Alpha_SPB_21.07262.07262.2	1.806	0.032	10.0	889.39215	888.953	2750.6	28	3.333	71.4	1	K.KPDSQSQV.Q
YLL018C	2	2	7.7%	557	63516	6.6	U	DPS1 SGDID:S000003941, Chr XII from 111574-109901, reverse complement, Verified ORF, "Cytoplasmic aspartyl-tRNA synthetase, homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation" 
*	Jamie_Alpha_SPB_118.42388.42388.3	2.2904	0.0217	36.9	2574.0544	2571.0527	7386.5	26	2.826	27.5	1	K.QYPVEEFKLPKDGKMVRLTYK.E
*	Jamie_Alpha_SPB_32.11474.11474.2	3.6101	0.3799	100.0	2399.3123	2399.6165	6529.3	1	7.248	40.5	1	R.AAGKEIGDFEDLSTENEKFLGK.L
Reverse_YDR326C	2	2	7.6%	1438	160578	7.5	U	YDR326C SGDID:S000002734, Chr IV from 1124918-1120602, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_1.00253.00253.3	1.0628	0.2271	67.3	5063.8745	5067.824	3496.5	50	4.276	5.7	1	K.KIESIMIKTTDAVGDFTGKEIMSKIWSKGTWDVSNYVTLKTSNNK.D
*	Jamie_Alpha_SPB_74.26587.26587.4	2.6018	0.036	45.6	6917.0566	6922.734	9173.8	329	2.929	9.5	1	K.GLDNSENFVDADIDDSSTMDTSNIDPDDDDLDGDDDNDDSDDFFASSSDSITGDDNNGFGNRYK.K
YNL054W	4	4	7.6%	1165	128140	6.0	U	VAC7 SGDID:S000004999, Chr XIV from 526087-529584, Verified ORF, "Integral vacuolar membrane protein involved in vacuole inheritance and morphology; may function to regulate Fab1p kinase activity" 
*	Jamie_Alpha_SPB_36.12874.12874.2	2.2392	0.3111	83.3	1740.6721	1743.0746	8055.8	1	4.809	40.0	1	S.KKKPAVISNNMPTSNI.A
*	Jamie_Alpha_SPB_36.12952.12952.3	3.2332	0.1524	13.4	2401.3145	2398.808	5750.4	427	3.903	25.0	1	I.GSNTPPAPLLPLPSLSQQNKPKI.I
*	Jamie_Alpha_SPB_64.23024.23024.2	1.3329	0.1589	21.5	2915.7922	2917.428	5168.0	14	3.925	22.0	1	Q.QQNHGITSKISAPLLNNNKKLLSRLK.N
*	Jamie_Alpha_SPB_54.19177.19177.4	3.2004	0.1762	16.3	2632.3364	2626.792	5056.2	2	3.61	27.5	1	I.MNGSIHMNGNDDVTHSNINNNDIV.G
YPL221W	2	2	7.6%	793	89291	8.0	U	YPL221W SGDID:S000006142, Chr XVI from 133042-135423, Uncharacterized ORF, "Protein involved in outer chain mannosylation, overexpression stimulates uptake of hemin" 
*	Jamie_Alpha_SPB_31.11097.11097.2	1.7975	0.0832	19.3	1813.9321	1814.0142	8159.2	137	3.537	33.3	1	N.VSENLACIQVFFSNGK.T
*	Jamie_Alpha_SPB_62.22176.22176.4	2.6568	0.1878	12.2	4762.5767	4763.108	6474.2	1	3.742	15.5	1	K.LGSFKRSAPDKITQQEVSPDRASSSPNSKSYPGVSHTRQESEAN.N
YAL005C	4	4	7.6%	642	69768	5.1	U	SSA1 SGDID:S000000004, Chr I from 141433-139505, reverse complement, Verified ORF, "ATPase involved in protein folding and nuclear localization signal (NLS)-directed nuclear transport; member of heat shock protein 70 (HSP70) family; forms a chaperone complex with Ydj1p; localized to the nucleus, cytoplasm, and cell wall" 
YLL024C	4	4	7.7%	639	69470	5.1	U	SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" 
	Jamie_Alpha_SPB_15.05358.05358.2	2.1745	0.1566	98.2	1677.4722	1676.6964	5051.9	1	4.066	53.3	1	K.ATAGDTHLGGEDFDNR.L
	Jamie_Alpha_SPB_14.05055.05055.2	3.3353	0.3562	100.0	1505.2322	1504.5126	5409.1	1	6.666	61.5	1	T.AGDTHLGGEDFDNR.L
	Jamie_Alpha_SPB_19.06667.06667.4	2.8108	0.0052	42.9	2184.7766	2184.3826	3991.2	98	3.213	29.4	1	K.MVAEAEKFKEEDEKESQR.I
	Jamie_Alpha_SPB_17.06144.06144.2	4.3317	0.3253	100.0	1618.8922	1619.7258	6484.0	1	7.3	67.9	1	K.NTISEAGDKLEQADK.D
Reverse_YPL072W	2	2	7.6%	499	56920	9.1	U	UBP16 SGDID:S000005993, Chr XVI from 418509-420008, Verified ORF, "Putative ubiquitin-specific protease" 
*	Jamie_Alpha_SPB_21.07411.07411.2	1.6218	0.1645	31.6	1496.9122	1498.8093	5357.1	1	3.655	50.0	1	K.KIVKGKINSVQLNG.K
*	Jamie_Alpha_SPB_91.32604.32604.3	2.8661	0.2002	14.4	2677.2844	2678.8784	5143.2	5	4.29	27.2	1	T.LSEHLPALSNSSNELRSHRTTNDV.T
Reverse_YIL094C	2	2	7.5%	371	40069	8.0	U	LYS12 SGDID:S000001356, Chr IX from 187629-186514, reverse complement, Verified ORF, "Homo-isocitrate dehydrogenase, an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine, in which homo-isocitrate is oxidatively decarboxylated to alpha-ketoadipate" 
*	Jamie_Alpha_SPB_80.28665.28665.2	1.6856	0.1777	95.5	1942.7722	1942.1796	7025.1	47	3.92	30.6	1	K.GGLDPTKISGERLNADVAK.Y
*	Jamie_Alpha_SPB_109.38985.38985.1	1.4254	0.0143	10.6	961.45	962.091	5388.9	102	2.809	50.0	1	P.KGKEGEVSK.V
Reverse_YBR037C	2	2	7.5%	295	33166	9.1	U	SCO1 SGDID:S000000241, Chr II from 311451-310564, reverse complement, Verified ORF, "Copper-binding protein of the mitochondrial inner membrane, required for cytochrome c oxidase activity and respiration; may function to deliver copper to cytochrome c oxidase; has similarity to thioredoxins" 
*	Jamie_Alpha_SPB_52.18444.18444.2	1.4986	0.1224	17.1	2013.4922	2012.2784	4467.3	21	4.097	34.4	1	K.GNSQWLRTVTFFGRQTL.L
*	Jamie_Alpha_SPB_65.23282.23282.2	1.9657	0.2107	70.8	1653.2722	1653.9218	5607.4	449	4.655	32.1	1	R.TVTFFGRQTLLKAGN.G
Reverse_YJL095W	4	4	7.4%	1478	164195	9.5	U	BCK1 SGDID:S000003631, Chr X from 247171-251607, Verified ORF, "Mitogen-activated protein (MAP) kinase kinase kinase acting in the protein kinase C signaling pathway, which controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p" 
*	Jamie_Alpha_SPB_119.42878.42878.4	1.613	0.229	10.0	5306.6963	5308.0303	4764.2	79	4.513	6.7	1	W.FVTGRMTMDSNSYIDKSKRSIGFDSIKCIGDQDLLLNDAKMDRHLI.G
*	Jamie_Alpha_SPB_75.26763.26763.3	2.412	0.0264	40.2	2403.7444	2402.664	6186.1	206	2.67	25.0	1	R.SPTSPETRSSAVNKPSLLSDLSK.P
*	Jamie_Alpha_SPB_89.31830.31830.2	1.7745	0.0283	75.4	2106.3323	2103.4697	7054.8	1	3.551	36.1	1	K.LPVNNESTLPAPKPKQQLK.M
*	Jamie_Alpha_SPB_107.38488.38488.2	1.5193	0.0873	10.1	2504.392	2504.7192	7601.8	29	3.586	26.2	1	V.TKDPNICDPYTEKFSATTSSIK.P
Reverse_YNL250W	5	5	7.4%	1312	152568	6.1	U	RAD50 SGDID:S000005194, Chr XIV from 175411-179349, Verified ORF, "Subunit of MRX complex, with Mre11p and Xrs2p, involved in processing double-strand DNA breaks in vegetative cells, initiation of meiotic DSBs, telomere maintenance, and nonhomologous end joining" 
*	Jamie_Alpha_SPB_73.26156.26156.2	1.315	0.2133	31.8	1981.2522	1984.239	6899.3	1	4.231	40.6	1	K.FFHDTFAAANMHGLFKE.D
*	Jamie_Alpha_SPB_94.33702.33702.4	2.4158	0.0207	37.6	4336.2563	4339.834	5895.2	9	2.89	18.1	1	K.TKLEQLLKSKFSENEFKRSCLYCCSDREAIELAKR.N
*	Jamie_Alpha_SPB_55.19711.19711.3	2.4741	0.203	13.1	3046.1943	3043.534	7492.6	63	3.977	21.2	1	L.VKSFNALLNQLDPKSLDLIDISNSLRK.V
*	Jamie_Alpha_SPB_9.03048.03048.1	1.0849	0.0071	76.1	866.88	866.90594	4125.3	162	2.302	50.0	1	K.QFDQNSK.F
*	Jamie_Alpha_SPB_58.20881.20881.2	1.7017	0.0503	10.5	1327.5922	1324.6274	4408.5	112	3.281	50.0	1	T.QLQHINLKMAK.S
YML075C	3	3	7.4%	1054	115625	8.0	U	HMG1 SGDID:S000004540, Chr XIII from 118898-115734, reverse complement, Verified ORF, "One of two isozymes of HMG-CoA reductase that catalyzes the conversion of HMG-CoA to mevalonate, which is a rate-limiting step in sterol biosynthesis; localizes to the nuclear envelope; overproduction induces the formation of karmellae" 
*	Jamie_Alpha_SPB_78.27949.27949.2	1.9621	0.1336	12.8	2405.372	2402.841	5671.2	5	5.249	30.0	1	S.ENVTQADPFDVLIMVTAYLMM.F
*	Jamie_Alpha_SPB_20.07184.07184.2	1.7302	0.1586	28.5	2065.0723	2065.5627	4179.9	29	3.474	33.3	1	K.KSVSSFLNLSVVVIIMKLS.V
*	Jamie_Alpha_SPB_59.21008.21008.3	2.6704	0.2172	29.8	4190.994	4191.8677	7134.7	50	4.43	16.9	1	L.VLSALVCSAVINVYLLNAARIHTSYTADQLVKTEVTKK.S
Reverse_YER157W	3	3	7.4%	801	92544	5.5	U	COG3 SGDID:S000000959, Chr V from 484783-487188, Verified ORF, "Essential component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking to mediate fusion of transport vesicles to Golgi compartments" 
*	Jamie_Alpha_SPB_14.04910.04910.2	2.0214	0.0031	82.7	1132.8922	1133.2468	2862.4	2	3.001	66.7	1	-.KTITDIDGNR.L
*	Jamie_Alpha_SPB_31.10862.10862.3	2.0023	0.0083	26.1	3661.6443	3657.801	6163.6	144	2.79	16.9	1	K.VDASTTAESGNVESCGESVDTRQLSDSNEVALSLK.K
*	Jamie_Alpha_SPB_77.27624.27624.2	1.5161	0.1949	28.6	1553.2922	1551.7861	3468.5	361	3.43	42.3	1	P.ITPHSAIDRVLSNK.R
YLR397C	2	2	7.4%	780	84748	5.7	U	AFG2 SGDID:S000004389, Chr XII from 914892-912550, reverse complement, Verified ORF, "ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a hexameric complex; may be involved in degradation of aberrant mRNAs" 
*	Jamie_Alpha_SPB_15.05350.05350.4	3.2679	0.1584	11.9	3736.7366	3742.374	6704.9	53	3.784	18.6	1	K.SAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTM.L
*	Jamie_Alpha_SPB_69.24634.24634.3	2.7716	0.1514	10.6	2149.2844	2147.5964	4903.5	36	3.48	31.0	1	A.TLLTLMDGMGAAGKVVVIAATN.R
YKR078W	2	2	7.4%	585	68282	6.2	U	YKR078W SGDID:S000001786, Chr XI from 584594-586351, Uncharacterized ORF, "Cytoplasmic protein of unknown function, has similarity to Vps5p; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_69.24632.24632.4	2.432	0.0122	33.6	3833.0166	3836.4817	8563.2	378	2.68	18.4	1	K.FQTDLAIDNRLLEKDPKYKKLFTEKRRRRR.P
*	Jamie_Alpha_SPB_40.14226.14226.2	1.6253	0.0188	72.3	1606.6522	1606.8625	6558.3	9	2.941	50.0	1	K.IRTAEDEYRIVLK.R
Reverse_YGR059W	2	2	7.4%	512	59845	7.4	U	SPR3 SGDID:S000003291, Chr VII from 607567-609105, Verified ORF, "Sporulation-specific homolog of the yeast CDC3/10/11/12 family of bud neck microfilament genes; septin protein involved in sporulation; regulated by ABFI" 
*	Jamie_Alpha_SPB_49.17568.17568.2	2.1934	0.064	25.3	2523.7122	2523.0347	4239.6	41	4.087	26.2	1	F.NKLEEKTLLDSKAIVPILNVRK.A
*	Jamie_Alpha_SPB_33.11836.11836.4	2.7997	0.1921	12.9	1892.8165	1891.1434	3276.4	378	4.037	28.9	1	F.SSSRQRRHKLEPSKPP.H
YBR127C	3	3	7.4%	517	57749	5.1	U	VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" 
*	Jamie_Alpha_SPB_27.09764.09764.3	2.9272	0.0779	67.4	2803.9143	2801.8071	4445.5	1	3.477	28.4	1	K.ILDEFYDRARDDADEDEEDPDTR.S
*	Jamie_Alpha_SPB_26.09296.09296.3	4.09	0.3436	100.0	3160.3442	3161.1895	6516.8	1	5.893	29.8	1	K.ILDEFYDRARDDADEDEEDPDTRSSGK.K
*	Jamie_Alpha_SPB_37.13130.13130.3	3.0816	0.2709	100.0	4388.844	4390.542	8210.1	3	5.808	16.9	1	K.ILDEFYDRARDDADEDEEDPDTRSSGKKKDASQEESLI.-
YMR212C	3	3	7.3%	782	89190	7.5	U	EFR3 SGDID:S000004825, Chr XIII from 693042-690694, reverse complement, Verified ORF, "Non-essential protein of unknown function; exhibits synthetic lethal genetic interactions with PHO85; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" 
*	Jamie_Alpha_SPB_16.05811.05811.2	1.3696	0.0521	69.2	2064.0322	2061.386	8185.7	16	2.99	33.3	1	R.NPKFKTLSLEAALESNLGK.R
*	Jamie_Alpha_SPB_77.27606.27606.2	2.0104	0.1295	13.2	1455.1522	1457.8584	5574.3	64	3.568	45.8	1	S.IVGLSVLDIMRKL.L
*	Jamie_Alpha_SPB_58.20916.20916.3	2.4317	0.0498	46.9	2795.3643	2798.1716	8129.6	82	2.775	22.9	1	R.DGSFRGSQSVKSRVTNITFLLNELK.T
YDL138W	2	2	7.3%	763	83159	6.0	U	RGT2 SGDID:S000002297, Chr IV from 213352-215643, Verified ORF, "Plasma membrane glucose receptor, highly similar to Snf3p; both Rgt2p and Snf3p serve as transmembrane glucose sensors generating an intracellular signal that induces expression of glucose transporter (HXT) genes" 
*	Jamie_Alpha_SPB_27.09716.09716.3	3.0158	0.1824	16.6	2717.6943	2716.252	8102.1	392	3.771	21.9	1	I.ETTSILLSQPLPLRSNVMSVLVGIF.V
*	Jamie_Alpha_SPB_28.10088.10088.4	3.0255	0.1724	16.6	3326.6965	3331.9905	6978.4	213	3.889	19.4	1	A.IVGVSEGKTVVASKIMIAFICLFIAAFSATW.G
Reverse_YPL005W	2	2	7.3%	606	70310	9.7	U	AEP3 SGDID:S000005926, Chr XVI from 548483-550303, Verified ORF, "Peripheral mitochondrial inner membrane protein, located on the matrix face of the membrane; stabilizes the bicistronic AAP1-ATP6 mRNA encoding subunits 6 and 8 of the ATP synthase complex" 
*	Jamie_Alpha_SPB_99.35566.35566.2	1.5233	0.1895	11.4	2386.0723	2385.8328	6654.5	1	4.583	35.0	1	I.YQLVAGFNKTNGNRVLAKFLM.E
*	Jamie_Alpha_SPB_62.22074.22074.3	2.5456	0.0095	37.3	2632.8245	2637.1125	5931.0	24	2.882	26.1	1	R.LLLNFTITNPKTGEAKMQAFIER.C
YCL008C	2	2	7.3%	385	43330	5.7	U	STP22 SGDID:S000000514, Chr III from 106852-105695, reverse complement, Verified ORF, "Component of the ESCRT-I complex, which is involved in ubiquitin-dependent sorting of proteins into the endosome; homologous to the mouse and human Tsg101 tumor susceptibility gene; mutants exhibit a Class E Vps phenotype" 
*	Jamie_Alpha_SPB_57.20322.20322.2	1.4388	0.1127	11.2	2049.0322	2049.3342	8201.4	1	3.915	41.2	1	R.TRVFTHSDGTPQLLLSIY.G
*	Jamie_Alpha_SPB_52.18572.18572.2	1.512	0.1712	11.2	1318.2122	1316.3666	4949.6	249	3.48	44.4	1	V.NELYREDVDY.V
YJL213W	2	2	7.3%	331	35905	7.0	U	YJL213W SGDID:S000003749, Chr X from 32163-33158, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_71.25573.25573.2	1.7491	0.1727	11.0	1655.6322	1654.74	6298.2	16	3.878	36.7	1	G.DLRSGALPASAFDSCS.C
*	Jamie_Alpha_SPB_106.38179.38179.1	1.1509	0.0958	27.8	774.3	774.8491	2888.9	48	3.144	50.0	1	G.GVASPTDK.I
Reverse_YLR371W	4	4	7.2%	1356	152596	9.2	U	ROM2 SGDID:S000004363, Chr XII from 862713-866783, Verified ORF, "GDP/GTP exchange protein (GEP) for Rho1p and Rho2p; mutations are synthetically lethal with mutations in rom1, which also encodes a GEP" 
*	Jamie_Alpha_SPB_13.04532.04532.4	2.4881	0.0326	43.1	2723.4165	2727.0957	5379.0	3	3.46	28.8	1	R.SLIGEHKIKRREDNLGLNVYENK.F
*	Jamie_Alpha_SPB_16.05725.05725.4	2.7425	0.1861	13.2	4650.8965	4652.134	6243.7	326	4.18	14.6	1	R.DQAAGSAQDIRKMFDRLADMAKSLDEYDSKDKEPDTSKMIE.K
*	Jamie_Alpha_SPB_58.20738.20738.2	1.8916	0.0482	11.6	1826.5521	1828.9797	7449.5	4	3.633	43.8	1	M.SSRRPSSLSTGSVSTYR.K
*	Jamie_Alpha_SPB_36.12944.12944.2	2.1919	0.1469	45.7	1776.4722	1777.8542	5852.4	50	3.392	37.5	1	K.MENNPIDSDDIAAEVGS.R
Reverse_YLL024C	2	2	7.2%	639	69470	5.1	U	SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" 
	Jamie_Alpha_SPB_59.21270.21270.2	1.476	0.1019	11.2	2497.8123	2496.78	7087.4	22	3.332	27.3	1	D.IGEFLSDIEVSTQASSSLTRKAR.E
*	Jamie_Alpha_SPB_118.42386.42386.2	1.3653	0.1007	80.1	2414.7522	2417.7454	6755.8	262	3.224	22.7	1	R.KADFVTNAPNMAAQNKAADGILR.E
YNL188W	2	2	7.2%	433	50653	9.3	U	KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" 
*	Jamie_Alpha_SPB_34.11948.11948.2	3.0076	0.2917	100.0	1805.0922	1805.936	7498.7	3	5.245	53.6	1	K.IDEDNIENELQFTPK.I
*	Jamie_Alpha_SPB_41.14528.14528.2	2.2907	0.0358	88.4	1849.2122	1848.101	6196.0	24	3.611	40.0	1	K.KLDTIIELLKDDTDSK.E
Reverse_YGL211W	2	2	7.2%	359	39987	8.8	U	NCS6 SGDID:S000003179, Chr VII from 92516-93595, Uncharacterized ORF, "Protein with a role in urmylation and in invasive and pseudohyphal growth; inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" 
*	Jamie_Alpha_SPB_115.41371.41371.1	1.4027	0.1353	31.6	914.97	915.9781	3067.4	17	3.552	58.3	1	I.EIGYDYR.D
*	Jamie_Alpha_SPB_43.15350.15350.3	2.2856	0.0124	32.7	2328.0544	2326.7234	6552.8	94	2.495	27.8	1	R.RILAKRSHCLECLQSVKVK.T
YLR257W	2	2	7.2%	321	35998	4.9	U	YLR257W SGDID:S000004247, Chr XII from 658828-659793, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_33.11797.11797.2	1.4804	0.0984	11.3	1415.7922	1413.4375	8263.0	488	3.133	34.6	1	K.YSSSGTPENITGEA.D
*	Jamie_Alpha_SPB_26.09193.09193.2	2.7662	0.3341	100.0	2514.392	2514.5293	10807.4	1	6.6	38.6	1	K.YSSSGTPENITGEADDEDEDIIR.N
YDR310C	3	3	7.1%	1062	118201	6.2	U	SUM1 SGDID:S000002718, Chr IV from 1084310-1081122, reverse complement, Verified ORF, "Transcriptional repressor required for repression of middle sporulation-specific genes during mitosis; regulated by the pachytene checkpoint; a dominant mutation acts as a suppressor of silencing defects of SIR2 mutations" 
*	Jamie_Alpha_SPB_35.12411.12411.4	3.0131	0.1653	13.2	5175.0566	5180.9043	6734.6	11	3.702	14.0	1	L.KVLSHNQSVLENKLDDVMKNQVNTDILVNNLNERLNKLSTMLQNT.S
*	Jamie_Alpha_SPB_107.38511.38511.1	1.1306	0.0619	14.8	1448.65	1449.622	6447.2	96	3.099	35.7	1	K.GSSMSPKPRSASISG.I
*	Jamie_Alpha_SPB_102.36493.36493.2	1.7373	0.1216	24.6	1547.6721	1549.7363	5093.8	57	3.952	39.3	1	K.VGIQSMLNSGEEAIT.K
YPR029C	2	2	7.1%	832	93624	5.5	U	APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport" 
*	Jamie_Alpha_SPB_105.37592.37592.2	1.7413	0.2225	64.9	2490.5923	2489.924	11739.2	1	4.276	33.3	1	L.RSFIKDVRGAKTLADERAIITK.Q
*	Jamie_Alpha_SPB_48.17188.17188.4	2.676	0.2528	12.3	4132.5767	4133.698	7068.6	63	4.983	16.7	1	I.LSSHSICTHGVLLGVTKIIQSILLIGLNRKKDEDEDE.D
Reverse_YPR024W	2	2	7.1%	747	81772	7.1	U	YME1 SGDID:S000006228, Chr XVI from 610478-612721, Verified ORF, "Subunit, with Mgr1p, of the mitochondrial inner membrane i-AAA protease complex, which is responsible for degradation of unfolded or misfolded mitochondrial gene products; mutation causes an elevated rate of mitochondrial turnover" 
*	Jamie_Alpha_SPB_58.20926.20926.4	2.9748	0.1411	84.2	3141.6165	3138.7185	6626.5	68	3.78	21.7	1	R.ALLTKGTGPPGTLLVGKPLKGGLSEYKTPDK.L
*	Jamie_Alpha_SPB_98.35131.35131.2	1.3731	0.1451	19.6	2518.4722	2516.856	10397.0	37	3.596	26.2	1	R.SVVYQPYNSQLLLKYFAAQADP.S
YPL020C	2	2	7.1%	621	72378	9.5	U	ULP1 SGDID:S000005941, Chr XVI from 514176-512311, reverse complement, Verified ORF, "Ubl (ubiquitin-like protein)-specific protease that cleaves Smt3p protein conjugates; specifically required for cell cycle progression; associates with nucleoporins and may interact with septin rings during telophase" 
*	Jamie_Alpha_SPB_49.17466.17466.2	1.2819	0.1529	14.3	1984.1721	1983.2773	8339.1	174	3.267	32.4	1	K.AGFIGGIRETLWNSGKYL.W
*	Jamie_Alpha_SPB_106.38023.38023.4	2.5152	0.1356	79.0	3148.5764	3148.5034	5879.5	342	3.313	22.0	1	K.NRLQTRNENDDDLVFVKEKKISSLER.K
YCL036W	2	2	7.1%	566	64913	8.6	U	GFD2 SGDID:S000000541, Chr III from 59026-60726, Uncharacterized ORF, "Protein of unknown function, identified as a high-copy suppressor of a dbp5 mutation" 
*	Jamie_Alpha_SPB_63.22538.22538.2	1.4209	0.1144	12.0	2501.9922	2499.7454	6914.7	281	3.515	23.8	1	P.VTEEDKTWSRAFVGHHVSGDLK.W
*	Jamie_Alpha_SPB_49.17374.17374.2	1.3331	0.1041	79.9	2062.7922	2065.256	9870.8	40	3.607	32.4	1	K.ERVCQTEFGGLTYFGTAK.D
YER019W	2	2	7.1%	477	53941	7.5	U	ISC1 SGDID:S000000821, Chr V from 192796-194229, Verified ORF, "Inositol phosphosphingolipid phospholipase C, hydrolyzes inositolphosphosphingolipids, activated by phosphatidylserine, cardiolipin, and phosphatidylglycerol, mediates Na+ and Li+ halotolerance, contains a P loop-like domain" 
*	Jamie_Alpha_SPB_91.32466.32466.2	1.985	0.0823	25.7	2308.9521	2307.6672	10525.5	50	3.93	28.6	1	R.AIADKLAGHSMLTPISDELLPN.G
*	Jamie_Alpha_SPB_22.07791.07791.2	2.8004	0.041	15.2	1396.8121	1395.5951	6665.4	2	3.071	63.6	1	D.YALIDPDFLQTV.D
YMR166C	2	2	7.1%	368	40992	9.2	U	YMR166C SGDID:S000004776, Chr XIII from 594472-593366, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_109.39082.39082.1	1.1	0.1468	11.4	1043.7	1045.1863	7659.0	219	3.783	42.9	1	I.WLEEGVRR.G
*	Jamie_Alpha_SPB_29.10296.10296.2	2.6544	0.0578	13.1	1954.0122	1954.1876	3586.4	184	3.346	38.2	1	A.LSNSISLSLRTVYQSEGV.L
YNL002C	2	2	7.1%	322	36559	9.5	U	RLP7 SGDID:S000004947, Chr XIV from 627144-626176, reverse complement, Verified ORF, "Nucleolar protein with similarity to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs" 
*	Jamie_Alpha_SPB_86.30868.30868.2	2.1109	0.1499	98.2	1571.6122	1571.7859	5827.9	26	4.184	45.5	1	R.KRRNADRTRIER.Q
*	Jamie_Alpha_SPB_114.40962.40962.1	1.1734	0.1029	21.7	1119.03	1119.1301	8411.8	401	3.68	40.0	1	K.ANGAEENSVDL.E
YOL006C	2	2	7.0%	769	89995	8.7	U	TOP1 SGDID:S000005366, Chr XV from 315387-313078, reverse complement, Verified ORF, "Topoisomerase I, nuclear enzyme that relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled DNA; functions in replication, transcription, and recombination" 
*	Jamie_Alpha_SPB_61.21664.21664.2	1.6229	0.0639	80.9	2965.9521	2964.5193	10842.8	4	3.772	24.1	1	K.IKTEPVQSSSLPSPPAKKSATSKPKKIK.K
*	Jamie_Alpha_SPB_51.18355.18355.3	1.9101	0.0047	24.8	3204.6543	3205.5486	7166.4	23	3.026	22.0	1	K.EPKYFEEIDDLTKEDEATIHKRIIDR.E
Reverse_YMR001C	2	2	7.0%	705	81031	9.0	U	CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" 
*	Jamie_Alpha_SPB_59.21248.21248.4	2.7306	0.2273	10.4	3055.1365	3053.4082	5680.9	47	3.975	21.6	1	Y.NPTGCITYKRESENALVAALGFDGIKLN.Y
*	Jamie_Alpha_SPB_73.26055.26055.2	1.5176	0.2127	96.2	2414.7922	2412.8914	10070.0	7	4.572	30.0	1	K.GRTKILSPPTKCLASLKERKK.K
Reverse_YOR317W	2	2	7.0%	700	77866	7.6	U	FAA1 SGDID:S000005844, Chr XV from 909338-911440, Verified ORF, "Long chain fatty acyl-CoA synthetase with a preference for C12:0-C16:0 fatty acids; involved in the activation of imported fatty acids; not required for growth on nonfermentable carbon sources; essential for stationary phase" 
*	Jamie_Alpha_SPB_55.19762.19762.2	1.6312	0.2828	82.2	2930.6921	2930.346	6588.7	2	4.453	25.0	1	Y.ENSRYVSELKELAIYEGNMTKVLNK.K
*	Jamie_Alpha_SPB_105.37654.37654.2	1.6104	0.1162	21.0	2579.132	2578.033	8258.8	23	3.933	26.1	1	R.SIPSGGNLLYRLQGGTATRIKKFV.L
Reverse_YDR295C	2	2	7.0%	674	77059	8.7	U	HDA2 SGDID:S000002703, Chr IV from 1054641-1052617, reverse complement, Verified ORF, "Subunit of a possibly tetrameric trichostatin A-sensitive class II histone deacetylase complex that contains an Hda1p homodimer and an Hda2p-Hda3p heterodimer; required for the activity of the complex; has similarity to Hda3p; Ploidy-related" 
*	Jamie_Alpha_SPB_62.22274.22274.4	2.8613	0.0252	46.3	2803.9766	2804.9004	5589.8	1	3.136	27.8	1	K.IEEYEQSDDVHGNNSLHSSKVSSNK.I
*	Jamie_Alpha_SPB_102.36501.36501.2	1.2986	0.1545	16.5	2550.0723	2548.8706	7239.1	125	3.59	23.8	1	R.DRFCISNILQNLVQFKHSGAIS.S
YDR425W	3	3	7.0%	625	70741	7.0	U	SNX41 SGDID:S000002833, Chr IV from 1320054-1321931, Verified ORF, "Sorting nexin, involved in the retrieval of late-Golgi SNAREs from the post-Golgi endosome to the trans-Golgi network; forms a complex with Snx4p and Atg20p" 
*	Jamie_Alpha_SPB_21.07458.07458.2	2.9397	0.1641	25.0	1923.2322	1924.1613	4705.2	15	4.693	46.9	1	I.TVKSHNEISNLPTEILQ.N
*	Jamie_Alpha_SPB_31.11080.11080.2	2.1596	0.2632	25.0	2037.2522	2038.2651	7449.8	11	4.684	35.3	1	I.TVKSHNEISNLPTEILQN.E
*	Jamie_Alpha_SPB_24.08410.08410.2	1.3556	0.1585	21.9	2715.9722	2713.8809	5984.5	20	3.482	22.0	1	K.KDVRSLSKSSSNSSSSGHQNEIHIGA.S
Reverse_YNL117W	2	2	7.0%	554	62791	7.2	U	MLS1 SGDID:S000005061, Chr XIV from 406360-408024, Verified ORF, "Malate synthase, enzyme of the glyoxylate cycle, involved in utilization of non-fermentable carbon sources; expression is subject to carbon catabolite repression; localizes in peroxisomes during growth in oleic acid medium" 
*	Jamie_Alpha_SPB_35.12423.12423.4	3.4043	0.2446	76.9	4317.3364	4323.0264	9569.9	13	4.562	16.7	1	L.VIFELADKTLIDGVTTSSPKFFPEKDVDVLLKVNDLSVK.V
*	Jamie_Alpha_SPB_67.24001.24001.3	1.7211	0.0319	25.3	2205.9243	2206.5872	5187.7	234	3.339	26.4	1	K.FFPEKDVDVLLKVNDLSVK.V
contaminant_KERATIN20	2	2	7.0%	483	53748	5.4	U	no description
*	Jamie_Alpha_SPB_66.23605.23605.4	3.0133	0.0899	73.5	2518.8564	2523.7244	4353.2	93	3.353	23.2	1	K.SYKVSTSGPRAFSSRSYTSGPGSR.I
	Jamie_Alpha_SPB_15.05442.05442.3	1.729	0.0095	26.2	1310.7244	1309.4215	6033.0	1	3.067	50.0	1	K.NKYEDEINKR.T
contaminant_KERATIN05	2	2	7.0%	471	51531	5.2	U	no description
	Jamie_Alpha_SPB_21.07568.07568.2	2.1971	0.1111	96.7	1380.6921	1380.5437	6393.5	13	4.491	55.0	1	K.TRLEQEIATYR.R
*	Jamie_Alpha_SPB_19.06598.06598.2	2.4297	0.1664	99.5	2309.7522	2310.396	8202.8	1	4.378	40.5	1	R.LLEGEDAHLSSSQFSSGSQSSR.D
contaminant_KERATIN08	2	2	7.0%	469	50499	5.0	U	no description
	Jamie_Alpha_SPB_21.07568.07568.2	2.1971	0.1111	96.7	1380.6921	1380.5437	6393.5	13	4.491	55.0	1	K.TRLEQEIATYR.R
*	Jamie_Alpha_SPB_16.05583.05583.2	1.9264	0.0575	86.2	2351.412	2351.4485	7608.1	16	3.616	26.2	1	R.LLEGEDAHLSSQQASGQSYSSR.E
YKR095W	6	6	6.9%	1875	218454	5.2	U	MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" 
*	Jamie_Alpha_SPB_16.05798.05798.2	2.7342	0.1879	99.4	2191.5122	2191.3599	7514.4	1	4.963	44.1	1	R.KLDDLTEEKKETQSNQQR.T
*	Jamie_Alpha_SPB_15.05204.05204.2	3.261	0.2945	100.0	1838.9722	1838.8334	6360.1	1	5.787	50.0	1	S.SITDEADEDNENLSAKS.S
*	Jamie_Alpha_SPB_37.13107.13107.4	2.8401	0.0099	41.7	3413.3364	3410.6729	6341.0	15	2.412	20.2	1	K.DLYETTSQSLQQTNSKLDESFKDFTNQIK.N
*	Jamie_Alpha_SPB_33.11664.11664.2	2.6888	0.1337	99.5	1817.0322	1817.9879	5389.3	4	4.014	46.4	1	K.LESEIENLKEELENK.E
*	Jamie_Alpha_SPB_90.32324.32324.2	1.4985	0.2025	13.4	2697.2122	2698.005	7229.1	23	4.158	22.0	1	D.PPTHLEPSFNIPASRGLISSSSTLST.D
*	Jamie_Alpha_SPB_22.07879.07879.4	3.8605	0.2129	97.2	2891.1365	2890.0442	10434.2	1	5.778	29.2	1	K.RPIDEVGELKNDEDDTTENINESKK.I
YPL019C	2	2	6.9%	835	96553	7.4	U	VTC3 SGDID:S000005940, Chr XVI from 517016-514509, reverse complement, Verified ORF, "Vacuolar membrane protein involved in vacuolar polyphosphate accumulation; functions as a regulator of vacuolar H+-ATPase activity and vacuolar transporter chaperones; involved in non-autophagic vacuolar fusion" 
*	Jamie_Alpha_SPB_72.25962.25962.4	2.4769	0.2402	11.1	4037.8164	4041.3777	8183.1	268	4.55	15.3	1	E.ARLNIGSKSNSLSSDGNSNQDVEIGKSKSVIFPQSYDP.T
*	Jamie_Alpha_SPB_15.05228.05228.3	2.1879	0.0279	37.9	2224.7644	2223.5002	5215.6	36	3.113	27.6	1	K.EAARRERGLVNVSSQPSLPR.T
YJR015W	2	2	6.9%	510	58117	7.1	U	YJR015W SGDID:S000003776, Chr X from 462635-464167, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_50.17971.17971.3	3.0749	0.3102	50.0	2717.0942	2712.9756	8504.1	1	4.822	28.3	1	L.INDTAPLFNSTLFNQVVYETGRDP.T
*	Jamie_Alpha_SPB_59.21010.21010.2	1.2839	0.0163	63.9	1201.4122	1198.5381	4962.2	204	2.726	50.0	1	R.KLKQKALVAAK.Q
Reverse_YLR215C	2	2	6.9%	360	41852	4.8	U	CDC123 SGDID:S000004205, Chr XII from 571860-570778, reverse complement, Verified ORF, "Protein involved in nutritional control of the cell cycle; regulates abundance of the translation initiation factor eIF2; ortholog of human D123 protein" 
*	Jamie_Alpha_SPB_17.06135.06135.2	1.7409	0.1603	12.7	2093.392	2095.4863	4675.7	16	3.625	32.4	1	P.IYVDLVFSKDPFKPLVVD.H
*	Jamie_Alpha_SPB_111.39861.39861.1	1.1668	0.0451	12.5	785.62	785.0177	3890.4	307	2.821	50.0	1	K.KPLSKLV.I
Reverse_YLR420W	2	2	6.9%	364	40313	6.5	U	URA4 SGDID:S000004412, Chr XII from 963781-964875, Verified ORF, "Dihydroorotase, catalyzes the third enzymatic step in the de novo biosynthesis of pyrimidines, converting carbamoyl-L-aspartate into dihydroorotate" 
*	Jamie_Alpha_SPB_95.34174.34174.2	1.3201	0.19	26.7	2600.4922	2600.9	13621.8	492	4.06	20.5	1	K.KDNPLKAVPKCFNVPNGAWDDIT.L
*	Jamie_Alpha_SPB_84.30270.30270.3	2.8138	0.1727	12.1	2164.5544	2165.4192	5089.0	354	4.143	29.2	1	K.AVPKCFNVPNGAWDDITLF.L
YHR014W	2	2	6.9%	291	33295	9.6	U	SPO13 SGDID:S000001056, Chr VIII from 132040-132915, Verified ORF, "Meiosis-specific protein, involved in maintaining sister chromatid cohesion during meiosis I as well as promoting proper attachment of kinetochores to the spindle during meiosis I and meiosis II" 
*	Jamie_Alpha_SPB_94.33784.33784.2	2.1575	0.0973	94.5	1339.1322	1338.5497	4867.4	28	3.802	54.5	1	R.LLELGSPTHSKR.K
*	Jamie_Alpha_SPB_37.13308.13308.2	1.3481	0.1165	10.8	890.15216	888.0692	2666.0	71	2.955	64.3	1	R.EAPMFPVP.Y
Reverse_YGL006W	3	3	6.8%	1173	130861	7.4	U	PMC1 SGDID:S000002974, Chr VII from 485925-489446, Verified ORF, "Vacuolar Ca2+ ATPase involved in depleting cytosol of Ca2+ ions; prevents growth inhibition by activation of calcineurin in the presence of elevated concentrations of calcium" 
*	Jamie_Alpha_SPB_35.12555.12555.4	3.4621	0.2275	24.1	4573.8164	4574.133	7427.4	7	4.713	16.7	1	F.YYNRGLDQFFNLNAASIRGRWNSIGDGEDLKRSVLMTFF.Q
*	Jamie_Alpha_SPB_88.31434.31434.2	1.6469	0.0616	10.3	1545.0721	1542.824	5081.4	280	3.65	40.9	1	F.FRYFPKKNKGEK.Y
*	Jamie_Alpha_SPB_118.42316.42316.4	3.1002	0.1822	14.8	3459.9766	3465.1697	8134.7	154	3.788	20.2	1	V.LVHHISILIEQDNRIVIIKRNEKKKNLKA.F
Reverse_YDR138W	2	2	6.8%	752	87829	5.3	U	HPR1 SGDID:S000002545, Chr IV from 730573-732831, Verified ORF, "Subunit of THO/TREX, related complexes that couple transcription elongation with mitotic recombination and elongation with mRNA metabolism and export, subunit of an RNA Pol II complex; regulates lifespan; similar to Top1p" 
*	Jamie_Alpha_SPB_32.11403.11403.4	3.7479	0.1372	14.8	3610.3765	3611.7656	6434.3	478	3.394	17.2	1	Q.ATTNQPAFEGAVGSDPDQSSVESSKIKTNEESIEG.K
*	Jamie_Alpha_SPB_26.09362.09362.2	2.7681	0.0599	27.2	2068.652	2069.5015	5680.3	174	3.12	33.3	1	Q.LKKRHEQNIKYLLKEK.F
Reverse_YJL105W	2	2	6.8%	560	63856	8.7	U	SET4 SGDID:S000003641, Chr X from 224972-226654, Verified ORF, "Protein of unknown function, contains a SET domain" 
*	Jamie_Alpha_SPB_61.21698.21698.2	1.6164	0.1878	32.8	1574.6721	1571.8632	6895.7	32	3.678	45.8	1	L.FHSSVVLKEQRLK.K
*	Jamie_Alpha_SPB_37.13023.13023.2	1.4439	0.1414	21.5	3070.0923	3069.4812	5529.0	23	4.328	25.0	1	K.RPFIMPKVQNVQVKTDSDCRKCVFD.R
Reverse_YNR051C	2	2	6.8%	515	57674	9.1	U	BRE5 SGDID:S000005334, Chr XIV from 718329-716782, reverse complement, Verified ORF, "Ubiquitin protease cofactor, forms deubiquitination complex with Ubp3p that coregulates anterograde and retrograde transport between the endoplasmic reticulum and Golgi compartments; null is sensitive to brefeldin A" 
*	Jamie_Alpha_SPB_79.28269.28269.3	2.4105	0.0944	60.4	3073.3743	3075.4817	7143.9	261	3.223	19.0	1	R.IYEVTTNNKSIRDSNENMLKSAWTMK.P
*	Jamie_Alpha_SPB_21.07447.07447.2	1.927	0.019	11.9	987.2922	986.19977	3535.0	224	2.743	56.2	1	G.EKTKIPAAK.K
Reverse_YFL029C	2	2	6.8%	368	42186	5.9	U	CAK1 SGDID:S000001865, Chr VI from 79159-78053, reverse complement, Verified ORF, "Cyclin-dependent kinase-activating kinase required for passage through the cell cycle, phosphorylates and activates Cdc28p; nucleotide-binding pocket differs significantly from those of most other protein kinases" 
*	Jamie_Alpha_SPB_33.11851.11851.2	1.654	0.1613	11.2	1671.5122	1672.876	6125.6	24	3.411	38.5	1	N.REVISIQVDKEQDL.V
*	Jamie_Alpha_SPB_117.41994.41994.2	1.8225	0.1032	25.9	1543.5122	1541.7858	7912.5	403	3.574	50.0	1	R.RDRKYHMQMFE.Y
YGL092W	4	4	6.7%	1317	145661	5.7	U	NUP145 SGDID:S000003060, Chr VII from 337909-341862, Verified ORF, "Essential nucleoporin, catalyzes its own cleavage in vivo to generate a C-terminal fragment that assembles into the Nup84p subcomplex of the nuclear pore complex, and an N-terminal fragment of unknown function that is homologous to Nup100p" 
*	Jamie_Alpha_SPB_82.29542.29542.2	1.6431	0.1503	11.4	1414.4922	1415.5431	5540.8	169	4.12	35.7	1	F.SSSVSGNAPLPLASQ.S
*	Jamie_Alpha_SPB_69.24724.24724.4	3.1827	0.2451	20.5	5108.4966	5109.2725	7625.4	101	4.702	14.0	1	Q.DSSENEPIANADSVTNIDRKENRDNNLDNTYLNGKEQSNNLNKQD.G
*	Jamie_Alpha_SPB_47.16736.16736.2	1.7105	0.1484	94.8	1963.4722	1963.1545	8671.7	89	3.677	30.0	1	K.TLREILNEFPDSERDK.W
*	Jamie_Alpha_SPB_90.32263.32263.2	1.701	0.1273	29.2	1388.1921	1385.6493	5347.7	70	3.497	45.5	1	E.LPLGQPEKAYLR.G
Reverse_YIR023W	2	2	6.7%	970	109174	8.0	U	DAL81 SGDID:S000001462, Chr IX from 399774-402686, Verified ORF, "Positive regulator of genes in multiple nitrogen degradation pathways; contains DNA binding domain but does not appear to bind the dodecanucleotide sequence present in the promoter region of many genes involved in allantoin catabolism" 
*	Jamie_Alpha_SPB_91.32815.32815.4	2.0977	0.0873	52.5	5267.5366	5270.532	8775.1	141	3.402	12.4	1	R.TNITVNKDDNMKITQNGTASTEQNSNPNDDKLETSSEENATRERGATK.E
*	Jamie_Alpha_SPB_73.26253.26253.3	2.3165	0.0549	50.6	1946.2444	1950.4594	5102.7	4	3.115	37.5	1	R.LKLQLPKALKLVQEISK.N
YOR038C	2	2	6.7%	875	98445	8.3	U	HIR2 SGDID:S000005564, Chr XV from 405387-402760, reverse complement, Verified ORF, "Non-essential transcriptional corepressor involved in the cell cycle-regulated transcription of histone H2A, H2B, H3, and H4 genes; recruits Swi-Snf complexes to histone gene promoters; promotes heterochromatic gene silencing with Asf1p" 
*	Jamie_Alpha_SPB_22.07663.07663.4	2.8049	0.2103	11.3	4681.0566	4683.5757	8802.2	5	4.585	15.4	1	G.ILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDP.T
*	Jamie_Alpha_SPB_34.12235.12235.2	1.5886	0.1129	20.8	1924.2722	1922.1547	6481.3	82	3.761	32.4	1	K.TLVTPSSNGCRVLVYSPA.F
Reverse_YKL121W	2	2	6.7%	852	96022	8.4	U	YKL121W SGDID:S000001604, Chr XI from 213786-216344, Uncharacterized ORF, "Putative protein of unknown function" 
*	Jamie_Alpha_SPB_30.10544.10544.3	2.4379	0.0069	31.1	3187.6743	3183.4668	8137.6	159	2.992	21.2	1	R.NELISDNNHNNIKGAAELHFLNYEHFK.E
*	Jamie_Alpha_SPB_45.15994.15994.3	2.5897	0.0253	41.0	3449.1543	3452.8198	9460.9	1	2.787	25.0	1	K.DVKSFFCQLGTIRPGHQVKGYESSPHFSNK.T
YJR016C	3	3	6.7%	585	62861	7.8	U	ILV3 SGDID:S000003777, Chr X from 466122-464365, reverse complement, Verified ORF, "Dihydroxyacid dehydratase, catalyzes third step in the common pathway leading to biosynthesis of branched-chain amino acids" 
*	Jamie_Alpha_SPB_65.23364.23364.2	1.9667	0.1821	59.8	1429.7122	1427.5969	5678.9	281	3.909	41.7	1	K.YSYIITEPKGQGA.S
*	Jamie_Alpha_SPB_112.40173.40173.1	1.4906	0.0571	21.5	931.22	930.0483	5192.5	28	3.01	64.3	1	T.GKEGTYFK.G
*	Jamie_Alpha_SPB_24.08590.08590.2	2.0997	0.0403	12.6	2059.8123	2061.3179	8021.7	8	2.647	41.2	1	D.ADNNKIDLLVSDKEMAQR.K
YDL090C	2	2	6.7%	431	48190	6.4	U	RAM1 SGDID:S000002248, Chr IV from 296329-295034, reverse complement, Verified ORF, "Beta subunit of the CAAX farnesyltransferase (FTase) that prenylates the a-factor mating pheromone and Ras proteins; required for the membrane localization of Ras proteins and a-factor; homolog of the mammalian FTase beta subunit" 
*	Jamie_Alpha_SPB_90.32340.32340.2	1.5489	0.0561	75.5	1746.1522	1745.9327	5716.6	6	3.065	46.2	1	K.LLEWSSARQLQEER.G
*	Jamie_Alpha_SPB_118.42212.42212.2	1.7728	0.1497	12.4	1631.2122	1631.7523	7404.6	1	3.771	53.6	1	Y.CLLGLAVAESSYSCT.P
YMR275C	3	3	6.6%	976	109174	8.7	U	BUL1 SGDID:S000004888, Chr XIII from 818580-815650, reverse complement, Verified ORF, "Ubiquitin-binding component of the Rsp5p E3-ubiquitin ligase complex, functional homolog of Bul2p, disruption causes temperature-sensitive growth, overexpression causes missorting of amino acid permeases" 
*	Jamie_Alpha_SPB_72.25723.25723.4	2.8712	0.1769	16.3	4029.3765	4032.3733	7897.2	1	3.992	19.4	1	S.ADLSHQSLSTDALGATRSSSTSNLENLIPLRTEHHSIA.A
*	Jamie_Alpha_SPB_16.05643.05643.2	1.3901	0.0129	64.8	2025.0122	2023.2998	5280.7	369	2.777	29.4	1	K.NNHDLTGNKERTGLILVK.A
*	Jamie_Alpha_SPB_14.04836.04836.2	1.6492	0.0972	24.6	931.77216	932.06665	2357.8	3	3.355	71.4	1	K.QGLPYWAP.S
YGR089W	3	3	6.6%	936	106465	8.6	U	NNF2 SGDID:S000003321, Chr VII from 656964-659774, Uncharacterized ORF, "Protein that exhibits physical and genetic interactions with Rpb8p, which is a subunit of RNA polymerases I, II, and III; computational analysis of large-scale protein-protein interaction data suggests a role in chromosome segregation" 
*	Jamie_Alpha_SPB_32.11422.11422.2	1.6765	0.1766	13.2	1997.0322	1996.1417	6934.7	1	4.413	41.7	1	H.IDISTSKVTNGSSNRKSNS.R
*	Jamie_Alpha_SPB_77.27715.27715.2	1.6461	0.1666	13.9	1618.8922	1620.0311	6316.3	49	3.715	38.5	1	D.YFVKPIKNLAISII.A
*	Jamie_Alpha_SPB_86.30778.30778.4	2.8832	0.1752	14.7	3019.6565	3018.2231	5544.1	310	3.46	19.6	1	Q.QNNSPVPLSSHSNILNPAASYPTDATSSF.P
Reverse_YMR078C	2	2	6.6%	741	84373	8.3	U	CTF18 SGDID:S000004683, Chr XIII from 424727-422502, reverse complement, Verified ORF, "Subunit of a complex with Ctf8p that shares some subunits with Replication Factor C and is required for sister chromatid cohesion; may have overlapping functions with Rad24p in the DNA damage replication checkpoint" 
*	Jamie_Alpha_SPB_30.10779.10779.3	2.3452	0.0162	32.9	3241.1343	3239.6672	5583.4	69	2.611	21.3	1	R.FLQNVIKFWSIPSDKNSSAWTNKACAPK.D
*	Jamie_Alpha_SPB_60.21615.21615.2	1.326	0.0418	67.2	2439.392	2440.8115	8799.3	37	2.755	30.0	1	K.LPDLEMDSVEKETPLKPLQEK.F
YLR452C	2	2	6.6%	698	79716	8.6	U	SST2 SGDID:S000004444, Chr XII from 1041363-1039267, reverse complement, Verified ORF, "GTPase-activating protein for Gpa1p, regulates desensitization to alpha factor pheromone; also required to prevent receptor-independent signaling of the mating pathway; member of the RGS (regulator of G-protein signaling) family" 
*	Jamie_Alpha_SPB_29.10480.10480.1	1.1672	0.0748	20.4	1416.13	1416.7162	5329.6	44	3.228	33.3	1	R.DIGLKTMPDILLS.S
*	Jamie_Alpha_SPB_41.14692.14692.3	2.37	0.1113	68.0	3694.3442	3692.1042	9722.1	241	3.691	16.4	1	K.KTLDDSEGFSQDMLISSSNLNKLDYVLTDPGMR.Y
Reverse_YNL167C	2	2	6.6%	647	70192	9.3	U	SKO1 SGDID:S000005111, Chr XIV from 321361-319418, reverse complement, Verified ORF, "Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family that forms a complex with Tup1p and Ssn6p to both activate and repress transcription; cytosolic and nuclear protein involved in the osmotic and oxidative stress responses" 
*	Jamie_Alpha_SPB_35.12478.12478.2	1.9818	0.1927	63.6	2462.5923	2460.62	6021.9	2	4.156	29.5	1	K.NNEVDDKQAPATTVASNKRSISN.K
*	Jamie_Alpha_SPB_48.17269.17269.4	2.7746	0.2485	13.0	2121.4165	2118.441	2607.3	298	4.526	25.4	1	N.NRSLEKPLSPHSITGPLSLA.K
YHR168W	2	2	6.6%	499	55537	9.1	U	MTG2 SGDID:S000001211, Chr VIII from 440379-441878, Verified ORF, "Putative GTPase, member of the Obg family; peripheral protein of the mitochondrial inner membrane that associates with the large ribosomal subunit; required for mitochondrial translation, possibly via a role in ribosome assembly" 
*	Jamie_Alpha_SPB_79.28302.28302.2	1.3621	0.1326	10.5	2675.392	2675.9634	7467.3	191	3.67	22.7	1	R.FLPRVYSTKVPDNAPRAADNEQW.L
*	Jamie_Alpha_SPB_35.12576.12576.2	1.6927	0.0858	20.3	1254.0922	1254.4752	5471.8	7	3.711	55.6	1	P.PQKVRELVER.E
YGL169W	2	2	6.6%	426	46539	7.2	U	SUA5 SGDID:S000003137, Chr VII from 186065-187345, Verified ORF, "Protein required for respiratory growth; null mutation suppresses the Cyc1p translation defect caused by the presence of an aberrant ATG codon upstream of the correct start" 
*	Jamie_Alpha_SPB_8.02800.02800.2	1.193	0.2358	28.9	1337.7522	1337.539	4511.4	487	4.007	30.0	1	R.TPGMKYRHYSP.S
*	Jamie_Alpha_SPB_82.29422.29422.2	1.4564	0.1105	10.7	2610.872	2611.9695	5868.2	1	3.221	27.3	1	K.YRHYSPSAKVVLLVPHCEGDGIL.K
YHR080C	3	3	6.5%	1345	149679	8.7	U	YHR080C SGDID:S000001122, Chr VIII from 266840-262803, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_18.06494.06494.4	2.5182	0.0137	38.9	2403.4565	2403.744	5302.1	29	2.729	27.8	1	R.KTVPSKWSVVSSSTTDGVKPRR.R
*	Jamie_Alpha_SPB_20.06938.06938.4	3.0786	0.1824	14.9	4086.8564	4084.8376	9203.7	167	4.15	16.7	1	I.LGWVSTVFIPFKTIVQIEKRATAGIFPNGIVIDTLHT.K
*	Jamie_Alpha_SPB_42.14840.14840.4	3.5894	0.1704	17.1	3255.9365	3251.5828	7100.0	4	3.753	22.8	1	T.RDKNNVNVETIPKFTPSLVEGGSRHYEY.T
YNL193W	2	2	6.5%	558	63904	4.9	U	YNL193W SGDID:S000005137, Chr XIV from 274369-276045, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_56.19874.19874.2	1.7178	0.1256	27.6	1357.6721	1355.5054	5244.9	8	3.667	45.8	1	R.TNGPVQPPAEVMD.V
*	Jamie_Alpha_SPB_33.11595.11595.2	2.432	0.0066	12.3	2604.412	2603.941	4988.9	169	2.387	27.3	1	E.FAILCLNDYSSDASWKLSGLLTK.V
YIL022W	2	2	6.5%	431	48854	9.4	U	TIM44 SGDID:S000001284, Chr IX from 311163-312458, Verified ORF, "Peripheral mitochondrial membrane protein involved in mitochondrial protein import, tethers essential chaperone Ssc1p to the translocon channel at the matrix side of the inner membrane" 
*	Jamie_Alpha_SPB_9.03127.03127.3	1.2497	0.0716	25.5	2765.9944	2768.0068	6164.2	493	3.449	12.5	1	K.SQELQENIKTLQDASGKLGESEAYK.K
*	Jamie_Alpha_SPB_13.04659.04659.2	1.6815	0.1228	25.6	1951.7522	1952.1747	5514.5	1	3.982	41.2	1	T.LQDASGKLGESEAYKKAR.E
Reverse_YLR312C	2	2	6.5%	398	46628	9.7	U	YLR312C SGDID:S000004303, Chr XII from 758835-757639, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_56.19870.19870.2	1.9716	0.1778	59.3	1461.0922	1461.7537	5503.3	1	4.464	54.5	1	K.FRLKRLQLRSGS.W
*	Jamie_Alpha_SPB_52.18739.18739.2	1.5559	0.1152	20.5	1578.9321	1579.661	6772.3	354	3.236	38.5	1	D.LSIESKSSQEEGER.G
Reverse_YOR363C	2	2	6.4%	996	114710	7.6	U	PIP2 SGDID:S000005890, Chr XV from 1023208-1020218, reverse complement, Verified ORF, "Autoregulatory oleate-specific transcriptional activator of peroxisome proliferation, contains Zn(2)-Cys(6) cluster domain, forms heterodimer with Oaf1p, binds oleate response elements (OREs), activates beta-oxidation genes" 
*	Jamie_Alpha_SPB_102.36649.36649.4	1.7334	0.0163	24.6	6187.2964	6189.824	7947.8	383	3.62	9.3	1	K.PPLTKEIENIYGKLLDSYDNETPCTDELYSSERNSYLLSIVKNVAIQEEPNKR.Q
*	Jamie_Alpha_SPB_41.14689.14689.2	1.6462	0.2062	51.7	1200.1322	1202.3708	4591.6	122	4.036	45.0	1	I.DANLAPIMSNR.S
Reverse_contaminant_PIGR_RAT	2	2	6.4%	769	84798	5.2	U	owl|P15083| POLYMERIC-IMMUNOGLOBULIN RECEPTOR PRECURSOR (PLGR) (CONTAINS:... 
*	Jamie_Alpha_SPB_12.04207.04207.2	1.7303	0.0734	18.4	1197.8722	1198.3391	3988.2	8	3.623	61.1	1	N.RFDGMSIDTR.Y
*	Jamie_Alpha_SPB_105.37803.37803.3	1.6933	0.2515	94.1	4267.8545	4263.5127	4327.9	59	4.312	11.2	1	R.PDLNAKNEDERVSSEMAEEEPADKARANADTPNIHPSGR.T
YGL110C	2	2	6.4%	624	72043	7.0	U	CUE3 SGDID:S000003078, Chr VII from 303414-301540, reverse complement, Uncharacterized ORF, "Protein of unknown function; has a CUE domain that binds ubiquitin, which may facilitate intramolecular monoubiquitination" 
*	Jamie_Alpha_SPB_13.04537.04537.2	1.9481	0.1217	30.4	1244.3522	1244.5204	5215.6	12	3.652	65.0	1	S.VSADRLLKITK.E
*	Jamie_Alpha_SPB_43.15216.15216.4	2.7352	0.0616	55.1	3569.9766	3573.056	7052.0	69	2.952	19.0	1	K.QKKSENIKKHEPQSTEQKKRQHAKNEKRK.G
YBR288C	2	2	6.4%	483	54879	6.7	U	APM3 SGDID:S000000492, Chr II from 779459-778008, reverse complement, Verified ORF, "Mu3-like subunit of the clathrin associated protein complex (AP-3); functions in transport of alkaline phosphatase to the vacuole via the alternate pathway" 
*	Jamie_Alpha_SPB_31.11035.11035.2	1.6116	0.1548	11.5	2012.1522	2012.109	8528.0	55	3.922	29.4	1	P.QLLEDSSSDDYLDHSMVG.R
*	Jamie_Alpha_SPB_15.05220.05220.2	2.0179	0.099	34.1	1316.9521	1316.5376	6547.3	122	3.192	45.8	1	V.EAIDIVSGLTIGK.N
Reverse_YPL137C	4	4	6.3%	1276	140891	7.4	U	YPL137C SGDID:S000006058, Chr XVI from 296646-292816, reverse complement, Uncharacterized ORF, "Glc7-interacting protein whose overexpression relocalizes Glc7p from the nucleus" 
*	Jamie_Alpha_SPB_39.13832.13832.2	1.5467	0.1364	23.7	2534.5923	2531.7168	6487.4	74	4.058	25.0	1	R.LHCCRTYIVDLTVENNEISHG.D
*	Jamie_Alpha_SPB_91.32508.32508.2	1.7476	0.0532	10.4	1469.1522	1470.6708	4903.6	127	3.195	41.7	1	K.FNAVEFAIRNAAF.H
*	Jamie_Alpha_SPB_88.31644.31644.4	2.2726	0.0068	29.7	4553.1367	4551.117	5886.9	17	3.411	13.3	1	R.KLTANSPSSIPPHKGKGVSSSATANIASSALRPKSSVVANSISTSR.K
*	Jamie_Alpha_SPB_57.20292.20292.2	1.596	0.1059	15.1	2343.8523	2346.6462	7221.3	1	3.687	29.2	1	K.GKGVSSSATANIASSALRPKSSVVA.N
Reverse_YNL243W	2	2	6.3%	968	108996	5.5	U	SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" 
*	Jamie_Alpha_SPB_36.12846.12846.3	2.2876	0.134	75.7	3178.7644	3178.4148	6847.9	209	3.781	18.1	1	K.DQTMTEAAATAAASDAEANNISRELELRAR.D
*	Jamie_Alpha_SPB_18.06322.06322.3	2.3528	0.0717	52.9	3486.9844	3488.0557	7508.4	4	3.228	19.2	1	K.IEKSEDVDNILFVDPADVPLKPITVLTTLYK.V
YPL036W	6	7	6.3%	947	102172	5.0	U	PMA2 SGDID:S000005957, Chr XVI from 482841-485684, Verified ORF, "Plasma membrane H+-ATPase, isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential" 
*	Jamie_Alpha_SPB_79.28314.28314.3	3.1354	0.1783	16.2	2928.3245	2931.0134	8728.8	168	3.809	18.8	1	P.ANNSAASSSSSSSTSTSASSSAAAVPRKAAAAS.A
	Jamie_Alpha_SPB_32.11359.11359.3	2.8551	0.1455	10.3	3151.0745	3150.3855	8484.9	1	3.59	26.9	1	L.KTVEEDHPIPEDVHENYENKVAELASR.G
	Jamie_Alpha_SPB_16.05724.05724.3	5.0986	0.3852	100.0	2294.4243	2295.3806	8398.3	1	8.096	50.0	1	K.TVEEDHPIPEDVHENYENK.V
	Jamie_Alpha_SPB_16.05791.05791.2	3.3333	0.4781	100.0	2294.4521	2295.3806	7919.0	1	8.573	55.6	2	K.TVEEDHPIPEDVHENYENK.V
	Jamie_Alpha_SPB_28.09818.09818.2	3.4377	0.3424	100.0	2778.7922	2778.9458	8430.1	1	7.403	43.5	1	K.TVEEDHPIPEDVHENYENKVAELA.S
	Jamie_Alpha_SPB_28.10128.10128.3	5.8041	0.5087	100.0	3020.9644	3022.2114	6785.5	1	8.125	37.0	1	K.TVEEDHPIPEDVHENYENKVAELASR.G
YDR409W	2	2	6.3%	904	100796	6.9	U	SIZ1 SGDID:S000002817, Chr IV from 1289396-1292110, Verified ORF, "SUMO ligase that promotes the attachment of sumo (Smt3p; small ubiquitin-related modifier) to proteins; binds Ubc9p and may bind septins; specifically required for sumoylation of septins in vivo; localized to the septin ring" 
*	Jamie_Alpha_SPB_57.20559.20559.4	3.1736	0.2166	46.7	3133.8564	3128.645	7069.3	77	4.177	21.0	1	K.AVLQDLIRNFLQNALVVGKSDPYRVQAV.K
*	Jamie_Alpha_SPB_9.02914.02914.4	1.5706	0.0438	26.8	3362.3364	3361.3298	5058.2	261	3.382	10.7	1	K.HDHGSRSNTPSHNHTKNLMNDNDDDDDDR.L
YKL176C	2	2	6.3%	828	93359	8.7	U	LST4 SGDID:S000001659, Chr XI from 117991-115505, reverse complement, Verified ORF, "Protein possibly involved in a post-Golgi secretory pathway; required for the transport of nitrogen-regulated amino acid permease Gap1p from the Golgi to the cell surface" 
*	Jamie_Alpha_SPB_12.04117.04117.2	1.3347	0.1735	25.0	1838.6721	1835.9751	9651.6	23	3.983	33.3	1	R.SSDLTQCDKIRTIPNS.D
*	Jamie_Alpha_SPB_68.24331.24331.4	2.7082	0.0918	67.3	4264.5366	4261.1323	9746.6	88	3.232	16.2	1	K.SIFNWIEIKDGPKLGFLPLLMAMIISDYRHTIRELK.T
YPL270W	2	2	6.3%	773	85137	9.1	U	MDL2 SGDID:S000006191, Chr XVI from 30482-32803, Verified ORF, "Half-type ATP-binding cassette (ABC) transporter of the inner mitochondrial membrane" 
*	Jamie_Alpha_SPB_37.13225.13225.3	2.4048	0.0049	33.4	1867.4343	1871.1156	5717.3	22	3.244	32.4	1	R.SENVIVLGHDGSVVEMGK.F
*	Jamie_Alpha_SPB_84.30104.30104.4	2.4775	0.0039	30.7	3554.7366	3549.3105	5134.5	463	2.587	18.9	1	K.DDNDDNDNNHDNDSNNQSPETKDNNSDDIEK.S
YJL132W	2	2	6.3%	750	84466	6.3	U	YJL132W SGDID:S000003668, Chr X from 161832-164084, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_100.35899.35899.4	3.3333	0.1761	14.4	3333.4565	3327.8015	5853.3	2	4.132	23.0	1	Q.SLGTVFVYSSNDLHDLSIPIYYITKNGVIP.A
*	Jamie_Alpha_SPB_49.17354.17354.2	1.7539	0.0862	16.5	1835.0721	1838.0648	5656.3	16	3.729	34.4	1	K.IKTKSDSIPDEFGSSLL.F
Reverse_YKR018C	2	2	6.3%	725	81754	5.2	U	YKR018C SGDID:S000001726, Chr XI from 475543-473366, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus" 
*	Jamie_Alpha_SPB_17.06177.06177.4	2.9854	0.193	12.3	3000.4165	3003.4463	6270.2	491	3.938	20.5	1	I.MLLAHLLCSETYTVAYVTGPPYLSSSK.L
*	Jamie_Alpha_SPB_97.34654.34654.2	1.5485	0.1986	32.8	2007.1322	2005.1431	8045.3	198	4.079	25.0	1	R.ALANITQDSAEKADSEDLL.A
Reverse_YBR041W	2	2	6.3%	669	77141	8.3	U	FAT1 SGDID:S000000245, Chr II from 318266-320275, Verified ORF, "Fatty acid transporter and very long-chain fatty acyl-CoA synthetase, may form a complex with Faa1p or Faa4p that imports and activates exogenous fatty acids" 
*	Jamie_Alpha_SPB_18.06345.06345.3	2.5355	0.1381	79.4	3283.9143	3281.5981	8549.4	14	3.714	19.0	1	K.IGVVLVQAYQEKNSATLQDEVETTSVNESK.W
*	Jamie_Alpha_SPB_42.15122.15122.2	1.7527	0.0703	11.4	1663.6921	1664.9102	7155.5	260	3.348	36.4	1	N.FRKRFDQWIDPR.L
Reverse_YKL204W	2	2	6.3%	632	69762	9.5	U	EAP1 SGDID:S000001687, Chr XI from 53705-55603, Verified ORF, "eIF4E-associated protein, binds eIF4E and inhibits cap-dependent translation, also functions independently of eIF4E to maintain genetic stability; plays a role in cell growth, implicated in the TOR signaling cascade" 
*	Jamie_Alpha_SPB_18.06501.06501.4	3.4071	0.231	50.0	3610.6165	3613.0999	7622.4	388	4.331	19.4	1	H.MPFFGPPPPPPMYQQQPLDPTATEEQKGKSNR.T
*	Jamie_Alpha_SPB_111.39732.39732.1	1.4519	0.0375	18.9	900.31	901.0507	4108.4	35	3.114	57.1	1	K.PLSRVLES.I
YLR190W	2	2	6.3%	491	54817	7.6	U	MMR1 SGDID:S000004180, Chr XII from 535216-536691, Verified ORF, "Phosphorylated protein of the mitochondrial outer membrane, localizes only to mitochondria of the bud; interacts with Myo2p to mediate mitochondrial distribution to buds; mRNA is targeted to the bud via the transport system involving She2p" 
*	Jamie_Alpha_SPB_78.27802.27802.4	3.1922	0.1637	15.7	3392.0166	3386.8325	7508.2	75	3.578	19.4	1	L.PSYVPVPATPLEDPENHGVRKVEDKGLRVVS.G
*	Jamie_Alpha_SPB_24.08654.08654.2	1.7472	0.1117	25.2	1848.2122	1850.0446	5233.0	30	3.496	36.7	1	E.DPENHGVRKVEDKGLR.V
YPR097W	2	2	6.2%	1073	123054	5.8	U	YPR097W SGDID:S000006301, Chr XVI from 725392-728613, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_97.34830.34830.3	2.3141	0.2095	16.2	3225.4443	3222.727	10654.0	2	4.261	22.3	1	V.ALKNFEKFMGDLIRLVDDVINGQLGVSTQ.F
*	Jamie_Alpha_SPB_50.17967.17967.3	2.2881	0.1085	64.4	4317.804	4315.9697	9502.9	34	3.34	14.6	1	K.FGGPSERIDFNKLICRDDIDIDVKLLKVQVNNVLNKK.I
Reverse_YDR324C	2	2	6.2%	776	87801	6.6	U	UTP4 SGDID:S000002732, Chr IV from 1116758-1114428, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_41.14668.14668.2	1.7245	0.0948	25.5	1049.0521	1048.2302	4289.3	27	3.556	62.5	1	H.VATIFNNLR.A
*	Jamie_Alpha_SPB_105.37801.37801.4	2.1698	0.08	50.6	4640.9365	4640.104	8812.6	76	3.76	16.2	1	K.SQYACIARIDNGHLLRNSSNVWRNNKQSKNTNQSFQFIK.R
Reverse_YHR031C	2	3	6.2%	723	81581	9.7	U	RRM3 SGDID:S000001073, Chr VIII from 172963-170792, reverse complement, Verified ORF, "DNA helicase involved in rDNA replication and Ty1 transposition; structurally and functionally related to Pif1p" 
*	Jamie_Alpha_SPB_59.21009.21009.2	1.3159	0.1392	10.8	2491.2122	2492.9272	9244.7	167	3.605	23.8	1	M.TVARSLAVYVQGAEFIRRLDVK.L
*	Jamie_Alpha_SPB_43.15189.15189.2	2.0449	0.0192	10.1	2522.132	2521.9163	4272.8	218	3.583	22.7	2	L.SETVFFLVKGLSGNVLEVDPKNK.L
Reverse_YHR074W	2	2	6.2%	714	80686	6.5	U	QNS1 SGDID:S000001116, Chr VIII from 246195-248339, Verified ORF, "Glutamine-dependent NAD(+) synthetase, essential for the formation of NAD(+) from nicotinic acid adenine dinucleotide" 
*	Jamie_Alpha_SPB_48.17137.17137.4	3.8035	0.2444	25.0	5225.0566	5219.133	7738.2	438	4.457	13.6	1	P.VLRQGTVKQIEPPLIFDEVVGPKMWPTFFRMERYNGDNALWIKP.R
*	Jamie_Alpha_SPB_22.07845.07845.1	1.2172	0.1731	25.0	1365.77	1366.6666	2343.9	12	3.794	30.0	1	V.VGPKMWPTFFR.M
Reverse_YKL146W	2	2	6.2%	692	75459	8.5	U	AVT3 SGDID:S000001629, Chr XI from 171788-173866, Verified ORF, "Vacuolar transporter, exports large neutral amino acids from the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters" 
*	Jamie_Alpha_SPB_60.21349.21349.2	1.7937	0.1666	10.6	2752.7122	2751.0774	8949.9	7	4.085	22.9	1	Q.LSNSPNRILHRAVADVVHPEPNNIS.V
*	Jamie_Alpha_SPB_27.09698.09698.2	1.7475	0.0617	11.0	1788.7122	1790.8038	7151.2	26	3.862	35.3	1	R.SRSRSNGNSNGGNGDTLP.S
YKR036C	2	2	6.2%	659	74709	5.5	U	CAF4 SGDID:S000001744, Chr XI from 510323-508344, reverse complement, Verified ORF, "WD40 repeat-containing protein associated with the CCR4-NOT complex, interacts in a Ccr4p-dependent manner with Ssn2p" 
*	Jamie_Alpha_SPB_23.08127.08127.2	2.1638	0.0854	33.2	1712.2722	1712.971	4353.0	68	3.963	42.9	1	L.PGHLATVNCMQIDKK.N
*	Jamie_Alpha_SPB_40.14413.14413.3	1.8586	0.0733	42.6	2971.5244	2973.4043	8939.9	120	3.141	21.0	1	R.RIAIVKYKDGFLINGHNDGDINVWTL.-
Reverse_YJR052W	2	2	6.2%	565	63778	5.5	U	RAD7 SGDID:S000003813, Chr X from 531976-533673, Verified ORF, "Protein that recognizes and binds damaged DNA in an ATP-dependent manner (with Rad16p) during nucleotide excision repair; subunit of Nucleotide Excision Repair Factor 4 (NEF4)" 
*	Jamie_Alpha_SPB_101.36168.36168.3	1.9186	0.1045	53.0	3958.5842	3961.433	8631.9	10	3.268	16.9	1	R.SLGLSVLTSGCNILLNSLSKDTFRHTNSIHFEELR.G
*	Jamie_Alpha_SPB_21.07306.07306.2	2.1696	0.0313	21.4	1407.6721	1407.6531	7803.8	21	3.074	50.0	1	N.ILLNSLSKDTFR.H
YDR062W	2	2	6.2%	561	63111	8.1	U	LCB2 SGDID:S000002469, Chr IV from 576470-578155, Verified ORF, "Component of serine palmitoyltransferase, responsible along with Lcb1p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine" 
*	Jamie_Alpha_SPB_22.07770.07770.3	2.5643	0.1902	17.4	2419.7644	2416.85	7589.3	30	4.102	27.6	1	E.LKKKYKCYLFIDEAHSIGAM.G
*	Jamie_Alpha_SPB_56.20112.20112.2	1.6389	0.0699	10.2	1527.6122	1527.6763	4460.2	178	3.223	39.3	1	K.SFGAAGGYIAADQWI.I
Reverse_YMR145C	2	2	6.2%	560	62774	9.3	U	NDE1 SGDID:S000004753, Chr XIII from 556474-554792, reverse complement, Verified ORF, "Mitochondrial external NADH dehydrogenase, catalyzes the oxidation of cytosolic NADH; Nde1p and Nde2p are involved in providing the cytosolic NADH to the mitochondrial respiratory chain" 
*	Jamie_Alpha_SPB_67.24048.24048.3	2.205	0.0725	50.2	2432.0044	2428.8528	5583.8	1	2.821	31.0	1	R.AREPDKPSLSAAKEISSMIKLR.I
*	Jamie_Alpha_SPB_78.27976.27976.2	1.7666	0.0685	11.0	1339.9922	1337.5994	4431.4	166	3.263	50.0	1	K.LEITGVPTSPLLP.T
YKL120W	2	2	6.2%	324	35153	9.6	U	OAC1 SGDID:S000001603, Chr XI from 216988-217962, Verified ORF, "Mitochondrial inner membrane transporter, transports oxaloacetate, sulfate, and thiosulfate; member of the mitochondrial carrier family" 
*	Jamie_Alpha_SPB_19.06644.06644.2	2.6285	0.063	28.8	1516.2722	1516.7379	5876.1	1	3.86	66.7	1	S.KQDKQIEKTAAQK.I
*	Jamie_Alpha_SPB_114.41060.41060.1	1.0965	0.0556	13.0	729.4	730.83936	2915.4	14	2.978	66.7	1	K.NEGIKGL.Q
YOR330C	4	4	6.1%	1254	143502	8.8	U	MIP1 SGDID:S000005857, Chr XV from 943380-939616, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial DNA polymerase" 
*	Jamie_Alpha_SPB_14.04899.04899.3	2.6341	0.1555	10.7	2633.5745	2636.9392	6782.8	25	4.242	23.9	1	K.GVLKSESELAHQALQINSSGSYWM.S
*	Jamie_Alpha_SPB_58.20655.20655.2	2.1293	0.048	21.6	2018.8322	2017.2931	9324.5	64	3.017	36.1	1	L.TASNAKANRIGSELKTQVK.A
*	Jamie_Alpha_SPB_15.05355.05355.2	2.4796	0.0756	28.2	1523.4122	1522.6953	7044.2	417	3.237	45.8	1	R.FNPSLTDEETKKI.A
*	Jamie_Alpha_SPB_62.22252.22252.2	1.538	0.1358	23.5	2394.2122	2393.834	8925.0	1	4.351	34.2	1	R.SKLFKKFWYGGSESILFNKL.E
YKR067W	2	2	6.1%	743	83645	9.5	U	GPT2 SGDID:S000001775, Chr XI from 567560-569791, Verified ORF, "Glycerol-3-phosphate acyltransferase located in both lipid particles and the ER; involved in the stepwise acylation of glycerol-3-phosphate and dihydroxyacetone, which are intermediate steps in lipid biosynthesis" 
*	Jamie_Alpha_SPB_52.18745.18745.2	1.8618	0.0637	12.3	1431.2722	1429.6561	4148.9	27	3.736	46.2	1	R.GAYNVPEVGVPTIL.V
*	Jamie_Alpha_SPB_52.18717.18717.3	1.6967	0.0402	26.8	3546.7144	3547.2708	7234.9	241	3.435	15.0	1	K.FSVFAILSLPGSILFTPIFIICRVYSEKKAK.E
YIL105C	2	2	6.1%	686	77995	7.9	U	SLM1 SGDID:S000001367, Chr IX from 169638-167578, reverse complement, Verified ORF, "Phosphoinositide PI4,5P(2) binding protein, forms a complex with Slm2p; acts downstream of Mss4p in a pathway regulating actin cytoskeleton organization in response to stress; subunit of and phosphorylated by the TORC2 complex" 
*	Jamie_Alpha_SPB_42.14881.14881.2	1.8401	0.1189	29.8	1756.1322	1755.9124	7357.1	368	3.634	33.3	1	K.NNTMTSAVSDMLSQQQ.L
*	Jamie_Alpha_SPB_97.34869.34869.3	2.2525	0.239	15.1	3051.3843	3053.3682	7898.9	135	4.247	19.0	1	N.TSILSRARSSLQRQRLAQQQQQQQDP.R
YDL203C	2	2	6.1%	623	69371	8.4	U	YDL203C SGDID:S000002362, Chr IV from 97954-96083, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_74.26559.26559.2	1.6714	0.1693	12.1	1938.2922	1940.2004	7776.6	5	4.997	35.3	1	Q.NIVPAPYPVDDSIVELTP.A
*	Jamie_Alpha_SPB_35.12579.12579.4	2.6826	0.1806	15.5	1971.2965	1976.082	3039.7	62	3.804	25.4	1	G.NADGGQLGTPVTINSNNGMD.I
YHR184W	2	2	6.1%	571	65816	5.8	U	SSP1 SGDID:S000001227, Chr VIII from 472744-474459, Verified ORF, "Protein involved in the control of meiotic nuclear division and coordination of meiosis with spore formation; transcription is induced midway through meiosis" 
*	Jamie_Alpha_SPB_30.10834.10834.4	2.7958	0.1852	15.8	2483.7366	2487.7253	6422.2	48	3.546	25.8	1	N.FFLPSEDESGPVQSSVKTFLTGN.N
*	Jamie_Alpha_SPB_26.09140.09140.2	1.6651	0.0145	72.2	1404.3522	1403.5321	7595.1	312	2.831	40.9	1	K.ENLESNDSLILR.S
YOR204W	3	3	6.1%	604	65553	7.8	U	DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" 
*	Jamie_Alpha_SPB_19.06693.06693.2	1.661	0.1702	11.5	1046.5521	1047.0715	5099.2	129	3.349	50.0	1	G.GYGNGGFFGGN.N
	Jamie_Alpha_SPB_63.22515.22515.2	1.4262	0.0055	65.5	1242.1721	1239.3522	4264.8	302	2.442	50.0	1	R.DLMACAQTGSGK.T
*	Jamie_Alpha_SPB_16.05668.05668.2	2.5886	0.375	100.0	1659.4321	1658.7896	5698.3	8	5.712	46.2	1	R.HIVEDCDMTPVGER.Q
contaminant_KERATIN17	2	2	6.1%	590	62461	8.1	U	no description
*	Jamie_Alpha_SPB_69.24816.24816.2	1.6021	0.0803	10.7	2324.5522	2326.452	6233.3	13	3.677	26.0	1	R.GGSFRNRFGAGAGGGYGFGGGAGSGF.G
	Jamie_Alpha_SPB_15.05442.05442.3	1.729	0.0095	26.2	1310.7244	1309.4215	6033.0	1	3.067	50.0	1	K.NKYEDEINKR.T
YFL048C	2	2	6.1%	445	50331	6.0	U	EMP47 SGDID:S000001846, Chr VI from 40180-38843, reverse complement, Verified ORF, "Integral membrane component of endoplasmic reticulum-derived COPII-coated vesicles, which function in ER to Golgi transport" 
*	Jamie_Alpha_SPB_19.06546.06546.2	1.5681	0.0043	68.4	1313.8922	1313.4532	3845.8	70	2.963	54.5	1	K.QLSSKPPANNEK.G
*	Jamie_Alpha_SPB_34.12162.12162.2	1.5815	0.0522	75.1	1703.8922	1706.8588	7424.9	91	2.869	35.7	1	K.RHGQDGPQVDEIARK.L
Reverse_YDR180W	2	2	6.0%	1493	171101	6.8	U	SCC2 SGDID:S000002588, Chr IV from 821290-825771, Verified ORF, "Putative protein kinase and subunit of cohesin loading factor (Scc2p-Scc4p), a complex required for the loading of cohesin complexes onto chromosomes; involved in establishing sister chromatid cohesion during DSB repair via histone H2AX" 
*	Jamie_Alpha_SPB_95.34149.34149.4	3.0462	0.1705	15.6	4363.0166	4365.3545	9364.8	6	4.759	18.0	1	L.IVKDKSALMSLCKIATSRLKIKDKALLSLILKLYPDYL.N
*	Jamie_Alpha_SPB_102.36518.36518.4	2.4867	0.1978	15.9	5806.8164	5803.7812	9869.0	475	4.396	11.3	1	L.QLCITEINASVQMSPSYVSLLRKLLSSLIKETVPWQPSSILLLLDQVFNDI.V
Reverse_YMR076C	3	3	6.0%	1277	147041	6.3	U	PDS5 SGDID:S000004681, Chr XIII from 420028-416195, reverse complement, Verified ORF, "Protein required for establishment and maintenance of sister chromatid condensation and cohesion, colocalizes with cohesin on chromosomes in an interdependent manner, may function as a protein-protein interaction scaffold" 
*	Jamie_Alpha_SPB_76.27074.27074.3	1.9195	0.0055	24.8	4438.014	4434.042	11552.0	148	2.748	14.2	1	K.PSLAILKTAYKTIEPKSEVAFDYLKTFFFTDDFDVQDK.L
*	Jamie_Alpha_SPB_31.10993.10993.4	2.7801	0.1984	16.5	2872.0964	2866.2407	5104.8	16	3.967	27.3	1	N.FQKITELADIAKTSDSLGSALWQLTQ.N
*	Jamie_Alpha_SPB_43.15318.15318.3	2.037	0.1057	63.5	1486.8844	1487.6531	2980.4	393	3.031	35.4	1	K.ALAQNLEKSIDER.T
YML065W	4	4	6.0%	914	104400	5.7	U	ORC1 SGDID:S000004530, Chr XIII from 142210-144954, Verified ORF, "Largest subunit of the origin recognition complex, which directs DNA replication by binding to replication origins and is also involved in transcriptional silencing; may be phosphorylated by Cdc28p" 
*	Jamie_Alpha_SPB_13.04480.04480.2	1.4622	0.0366	71.5	1265.4521	1266.4891	4743.4	243	3.416	50.0	1	R.GRKPKDPSKPR.Q
*	Jamie_Alpha_SPB_83.29646.29646.2	1.8253	0.1137	94.1	1903.8722	1902.2444	8426.3	445	3.559	30.0	1	K.LKTTQKHQIVETIFSK.V
*	Jamie_Alpha_SPB_14.05030.05030.2	2.1838	0.0614	24.7	1265.1721	1264.4644	4498.9	8	3.395	54.2	1	A.TTIYVAGTPGVGK.T
*	Jamie_Alpha_SPB_104.37292.37292.2	1.9563	0.055	12.1	1661.6122	1661.7197	4389.8	156	3.184	39.3	1	K.KNGSQEQELGDIVDE.I
YIL075C	2	2	6.0%	945	104232	6.2	U	RPN2 SGDID:S000001337, Chr IX from 220697-217860, reverse complement, Verified ORF, "Subunit of the 26S proteasome, substrate of the N-acetyltransferase Nat1p" 
*	Jamie_Alpha_SPB_56.19936.19936.3	2.1226	0.2294	13.5	4465.8843	4464.001	8490.2	111	4.318	12.5	1	V.DVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALG.M
*	Jamie_Alpha_SPB_43.15488.15488.2	1.7676	0.0728	14.7	1236.5521	1234.382	4147.1	439	3.331	50.0	1	A.CVAQGIMNAGGR.N
Reverse_YDR206W	2	2	6.0%	884	100000	9.0	U	EBS1 SGDID:S000002614, Chr IV from 862049-864703, Verified ORF, "Protein of unknown function, contains a putative RNA recognition motif, deletion results in short telomeres; similar to Est1p, may be partially redundant with Est1p for telomere maintenance" 
*	Jamie_Alpha_SPB_94.33842.33842.3	2.3724	0.2045	15.4	3772.6143	3771.191	8486.9	9	4.233	19.4	1	T.NSQADFPFQMYKGVDQQMPQQFMQRQAQAYAS.S
*	Jamie_Alpha_SPB_45.16014.16014.2	1.8946	0.2075	67.6	2362.4922	2361.6008	5652.6	11	4.298	27.5	1	Q.HCVDNAPIQENVGQMSKAFSK.E
YDR052C	2	2	6.0%	704	80690	9.3	U	DBF4 SGDID:S000002459, Chr IV from 560622-558508, reverse complement, Verified ORF, "Regulatory subunit of Cdc7p-Dbf4p kinase complex, required for Cdc7p kinase activity and initiation of DNA replication; phosphorylates the Mcm2-7 family of proteins; cell cycle regulated" 
*	Jamie_Alpha_SPB_65.23281.23281.4	3.3334	0.175	11.9	2841.0166	2839.1057	4242.0	29	3.648	22.5	1	I.GSFGRCPFIGDRNYDESSYKRVVK.R
*	Jamie_Alpha_SPB_17.05835.05835.2	1.8298	0.1052	93.1	1947.6921	1950.2914	7261.1	302	3.764	29.4	1	K.ELAATPKLNHPVLATFAR.Q
Reverse_YLR214W	2	2	6.0%	686	78854	9.2	U	FRE1 SGDID:S000004204, Chr XII from 568569-570629, Verified ORF, "Ferric reductase and cupric reductase, reduces siderophore-bound iron and oxidized copper prior to uptake by transporters; expression induced by low copper and iron levels" 
*	Jamie_Alpha_SPB_51.18195.18195.2	1.5601	0.1358	25.4	1431.2922	1428.7617	5095.4	348	3.267	41.7	1	V.KSLLVRTIGKNAK.V
*	Jamie_Alpha_SPB_23.08338.08338.4	2.7193	0.0080	39.1	3165.8164	3163.6353	6565.3	118	2.681	21.0	1	K.MDELTYVKISSCQSALKMLASDLTKNSK.S
Reverse_YIL105C	2	2	6.0%	686	77995	7.9	U	SLM1 SGDID:S000001367, Chr IX from 169638-167578, reverse complement, Verified ORF, "Phosphoinositide PI4,5P(2) binding protein, forms a complex with Slm2p; acts downstream of Mss4p in a pathway regulating actin cytoskeleton organization in response to stress; subunit of and phosphorylated by the TORC2 complex" 
*	Jamie_Alpha_SPB_78.27828.27828.2	1.7179	0.1574	12.6	2400.372	2397.5144	8683.3	69	4.26	28.6	1	N.TNTQNDLKPTVTSGVYNSNIDD.N
*	Jamie_Alpha_SPB_71.25422.25422.2	1.4966	0.1725	11.2	2174.0923	2176.6072	11346.7	18	4.047	30.6	1	Q.ISAIETLYVIVSKIVNRWA.S
Reverse_YJL162C	2	2	6.0%	482	55502	8.5	U	JJJ2 SGDID:S000003698, Chr X from 115624-114176, reverse complement, Uncharacterized ORF, "Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein" 
*	Jamie_Alpha_SPB_18.06392.06392.2	1.7435	0.0539	82.1	1746.0122	1747.9517	6885.1	1	3.101	46.2	1	K.DGIEDRRFLLDKNR.D
*	Jamie_Alpha_SPB_20.07218.07218.2	1.7287	0.0789	10.5	1845.4122	1848.1216	6184.9	62	3.139	35.7	1	G.QSEKAKTKFIHCNKK.P
Reverse_YKL092C	2	2	5.9%	1104	126663	8.8	U	BUD2 SGDID:S000001575, Chr XI from 269103-265789, reverse complement, Verified ORF, "GTPase activating factor for Rsr1p/Bud1p required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types" 
*	Jamie_Alpha_SPB_71.25303.25303.4	2.2434	0.0738	51.0	4509.6963	4509.0103	8237.5	2	3.086	16.3	1	R.MIRSLKTPSFRNGLNGKGQSNPLTLYDDKAGNESSTGHVSTK.N
*	Jamie_Alpha_SPB_50.17931.17931.2	1.4407	0.1339	19.2	2563.4521	2562.0298	8907.9	28	3.565	22.7	1	N.EMSSSSKYILNSVMSLNANMLLK.E
YCR011C	2	2	5.9%	1049	117231	5.2	U	ADP1 SGDID:S000000604, Chr III from 136870-133721, reverse complement, Verified ORF, "Putative ATP-dependent permease of the ABC transporter family of proteins" 
*	Jamie_Alpha_SPB_85.30559.30559.4	2.723	0.0129	41.4	3494.5764	3499.0107	4429.5	470	2.831	19.0	1	K.VLEELRIIDIKDRIIGNEFDRGISGGEKRR.V
*	Jamie_Alpha_SPB_97.34896.34896.4	3.0108	0.1862	15.9	3546.0166	3542.9917	5152.6	427	3.519	18.3	1	S.NVLNGDLPTGQQSAGFLQQLSILNSRSFKNMY.R
Reverse_YGL093W	2	2	5.9%	917	104825	5.2	U	SPC105 SGDID:S000003061, Chr VII from 334889-337642, Verified ORF, "Protein required for accurate chromosome segregation, localizes to the nuclear side of the spindle pole body; forms a complex with Ydr532cp" 
*	Jamie_Alpha_SPB_65.23244.23244.4	2.6081	0.02	41.9	4485.6567	4488.6157	9882.5	17	3.2	15.8	1	R.TKEVIKNGNDDVNEGDEEDDTATQMGTDETGPEITFVDNSR.T
*	Jamie_Alpha_SPB_82.29494.29494.2	1.7007	0.1706	11.1	1511.0922	1512.7953	5018.8	12	4.142	41.7	1	I.IRTPIRVGPNELF.S
YGR204W	2	2	5.9%	946	102205	6.8	U	ADE3 SGDID:S000003436, Chr VII from 905939-908779, Verified ORF, "Cytoplasmic trifunctional enzyme C1-tetrahydrofolate synthase, involved in single carbon metabolism and required for biosynthesis of purines, thymidylate, methionine, and histidine" 
*	Jamie_Alpha_SPB_73.26056.26056.3	2.0833	0.2198	15.7	3480.2344	3475.8833	7873.3	493	4.408	17.7	1	V.QLPLPAHLDEDRITSRVLAEKDVDGFGPTNIG.E
*	Jamie_Alpha_SPB_28.09804.09804.2	1.6879	0.1067	20.9	2452.5923	2454.0254	7648.3	478	4.199	23.9	1	T.PVPGGVGPMTVAMLMQNTLIAAKR.Q
Reverse_YDR137W	2	2	5.9%	663	75317	5.8	U	RGP1 SGDID:S000002544, Chr IV from 728254-730245, Verified ORF, "Subunit of a Golgi membrane exchange factor (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p" 
*	Jamie_Alpha_SPB_26.09190.09190.2	1.6248	0.0989	13.5	2517.8123	2517.891	4920.8	118	3.61	22.5	1	D.IDRSVNQNSEVLEIFNKKVRK.V
*	Jamie_Alpha_SPB_99.35515.35515.4	2.1079	0.1416	73.2	4194.3765	4192.716	6181.6	23	3.314	18.1	1	R.SVNQNSEVLEIFNKKVRKVFENDELPSDIDIISSKR.R
YDR189W	2	2	5.9%	666	74679	5.2	U	SLY1 SGDID:S000002597, Chr IV from 838387-840387, Verified ORF, "Hydrophilic protein involved in vesicle trafficking between the ER and Golgi; SM (Sec1/Munc-18) family protein that binds the tSNARE Sed5p and stimulates its assembly into a trans-SNARE membrane-protein complex" 
*	Jamie_Alpha_SPB_62.22256.22256.2	1.8772	0.1483	15.1	1639.9122	1638.6854	5579.4	22	3.822	40.0	1	F.VINTNSSSTSTLQGND.S
*	Jamie_Alpha_SPB_73.26092.26092.2	1.354	0.1387	12.6	2440.7522	2442.7896	7949.7	190	3.954	25.0	1	K.VMYGSTAITTPAEFLNEISRLGA.S
YBL075C	3	3	5.9%	649	70547	5.2	U	SSA3 SGDID:S000000171, Chr II from 86446-84497, reverse complement, Verified ORF, "ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" 
	Jamie_Alpha_SPB_15.05358.05358.2	2.1745	0.1566	98.2	1677.4722	1676.6964	5051.9	1	4.066	53.3	1	K.ATAGDTHLGGEDFDNR.L
	Jamie_Alpha_SPB_14.05055.05055.2	3.3353	0.3562	100.0	1505.2322	1504.5126	5409.1	1	6.666	61.5	1	T.AGDTHLGGEDFDNR.L
*	Jamie_Alpha_SPB_27.09697.09697.2	1.8843	0.0816	21.2	2549.2522	2548.815	6301.4	8	3.51	31.0	1	K.IQKLVSDFFNGKEPNRSINPDE.A
YEL030W	3	3	5.9%	644	70085	6.3	U	ECM10 SGDID:S000000756, Chr V from 94644-96578, Verified ORF, "Heat shock protein of the Hsp70 family, localized in mitochondrial nucleoids, plays a role in protein translocation, interacts with Mge1p in an ATP-dependent manner; overexpression induces extensive mitochondrial DNA aggregations" 
*	Jamie_Alpha_SPB_30.10524.10524.2	2.005	0.1307	30.1	1763.8722	1765.1497	7040.3	55	3.46	36.7	1	T.APLIDRTVDPVKKALK.D
*	Jamie_Alpha_SPB_8.02904.02904.1	1.037	0.0068	78.0	844.82	845.9713	1964.9	37	2.851	41.7	1	R.ELVKDNK.L
*	Jamie_Alpha_SPB_15.05175.05175.2	1.7	0.125	24.8	1923.2122	1925.0862	6051.9	5	3.456	39.3	1	I.DRMVNEAERYKNQDR.A
Reverse_YMR213W	2	2	5.9%	590	67731	8.2	U	CEF1 SGDID:S000004826, Chr XIII from 693380-695152, Verified ORF, "Essential splicing factor; associated with Prp19p and the spliceosome, contains an N-terminal c-Myb DNA binding motif necessary for cell viability but not for Prp19p association, evolutionarily conserved and homologous to S. pombe Cdc5p" 
*	Jamie_Alpha_SPB_94.33746.33746.3	2.8464	0.2388	45.0	2372.4844	2369.9058	6660.4	75	4.252	27.6	1	G.YKKKPKKIAVNIGAQKLERR.K
*	Jamie_Alpha_SPB_26.09156.09156.2	1.9812	0.1062	32.8	1691.2322	1693.7767	6763.3	78	3.316	42.9	1	R.AEALMEKEEDELDGN.D
YHR196W	2	2	5.9%	575	65272	4.9	U	UTP9 SGDID:S000001239, Chr VIII from 491931-493658, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_95.34200.34200.3	1.5549	0.1216	50.7	3956.6343	3957.683	7406.4	145	3.418	14.4	1	K.HTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLR.R
*	Jamie_Alpha_SPB_113.40683.40683.1	1.3134	0.0662	27.8	757.79	756.9236	3913.0	241	3.645	50.0	1	V.LLGIQGR.L
Reverse_YKL181W	2	2	5.9%	427	47047	5.7	U	PRS1 SGDID:S000001664, Chr XI from 107321-108604, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, involved in nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes" 
*	Jamie_Alpha_SPB_50.17726.17726.3	2.1959	0.0291	38.0	2324.5745	2324.7993	6387.1	152	3.037	26.4	1	R.KMKCQKSYPFQPIVATIKR.A
*	Jamie_Alpha_SPB_62.22118.22118.2	1.7168	0.1339	29.3	2523.2722	2525.8457	9155.3	1	3.614	31.0	1	K.CQKSYPFQPIVATIKRASGGRC.A
Reverse_YCR092C	3	3	5.8%	1047	119753	7.4	U	MSH3 SGDID:S000000688, Chr III from 279903-276760, reverse complement, Verified ORF, "Mismatch repair protein, forms dimers with Msh2p that mediate repair of insertion or deletion mutations and removal of nonhomologous DNA ends, contains a PCNA (Pol30p) binding motif required for genome stability" 
*	Jamie_Alpha_SPB_76.27199.27199.2	1.8225	0.113	30.8	1505.7922	1505.7979	7091.7	74	3.327	45.5	1	K.LYKRIEALEEKL.Q
*	Jamie_Alpha_SPB_28.10074.10074.4	3.0092	0.0715	65.4	3236.9766	3239.3936	6431.2	92	3.06	19.2	1	K.RAKKKVFDEEGEEEDDEAEVNEDSRRK.M
*	Jamie_Alpha_SPB_89.31756.31756.2	1.5094	0.0677	77.0	2391.612	2393.5261	8939.5	29	3.255	26.2	1	K.AFDIDNFTTSTGSTKESNKSNK.S
Reverse_YPL089C	2	2	5.8%	676	73484	9.3	U	RLM1 SGDID:S000006010, Chr XVI from 381147-379117, reverse complement, Verified ORF, "MADS-box transcription factor, component of the protein kinase C-mediated MAP kinase pathway involved in the maintenance of cell integrity; phosphorylated and activated by the MAP-kinase Slt2p" 
*	Jamie_Alpha_SPB_68.24379.24379.4	3.0265	0.2644	25.8	3175.3765	3176.6562	6302.2	26	4.517	21.3	1	G.KQLTLPGSASASLPSIKSSRSTKNEKMIQS.S
*	Jamie_Alpha_SPB_24.08688.08688.2	1.3089	0.0819	74.4	1040.0122	1040.2974	3154.6	30	3.812	50.0	1	R.LVPRASLKR.R
YOR192C	2	2	5.8%	599	67186	7.2	U	YOR192C SGDID:S000005718, Chr XV from 700567-698768, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_47.16700.16700.2	1.5422	0.1042	10.6	1967.4722	1970.2415	9605.9	11	3.935	34.4	1	L.LTILFALANSCPGYDWK.V
*	Jamie_Alpha_SPB_105.37747.37747.2	1.4914	0.0685	76.2	2157.4521	2159.446	8698.0	147	3.461	26.5	1	R.QYSVTNAFVLKGEYYFTK.G
Reverse_YOL019W	2	2	5.8%	551	60901	6.4	U	YOL019W SGDID:S000005379, Chr XV from 288898-290553, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and vacuole" 
*	Jamie_Alpha_SPB_20.06976.06976.2	1.5821	0.0949	10.7	1523.0521	1523.6053	6088.6	291	3.178	38.5	1	S.GNNRVYNNSVSGNK.L
*	Jamie_Alpha_SPB_25.08775.08775.2	2.0104	0.1284	13.4	1909.8522	1910.3655	8342.8	10	3.58	35.3	1	T.ISGIILFAMTVFQSLGVL.F
Reverse_YDR195W	2	2	5.8%	533	59819	9.6	U	REF2 SGDID:S000002603, Chr IV from 848594-850195, Verified ORF, "RNA-binding protein involved in the cleavage step of mRNA 3'-end formation prior to polyadenylation, and in snoRNA maturation; part of holo-CPF subcomplex APT, which associates with 3'-ends of snoRNA- and mRNA-encoding genes" 
*	Jamie_Alpha_SPB_71.25285.25285.3	2.8778	0.1742	16.5	2183.6042	2186.4697	5822.1	135	3.543	28.9	1	L.QTPSVQLGQNPLDDGYVKIL.Q
*	Jamie_Alpha_SPB_20.07026.07026.2	1.7455	0.0132	73.6	1186.4521	1188.4563	5319.3	118	2.905	50.0	1	K.SSALKKKLNAK.T
YBL106C	2	2	5.7%	1010	111678	8.8	U	SRO77 SGDID:S000000202, Chr II from 13879-10847, reverse complement, Verified ORF, "Protein with roles in exocytosis and cation homeostasis; functions in docking and fusion of post-Golgi vesicles with plasma membrane; homolog of Sro7p and Drosophila lethal giant larvae tumor suppressor; interacts with SNARE protein Sec9p" 
*	Jamie_Alpha_SPB_42.15068.15068.3	2.7123	0.1983	16.9	3568.6143	3572.1726	6746.5	35	4.093	19.2	1	W.MLIGLESGSILIYDVDRNQMSKLKIENFQKS.V
*	Jamie_Alpha_SPB_59.21049.21049.3	2.2468	0.1778	82.9	2893.9143	2894.344	5549.4	449	3.949	20.2	1	K.TILVDVSDRGPTNVKQGFIPSTVIHAK.K
Reverse_YMR066W	3	3	5.7%	898	104748	8.6	U	SOV1 SGDID:S000004670, Chr XIII from 401540-404236, Uncharacterized ORF, "Mitochondrial protein of unknown function" 
*	Jamie_Alpha_SPB_61.21699.21699.4	2.525	0.0987	66.9	4666.2163	4664.3286	7828.9	361	3.603	14.1	1	-.AKIKLKNVDEILEELLTFETGLEKFADEVMLFTSCDSKEK.W
*	Jamie_Alpha_SPB_44.15544.15544.3	2.0147	0.0276	29.9	4296.804	4296.796	7467.2	62	2.912	15.0	1	K.NVDEILEELLTFETGLEKFADEVMLFTSCDSKEKWK.I
*	Jamie_Alpha_SPB_8.02690.02690.2	2.0223	0.193	81.8	1007.8522	1007.14124	5817.0	12	4.067	75.0	1	A.ILASSCLSR.N
Reverse_YOR038C	2	2	5.7%	875	98445	8.3	U	HIR2 SGDID:S000005564, Chr XV from 405387-402760, reverse complement, Verified ORF, "Non-essential transcriptional corepressor involved in the cell cycle-regulated transcription of histone H2A, H2B, H3, and H4 genes; recruits Swi-Snf complexes to histone gene promoters; promotes heterochromatic gene silencing with Asf1p" 
*	Jamie_Alpha_SPB_18.06210.06210.4	3.8056	0.1679	28.3	3256.1765	3261.6218	6203.7	28	4.271	19.6	1	I.TPRQENGSGNKVDLILNPNNIPSYKFTSR.I
*	Jamie_Alpha_SPB_64.22844.22844.2	1.4829	0.1587	24.8	2313.8323	2314.7336	9236.4	3	4.076	27.5	1	R.IKPTALRIRSFSTNPLLLGTD.L
Reverse_YFR002W	2	2	5.7%	839	96174	6.8	U	NIC96 SGDID:S000001898, Chr VI from 150011-152530, Verified ORF, "Component of the nuclear pore complex, required for nuclear pore formation; forms a subcomplex with Nsp1p, Nup57p, and Nup49p" 
*	Jamie_Alpha_SPB_29.10233.10233.2	1.6402	0.1395	26.4	2695.4521	2695.1462	6383.8	11	4.232	22.9	1	R.TSSDIKFLKLSALGIALHVADMESF.T
*	Jamie_Alpha_SPB_16.05799.05799.3	2.37	0.036	42.1	2656.3743	2655.8875	6751.8	81	3.636	22.7	1	K.ERLINNENVNLRSENSNLINNGK.N
YLR182W	2	2	5.7%	803	90560	4.9	U	SWI6 SGDID:S000004172, Chr XII from 517942-520353, Verified ORF, "Transcription cofactor, forms complexes with DNA-binding proteins Swi4p and Mbp1p to regulate transcription at the G1/S transition; involved in meiotic gene expression; localization regulated by phosphorylation; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_103.36843.36843.4	1.7725	0.0191	25.4	4918.0166	4912.4893	10299.6	50	3.108	14.8	1	R.PVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNGKAKKIRSQLLK.N
*	Jamie_Alpha_SPB_53.18799.18799.2	1.7562	0.1978	98.3	2123.3323	2124.466	9536.4	25	4.192	33.3	1	K.MVSKGDYDGQKNGKAKKIR.S
YBR172C	2	2	5.7%	740	81397	8.8	U	SMY2 SGDID:S000000376, Chr II from 581367-579145, reverse complement, Verified ORF, "Protein of unknown function that interacts with Myo2p; has similarity to S. pombe Mpd2" 
*	Jamie_Alpha_SPB_86.30998.30998.4	3.1574	0.1566	12.5	3054.0566	3054.4622	4976.8	209	3.224	21.2	1	T.QMMSQWYIGGYFASTLQISRLGSTPET.L
*	Jamie_Alpha_SPB_58.20751.20751.2	1.7271	0.0984	87.8	1884.4922	1886.2081	7631.6	64	3.807	32.1	1	R.NRELKRKEEARLSKK.Q
YBR123C	2	2	5.7%	649	73554	5.4	U	TFC1 SGDID:S000000327, Chr II from 486685-484736, reverse complement, Verified ORF, "One of six subunits of the RNA polymerase III transcription initiation factor complex (TFIIIC); part of the TauA globular domain of TFIIIC that binds DNA at the BoxA promoter sites of tRNA and similar genes; human homolog is TFIIIC-63" 
*	Jamie_Alpha_SPB_83.29587.29587.2	1.9014	0.145	14.9	1774.1921	1774.8785	7109.7	207	3.789	31.2	1	I.PDSSADQAPPLIADEFT.L
*	Jamie_Alpha_SPB_72.25959.25959.3	2.4038	0.1533	80.6	2194.6143	2195.3809	5459.9	66	3.669	27.6	1	K.ESMVPENKNSEEGMGVNTNK.D
YMR199W	2	2	5.7%	546	62050	5.8	U	CLN1 SGDID:S000004812, Chr XIII from 662643-664283, Verified ORF, "G1 cyclin involved in regulation of the cell cycle; activates Cdc28p kinase to promote the G1 to S phase transition; late G1 specific expression depends on transcription factor complexes, MBF (Swi6p-Mbp1p) and SBF (Swi6p-Swi4p)" 
*	Jamie_Alpha_SPB_33.11655.11655.2	2.4235	0.1678	99.5	2367.672	2369.8657	9425.5	1	5.033	37.5	1	K.RVVLKDQAKLVVGTCLWLAAK.T
*	Jamie_Alpha_SPB_40.14173.14173.2	1.1428	0.2301	10.3	1065.1522	1063.1124	2897.4	295	3.64	44.4	1	Q.NTGELTNRAS.S
YBR274W	2	2	5.7%	527	60017	6.3	U	CHK1 SGDID:S000000478, Chr II from 749589-751172, Verified ORF, "DNA damage checkpoint effector kinase, mediates mitotic cell cycle arrest via phosphorylation of Pds1p; phosphorylated by checkpoint signal transducer kinase Mec1p; homolog of S. pombe and mammalian Chk1 checkpoint kinase" 
*	Jamie_Alpha_SPB_23.08313.08313.2	1.5318	0.1767	12.5	981.47217	981.99097	2495.5	53	3.532	57.1	1	L.YSEEGYYA.D
*	Jamie_Alpha_SPB_15.05264.05264.3	2.471	0.0555	50.8	2390.9944	2388.481	6193.3	57	3.446	26.2	1	R.AFTSYDSNTNYNSGTGMTQEAK.W
Reverse_YMR209C	2	2	5.7%	457	52246	7.6	U	YMR209C SGDID:S000004822, Chr XIII from 687283-685910, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_34.12109.12109.2	1.5466	0.0579	79.8	1127.7322	1126.2572	3024.4	25	3.185	55.6	1	R.FLLGNYGEGR.A
*	Jamie_Alpha_SPB_37.13182.13182.2	2.5586	0.2309	27.3	1796.8722	1797.9597	8702.5	35	4.781	40.0	1	Q.YNIKSLNSQDASISKE.V
YNL254C	2	2	5.7%	401	46212	7.4	U	YNL254C SGDID:S000005198, Chr XIV from 169249-168044, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_118.42438.42438.2	1.6767	0.0568	83.6	1011.65216	1014.23096	5269.5	21	3.993	61.1	1	-.MVGPGLGINR.V
*	Jamie_Alpha_SPB_45.16190.16190.2	1.4813	0.1337	21.1	1505.3922	1505.622	5275.0	36	3.846	41.7	1	K.RGKIDSITEDEIE.V
YFR019W	5	5	5.6%	2278	257447	8.3	U	FAB1 SGDID:S000001915, Chr VI from 184490-191326, Verified ORF, "1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis" 
*	Jamie_Alpha_SPB_95.33918.33918.4	3.3509	0.1784	14.7	3802.5366	3796.8706	6218.8	383	4.061	16.2	1	L.YDDSSPLQDKASSSAASRLTDRKFSNSSGSNNNSNS.N
*	Jamie_Alpha_SPB_28.09944.09944.2	1.5578	0.172	29.6	1216.3722	1217.5436	4443.4	10	3.827	55.6	1	R.HLKNPRILLI.M
*	Jamie_Alpha_SPB_41.14728.14728.4	2.6782	0.1134	76.4	4298.0566	4298.997	8635.2	4	3.443	18.0	1	R.GCNPELGGTILLRGDSLENLRKIKQVSEFMVYAIFSLK.L
*	Jamie_Alpha_SPB_41.14526.14526.4	2.8166	0.162	10.8	2322.6965	2328.6887	5081.4	31	3.902	28.9	1	R.GDSLENLRKIKQVSEFMVYA.I
*	Jamie_Alpha_SPB_22.07846.07846.4	2.0567	0.0089	26.3	5153.6167	5151.947	9173.5	235	2.897	12.0	1	K.TLDDRFIIKELSHAELEAFIKFAPSYFEYMAQAMFHDLPTTLAK.V
Reverse_YAL029C	4	4	5.6%	1471	169343	7.6	U	MYO4 SGDID:S000000027, Chr I from 92271-87856, reverse complement, Verified ORF, "One of two type V myosins; required for mother-specific HO expression, for the bud tip localization of ASH1 and IST2 mRNA; facilitates growth and orientation of ER tubules along with She3p" 
*	Jamie_Alpha_SPB_42.15001.15001.2	1.8518	0.0527	11.2	1796.8322	1797.0616	5871.6	157	3.143	34.4	1	H.IPGLVNDGNVETVNVKK.L
*	Jamie_Alpha_SPB_87.31263.31263.2	1.2806	0.1678	21.3	3005.152	3006.6882	6440.8	21	3.389	20.8	1	R.IKKQIIICIENMKNTRLKELFALMG.A
*	Jamie_Alpha_SPB_118.42423.42423.2	1.8494	0.1136	27.3	1645.7922	1644.071	7249.2	59	3.968	38.5	1	L.KELFALMGAKFFIK.T
*	Jamie_Alpha_SPB_88.31530.31530.4	3.203	0.1592	15.3	3767.0964	3772.2678	8260.6	194	3.568	17.6	1	M.IYKASVTKGAGSEGSVVVTQNAKEHVMFRYAEEAI.A
YDR128W	3	3	5.6%	1148	130946	5.9	U	YDR128W SGDID:S000002535, Chr IV from 709544-712990, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_66.23786.23786.4	2.8935	0.1806	12.8	3175.5764	3178.5068	4030.7	19	4.021	21.8	1	-.MCSSINEGPYNSPTFGKSLSLKVDGGFNAV.S
*	Jamie_Alpha_SPB_35.12519.12519.2	1.8848	0.1854	98.2	1965.7122	1964.1454	9680.7	26	4.845	36.1	1	R.PKRYVDTLGLGGGTNGDSR.T
*	Jamie_Alpha_SPB_26.09092.09092.3	2.5625	0.1915	15.9	1669.9143	1673.7332	3530.8	1	4.297	41.1	1	E.GTIVFNDNESQNTSF.W
YLR096W	2	2	5.6%	1147	128338	9.4	U	KIN2 SGDID:S000004086, Chr XII from 332591-336034, Verified ORF, "Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; closely related to Kin1p" 
*	Jamie_Alpha_SPB_101.36382.36382.3	2.4494	0.0349	45.5	2255.0344	2256.6506	5520.9	25	3.041	27.6	1	K.KGKVDYPSHLSIEVISLLTR.M
*	Jamie_Alpha_SPB_47.16808.16808.4	3.07	0.1691	13.0	5004.3765	5005.603	7935.4	58	3.623	13.6	1	Q.QDDILTTSRAQNINNVNGQTEQTNTSGIKERPPIKFEIHIVKVR.I
YDR081C	2	2	5.6%	925	103944	6.4	U	PDC2 SGDID:S000002488, Chr IV from 610077-607300, reverse complement, Verified ORF, "Transcription factor required for the synthesis of the glycolytic enzyme pyruvate decarboxylase, required for high level expression of both the THI and the PDC genes" 
*	Jamie_Alpha_SPB_100.35894.35894.3	2.153	0.263	42.1	4006.7944	4004.5315	8954.4	364	4.464	14.4	1	S.KIPPKDLFTLDEAFLSYNLPLDYAQYEASSIQRR.I
*	Jamie_Alpha_SPB_35.12484.12484.3	2.7187	0.1735	15.1	1808.8444	1808.9022	5998.0	69	3.841	33.8	1	P.TGGSNLPDSNNLHLPGNT.G
YGL008C	6	7	5.6%	918	99619	5.1	U	PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" 
*	Jamie_Alpha_SPB_45.15922.15922.2	3.631	0.3842	100.0	2653.5322	2653.9092	9294.1	2	6.778	37.0	1	R.IVTEDCFLQIDQSAITGESLAVDK.H
	Jamie_Alpha_SPB_32.11359.11359.3	2.8551	0.1455	10.3	3151.0745	3150.3855	8484.9	1	3.59	26.9	1	L.KTVEEDHPIPEDVHENYENKVAELASR.G
	Jamie_Alpha_SPB_16.05724.05724.3	5.0986	0.3852	100.0	2294.4243	2295.3806	8398.3	1	8.096	50.0	1	K.TVEEDHPIPEDVHENYENK.V
	Jamie_Alpha_SPB_16.05791.05791.2	3.3333	0.4781	100.0	2294.4521	2295.3806	7919.0	1	8.573	55.6	2	K.TVEEDHPIPEDVHENYENK.V
	Jamie_Alpha_SPB_28.09818.09818.2	3.4377	0.3424	100.0	2778.7922	2778.9458	8430.1	1	7.403	43.5	1	K.TVEEDHPIPEDVHENYENKVAELA.S
	Jamie_Alpha_SPB_28.10128.10128.3	5.8041	0.5087	100.0	3020.9644	3022.2114	6785.5	1	8.125	37.0	1	K.TVEEDHPIPEDVHENYENKVAELASR.G
YBR133C	5	5	5.6%	827	95153	6.4	U	HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" 
*	Jamie_Alpha_SPB_47.16681.16681.2	2.7008	0.3784	100.0	2580.9922	2581.6624	9258.2	1	6.276	35.7	1	K.DTVQDEDDFTVEFSQSSLNEFK.I
*	Jamie_Alpha_SPB_30.10597.10597.2	3.2996	0.4142	100.0	2809.7922	2811.0374	5745.6	1	6.902	45.7	1	K.ALEPSNELPRHEDLEEDVPEVHVR.V
*	Jamie_Alpha_SPB_30.10602.10602.3	3.5847	0.2369	100.0	2812.8245	2811.0374	6367.8	1	5.244	32.6	1	K.ALEPSNELPRHEDLEEDVPEVHVR.V
*	Jamie_Alpha_SPB_23.08203.08203.2	4.835	0.4937	100.0	1704.7522	1703.8058	5965.7	1	9.368	80.8	1	R.HEDLEEDVPEVHVR.V
*	Jamie_Alpha_SPB_23.08188.08188.3	3.1947	0.2543	100.0	1705.3444	1703.8058	6332.8	3	5.156	46.2	1	R.HEDLEEDVPEVHVR.V
Reverse_YLR347C	2	2	5.6%	861	94776	4.6	U	KAP95 SGDID:S000004339, Chr XII from 826412-823827, reverse complement, Verified ORF, "Karyopherin beta, forms a dimeric complex with Srp1p (Kap60p) that mediates nuclear import of cargo proteins via a nuclear localization signal (NLS), interacts with nucleoporins to guide transport across the nuclear pore complex" 
*	Jamie_Alpha_SPB_40.14163.14163.2	2.4	0.2031	82.5	1780.0721	1779.9475	6781.3	116	4.135	40.0	1	P.LHQQPDISEAVSDAIR.G
*	Jamie_Alpha_SPB_27.09481.09481.3	2.6832	0.2029	14.2	3458.3643	3456.1016	4445.9	8	4.109	20.2	1	V.MIKMLEPWAGHPLEIDAIAAILQAAANAIRPE.I
Reverse_YPR003C	2	2	5.6%	754	83384	8.3	U	YPR003C SGDID:S000006207, Chr XVI from 563765-561501, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_60.21620.21620.4	3.0732	0.1693	15.9	3330.4966	3326.8987	5075.3	24	3.779	20.0	1	S.VFTIVTSIDILSVNEKHLTISEVAQGVVLSI.A
*	Jamie_Alpha_SPB_22.07686.07686.2	1.8338	0.0784	90.3	1147.3121	1150.2952	5001.7	33	3.899	50.0	1	R.GRGLLSNNSTM.-
YKL112W	2	2	5.6%	731	81752	5.1	U	ABF1 SGDID:S000001595, Chr XI from 226214-228409, Verified ORF, "DNA binding protein with possible chromatin-reorganizing activity involved in transcriptional activation, gene silencing, and DNA replication and repair" 
*	Jamie_Alpha_SPB_96.34369.34369.3	2.1704	0.2282	14.7	2337.3245	2341.3232	6028.0	341	3.633	23.8	1	N.EDNDNNNGSNNKVSNDSKLDF.V
*	Jamie_Alpha_SPB_81.29094.29094.2	1.1322	0.0976	69.3	2310.5923	2309.5815	6656.1	51	3.621	26.3	1	R.ETAQLAIDKINSYKRSIDDK.N
Reverse_YBR169C	2	2	5.6%	693	77621	5.6	U	SSE2 SGDID:S000000373, Chr II from 575991-573910, reverse complement, Verified ORF, "Member of the heat shock protein 70 (HSP70) family; may be involved in protein folding; localized to the cytoplasm; highly homologous to the heat shock protein Sse1p" 
*	Jamie_Alpha_SPB_18.06388.06388.2	1.7486	0.1713	10.1	2264.172	2265.4822	7663.6	53	4.17	30.6	1	Y.IYEELANKRDETEAVLKDQ.N
	Jamie_Alpha_SPB_118.42415.42415.2	1.5342	0.0888	10.9	2197.7122	2197.5483	7513.7	429	3.294	26.3	1	D.NVIRVPNLGAIRAADAINYR.Q
Reverse_YFR029W	2	2	5.6%	678	76286	7.5	U	PTR3 SGDID:S000001925, Chr VI from 210925-212961, Verified ORF, "Component of the SPS plasma membrane amino acid sensor system (Ssy1p-Ptr3p-Ssy5p), which senses external amino acid concentration and transmits intracellular signals that result in regulation of expression of amino acid permease genes" 
*	Jamie_Alpha_SPB_66.23540.23540.3	2.5771	0.1928	17.0	1900.4944	1898.2305	4148.0	246	4.278	29.7	1	N.ANHMKSAVIHFLELLSS.K
*	Jamie_Alpha_SPB_71.25276.25276.2	1.4701	0.1051	11.5	2545.5322	2543.6914	8479.9	389	3.165	22.5	1	R.QCIPCATQKNSTERCLDNFLS.E
YCR048W	2	2	5.6%	610	71613	8.3	U	ARE1 SGDID:S000000644, Chr III from 211924-213756, Verified ORF, "Acyl-CoA:sterol acyltransferase, isozyme of Are2p; endoplasmic reticulum enzyme that contributes the major sterol esterification activity in the absence of oxygen" 
*	Jamie_Alpha_SPB_19.06814.06814.2	1.6644	0.1283	26.8	1374.1122	1373.5077	5623.4	1	3.871	54.5	1	Y.VSFFGDVSFDPR.P
*	Jamie_Alpha_SPB_34.12003.12003.2	1.8445	0.0654	11.4	2291.3523	2289.545	8654.8	305	3.553	28.6	1	K.ATVKTTVKTTEKTDKADAPPGE.K
YGL150C	3	3	5.5%	1489	171454	5.7	U	INO80 SGDID:S000003118, Chr VII from 225578-221109, reverse complement, Verified ORF, "ATPase that forms a large complex, containing actin and several actin-related proteins, that has chromatin remodeling activity and 3' to 5' DNA helicase activity in vitro; shows similarity to the Snf2p family of ATPases" 
*	Jamie_Alpha_SPB_90.32418.32418.3	2.7888	0.2284	10.7	2914.7344	2915.513	7210.7	2	4.322	24.0	1	N.DNDNENENDNDSDNDDEEENGEEDE.E
*	Jamie_Alpha_SPB_26.09393.09393.4	2.6659	0.1595	84.6	4776.2964	4774.399	7431.3	50	3.426	14.6	1	R.RKLNNNTANGADDANKRKFNTRHGLPTYGMKMNAKEARAIQR.H
*	Jamie_Alpha_SPB_23.08336.08336.2	2.3858	0.1202	39.4	1777.1322	1775.9629	6887.0	4	3.837	46.4	1	L.GDKIEIDVLCDLTQR.Q
YKL209C	3	3	5.5%	1290	144765	8.0	U	STE6 SGDID:S000001692, Chr XI from 46296-42424, reverse complement, Verified ORF, "ATP-binding cassette (ABC) transporter required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport, contains 12 transmembrane domains and two ATP binding domains, expressed only in MATa cells" 
*	Jamie_Alpha_SPB_117.41970.41970.4	3.4903	0.1911	10.6	3603.8564	3608.135	6920.1	82	4.385	18.8	1	A.ITSILTGRVFDLLSVFVANGSHQGLYSQLVQRS.M
*	Jamie_Alpha_SPB_103.36921.36921.3	1.8466	4.0E-4	24.2	3197.4844	3195.707	7971.7	187	2.718	20.2	1	K.FKEIILNCNTFFIKSCFFVAANAGILR.F
*	Jamie_Alpha_SPB_15.05364.05364.3	1.997	0.2031	14.5	1210.8844	1207.2892	3534.5	138	3.72	35.0	1	M.SCTSLVSQIPD.I
YGL021W	2	2	5.5%	760	86087	9.6	U	ALK1 SGDID:S000002989, Chr VII from 454790-457072, Verified ORF, "Putative Ser-Thr protein kinase, belongs to the haspin family of kinases; contains a leucine zipper motif; may function in mitosis" 
*	Jamie_Alpha_SPB_21.07538.07538.2	1.2783	0.0602	68.8	2447.9321	2447.7158	6941.9	25	3.243	30.0	1	R.RSSISSTVSSSSSSKWRFWKR.N
*	Jamie_Alpha_SPB_73.26288.26288.4	3.4697	0.2708	62.5	2721.4565	2720.0254	4773.2	389	4.472	24.2	1	G.KDKSKINEYQYQFEFEIYQSM.R
Reverse_YDR146C	2	2	5.5%	709	79775	8.7	U	SWI5 SGDID:S000002553, Chr IV from 750737-748608, reverse complement, Verified ORF, "Transcription factor that activates transcription of genes expressed in G1 phase and at the G1/M boundary; localization to the nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase" 
*	Jamie_Alpha_SPB_95.34042.34042.3	2.7964	0.2284	43.3	2566.0745	2561.9216	5922.0	83	4.217	23.8	1	G.PFLCEFTKDPMEKVYKDISGR.P
*	Jamie_Alpha_SPB_105.37557.37557.2	1.6923	0.0847	11.0	2037.4122	2037.2029	5356.9	4	3.642	38.2	1	G.ENLEQFCLPGVTGSSNKR.Q
Reverse_YNL103W	2	2	5.5%	672	74373	5.8	U	MET4 SGDID:S000005047, Chr XIV from 427737-429755, Verified ORF, "Lecine-zipper transcriptional activator, responsible for the regulation of the sulfur amino acid pathway, requires different combinations of the auxiliary factors Cbf1p, Met28p, Met31p and Met32p" 
*	Jamie_Alpha_SPB_30.10719.10719.2	2.1672	0.1489	44.1	2549.112	2549.4932	5304.1	2	3.881	30.0	1	K.EFGHLDADDYEDDENDSYKRD.V
*	Jamie_Alpha_SPB_27.09670.09670.2	1.8264	0.096	22.7	1739.6522	1742.0251	6179.5	342	3.221	30.0	1	K.PHKIGLELISSLFSAE.A
YER168C	2	2	5.5%	546	62485	8.2	U	CCA1 SGDID:S000000970, Chr V from 522664-521024, reverse complement, Verified ORF, "ATP (CTP):tRNA-specific tRNA nucleotidyltransferase; different forms targeted to the nucleus, cytosol, and mitochondrion are generated via the use of multiple transcriptional and translational start sites" 
*	Jamie_Alpha_SPB_52.18463.18463.2	1.7622	0.1007	22.0	1832.8322	1833.1031	8641.8	29	4.191	35.7	1	L.RRDATLNALFYNIHK.G
*	Jamie_Alpha_SPB_92.33096.33096.2	1.8743	0.1372	12.6	1795.3322	1795.0079	4751.7	107	4.038	39.3	1	D.KINHVYNDNILNSHL.K
YGR059W	2	2	5.5%	512	59845	7.4	U	SPR3 SGDID:S000003291, Chr VII from 607567-609105, Verified ORF, "Sporulation-specific homolog of the yeast CDC3/10/11/12 family of bud neck microfilament genes; septin protein involved in sporulation; regulated by ABFI" 
*	Jamie_Alpha_SPB_53.19053.19053.2	1.6583	0.1153	26.4	1321.3522	1318.6207	5274.1	226	3.071	50.0	1	R.SEMLRTRLLKA.R
*	Jamie_Alpha_SPB_77.27523.27523.3	2.411	0.0052	31.0	2765.7844	2763.1333	7161.5	19	3.382	23.9	1	R.TRLLKARDCLTTKSVDITEEQRK.F
Reverse_YNL192W	2	2	5.4%	1131	129919	6.2	U	CHS1 SGDID:S000005136, Chr XIV from 276503-279898, Verified ORF, "Chitin synthase I, requires activation from zymogenic form in order to catalyze the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for repairing the chitin septum during cytokinesis; transcription activated by mating factor" 
*	Jamie_Alpha_SPB_31.10953.10953.2	1.6023	0.0798	10.7	2507.672	2507.0737	6407.7	16	3.052	27.5	1	Y.IMMVAFIVCTLVYFKETSKPK.N
*	Jamie_Alpha_SPB_113.40714.40714.3	1.2656	0.0833	27.6	4525.7046	4529.0796	5707.6	349	2.865	7.7	1	K.ENIEDKAFGDQYCGLSSLLALSRENIKSRGDSIICVVIKK.W
YOL063C	2	2	5.4%	957	109715	5.7	U	YOL063C SGDID:S000005424, Chr XV from 210264-207391, reverse complement, Uncharacterized ORF, "Protein required for normal hydroxyurea resistance; not related to the HUS1 checkpoint protein identified in human and fission yeast" 
*	Jamie_Alpha_SPB_37.13021.13021.2	1.5166	0.1064	16.6	1111.6122	1109.3109	4066.8	28	3.146	55.6	1	A.GIPDEVIPLR.F
*	Jamie_Alpha_SPB_32.11354.11354.4	2.6092	0.0244	41.4	4810.3364	4808.5244	8549.1	237	2.656	13.4	1	R.NVKRLLESAVPGSEDSPLGYQLSEMHDEFFFLTTAHRLVLMK.A
YGR162W	2	2	5.4%	952	107101	6.0	U	TIF4631 SGDID:S000003394, Chr VII from 824064-826922, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4632p" 
*	Jamie_Alpha_SPB_58.20728.20728.2	2.1052	0.1234	15.7	1981.7922	1984.0697	9555.2	64	4.024	28.9	1	G.NYNGGGSFRGGHMGANSSNV.P
*	Jamie_Alpha_SPB_97.34848.34848.4	3.047	0.1629	12.7	3662.2566	3661.9468	6229.2	365	3.427	18.9	1	C.HAEFDKGWTDKLPTNEDGTPLEPEMMSEEYY.A
Reverse_YLR045C	3	3	5.4%	888	100918	8.6	U	STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p" 
*	Jamie_Alpha_SPB_119.42891.42891.2	1.4353	0.0707	75.7	1352.7722	1354.4655	4601.7	130	3.134	36.4	1	R.HPLDGISESSRR.E
*	Jamie_Alpha_SPB_73.26336.26336.4	3.5927	0.1193	10.5	3154.0566	3152.4482	6409.1	256	3.328	22.7	1	I.QYEGEDNSLISKRKRAEEEQSRKKEL.E
*	Jamie_Alpha_SPB_115.41433.41433.1	1.1641	0.0661	20.5	1179.62	1180.297	8782.1	131	3.015	44.4	1	R.EELPLTTYDV.E
Reverse_YMR198W	2	2	5.4%	594	69070	6.4	U	CIK1 SGDID:S000004811, Chr XIII from 659744-661528, Verified ORF, "Kinesin-associated protein required for both karyogamy and mitotic spindle organization, interacts stably and specifically with Kar3p and may function to target this kinesin to a specific cellular role; has similarity to Vik1p" 
*	Jamie_Alpha_SPB_76.27200.27200.2	1.6461	0.0887	15.8	1258.9722	1259.364	4890.6	5	3.105	55.0	1	M.SHFNVEAEGIR.K
*	Jamie_Alpha_SPB_41.14557.14557.2	1.4001	0.0525	70.7	2442.4722	2442.8674	6127.3	140	3.139	27.5	1	R.VKRENNKVREIIKPDGGFTLK.K
Reverse_contaminant_KERATIN22	2	2	5.4%	645	65865	8.0	U	no description
*	Jamie_Alpha_SPB_79.28333.28333.2	1.8295	0.0119	74.4	1494.7722	1493.7031	5322.9	41	3.507	45.8	1	K.KLTVFDNEAATRK.N
*	Jamie_Alpha_SPB_74.26442.26442.2	1.4522	0.1045	10.9	2556.392	2556.7234	8904.4	2	3.677	28.6	1	L.DQMNNLESNQSTREATLGDLYR.K
YDR061W	2	2	5.4%	539	61191	7.0	U	YDR061W SGDID:S000002468, Chr IV from 574160-575779, Uncharacterized ORF, "Mitochondrial protein, member of the ATP-binding cassette (ABC) transporter family; transcriptionally activated by Yrm1p along with genes involved in multidrug resistance" 
*	Jamie_Alpha_SPB_56.20210.20210.2	1.6666	0.0702	11.8	1320.9722	1320.5896	9698.3	429	3.843	40.9	1	R.IEQVAFKGVMPT.A
*	Jamie_Alpha_SPB_62.22023.22023.2	1.6727	0.1829	10.0	2001.1122	2003.2333	7593.9	45	4.173	31.2	1	L.HWKVQPGSKWHIRGDNG.S
Reverse_YCL061C	2	2	5.3%	1096	124326	5.3	U	MRC1 SGDID:S000000566, Chr III from 22106-18816, reverse complement, Verified ORF, "S-phase checkpoint protein found at replication forks, required for DNA replication; also required for Rad53p activation during DNA replication stress, where it forms a replication-pausing complex with Tof1p and is phosphorylated by Mec1p; protein involved in replication checkpoint" 
*	Jamie_Alpha_SPB_29.10353.10353.3	1.686	0.2426	10.9	4467.2344	4470.105	4698.5	8	4.271	11.1	1	I.KNIMKIDMEKNEAALMERIEHPNFNNKSYDDIMKELD.S
*	Jamie_Alpha_SPB_91.32516.32516.2	1.6312	0.3056	11.1	2227.0122	2228.4644	7897.0	2	5.166	30.0	1	G.PRGTTLPTKLAQSTENVLGDE.K
YDR475C	3	3	5.3%	876	98691	9.6	U	YDR475C SGDID:S000002883, Chr IV from 1410084-1407454, reverse complement, Uncharacterized ORF, "Protein of unknown function; previously annotated as two separate ORFs, YDR474C and YDR475C, which were merged as a result of corrections to the systematic reference sequence" 
*	Jamie_Alpha_SPB_20.07000.07000.2	1.6648	0.0993	19.0	1978.3121	1978.2565	7375.5	104	3.494	29.4	1	D.DRRSLASILDSSSSVKKK.G
*	Jamie_Alpha_SPB_20.06944.06944.2	1.535	0.0868	10.0	2265.7522	2264.54	4377.0	120	3.537	25.0	1	K.KKSSEGATPTIKFNPPIEDGF.T
*	Jamie_Alpha_SPB_109.39102.39102.1	1.2335	0.0545	20.4	711.7	710.80817	3580.4	28	3.053	58.3	1	K.PVVTSAH.L
Reverse_YHR205W	3	3	5.3%	824	91811	6.1	U	SCH9 SGDID:S000001248, Chr VIII from 509363-511837, Verified ORF, "Protein kinase that regulates signal transduction activity and G1 progression, controls cAPK activity, required for nitrogen activation of the FGM pathway, involved in life span regulation, homologous to mammalian Akt/PKB" 
*	Jamie_Alpha_SPB_110.39390.39390.1	1.1017	0.1173	19.6	1368.64	1367.5076	8150.2	70	3.488	36.4	1	L.ERGDDIAGLRHK.P
*	Jamie_Alpha_SPB_13.04542.04542.2	2.2001	0.1161	10.5	958.1122	959.044	4370.3	18	3.562	75.0	1	N.GNADLLINE.P
*	Jamie_Alpha_SPB_63.22658.22658.3	2.8317	0.1866	13.2	2343.0244	2339.4778	5882.7	122	4.207	25.0	1	P.IDTDPGYAAAAAERQNISLSSTS.S
Reverse_YOR322C	3	3	5.3%	818	89826	8.6	U	LDB19 SGDID:S000005849, Chr XV from 921057-918601, reverse complement, Verified ORF, "Protein of unknown function; null mutant shows a reduced affinity for the alcian blue dye suggesting a decreased net negative charge of the cell surface" 
*	Jamie_Alpha_SPB_36.12950.12950.2	1.6219	0.0295	73.4	1455.4321	1456.5547	9818.9	299	3.142	45.5	1	R.NSDLFDSFNQIR.I
*	Jamie_Alpha_SPB_79.28190.28190.2	1.7518	0.1588	12.1	1836.2722	1835.1718	7781.2	379	3.643	31.2	1	I.TIKTYGAMIRLNAPTPS.H
*	Jamie_Alpha_SPB_24.08379.08379.3	2.6682	0.1934	16.1	3006.5044	3007.3452	8044.4	2	3.895	22.3	1	I.KTYGAMIRLNAPTPSHSISTSSTSPSINS.T
YEL053C	2	2	5.3%	733	84302	5.9	U	MAK10 SGDID:S000000779, Chr V from 56102-53901, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type, required for replication of dsRNA virus; expression is glucose-repressible" 
*	Jamie_Alpha_SPB_16.05618.05618.3	2.6081	0.1778	12.5	2299.2844	2303.4443	6924.1	4	3.573	30.3	1	E.DHLTDYSTKTSHLDELIENA.N
*	Jamie_Alpha_SPB_31.11070.11070.2	2.2468	0.0123	10.8	2180.5923	2181.4937	4362.4	10	3.328	33.3	1	F.QQTLKDFVIEEKGAAFDIK.L
YML020W	2	2	5.3%	664	76138	8.1	U	YML020W SGDID:S000004482, Chr XIII from 231149-233143, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_98.35313.35313.3	2.5949	0.1804	12.4	2813.1243	2813.1846	5478.7	459	3.878	23.8	1	L.PKQTIWNTVTSTIWKWKTEYWD.R
*	Jamie_Alpha_SPB_54.19310.19310.2	1.8816	0.0847	22.8	1619.3722	1618.9229	5813.8	320	3.506	37.5	1	L.KDIKNRLNGLKYR.L
YDR292C	2	2	5.3%	621	69278	7.2	U	SRP101 SGDID:S000002700, Chr IV from 1045005-1043140, reverse complement, Verified ORF, "Signal recognition particle (SRP) receptor - alpha subunit; contain GTPase domains; involved in SRP-dependent protein targeting; interacts with SRP102p" 
*	Jamie_Alpha_SPB_21.07418.07418.2	1.8623	0.0798	20.2	1770.4722	1768.9706	7578.0	123	3.357	33.3	1	F.TKNGSVPQSHNKNTKK.K
*	Jamie_Alpha_SPB_20.07029.07029.3	2.3309	0.0542	51.1	1803.6244	1804.0219	6711.7	122	3.007	32.8	1	K.GKKQSTGNVGSGRKWGR.D
Reverse_YGL133W	2	2	5.2%	1264	145642	5.7	U	ITC1 SGDID:S000003101, Chr VII from 257712-261506, Verified ORF, "Component of the ATP-dependent Isw2p-Itc1p chromatin remodeling complex, required for repression of a-specific genes, repression of early meiotic genes during mitotic growth, and repression of INO1" 
*	Jamie_Alpha_SPB_17.06039.06039.4	2.7787	0.1767	13.2	5844.9365	5846.5864	5624.5	146	3.709	13.3	1	M.SDVNLENETFENNELEKLLKEENKTFATLSLAHDRLSLSSKIREMIPRIQ.R
*	Jamie_Alpha_SPB_30.10598.10598.2	1.9721	0.0514	11.5	1767.7722	1765.9205	6945.7	139	3.198	36.7	1	S.IGFVERTAESIGESNR.I
YNL106C	4	4	5.2%	1183	133331	8.6	U	INP52 SGDID:S000005050, Chr XIV from 424497-420946, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in endocytosis; hyperosmotic stress causes translocation to actin patches" 
*	Jamie_Alpha_SPB_111.39687.39687.1	1.264	0.0317	12.6	819.9	820.8862	4345.8	1	2.75	75.0	1	L.NGNGFRR.L
*	Jamie_Alpha_SPB_18.06308.06308.2	1.7823	0.1033	25.0	1469.5322	1466.5907	5543.1	1	3.933	53.8	1	R.ETSQDGFAAASRII.P
*	Jamie_Alpha_SPB_63.22555.22555.3	2.1467	0.0527	42.6	4287.3843	4284.7217	8637.6	4	3.527	16.2	1	R.RKSSTAPDEISTSTKNSGVSTTEDPEPAKASTKPEKPPVVK.K
*	Jamie_Alpha_SPB_38.13671.13671.2	1.686	0.1374	11.2	1253.8722	1251.4685	5193.0	245	3.674	40.9	1	E.PAKASTKPEKPP.V
YHR119W	2	2	5.2%	1080	123912	9.0	U	SET1 SGDID:S000001161, Chr VIII from 346046-349288, Verified ORF, "Histone methyltransferase, subunit of the COMPASS (Set1C) complex which methylates Rad6p ubiquitinated histone H3 on lysine 4; required in transcriptional silencing near telomeres and at the silent mating type loci; contains a SET domain" 
*	Jamie_Alpha_SPB_106.37941.37941.2	1.4216	0.0062	64.9	1906.2922	1907.0734	6121.9	333	3.087	26.7	1	-.MSNYYRRAHASSGSYR.Q
*	Jamie_Alpha_SPB_21.07429.07429.4	3.7029	0.151	13.6	4325.6567	4324.8926	5656.7	335	4.509	16.2	1	N.SALPLHVYLIKYASSDGKINDAAKAAFSAVRKHESSGCFI.M
YMR308C	2	2	5.2%	1089	121030	4.7	U	PSE1 SGDID:S000004925, Chr XIII from 892220-888951, reverse complement, Verified ORF, "Karyopherin/importin that interacts with the nuclear pore complex; acts as the nuclear import receptor for specific proteins, including Pdr1p, Yap1p, Ste12p, and Aft1p" 
*	Jamie_Alpha_SPB_53.18952.18952.4	2.0792	0.0826	51.3	4715.7764	4720.262	10679.2	80	3.873	13.0	1	R.ADSIRHKLSDAIAECVQDDLPAWPELLQALIESLKSGNPNFR.E
*	Jamie_Alpha_SPB_43.15309.15309.2	2.016	0.1666	47.8	1577.2722	1577.818	4970.5	26	4.08	42.9	1	Q.EQALTTIAFIAEAAK.N
Reverse_YGR258C	2	2	5.2%	1031	117838	5.2	U	RAD2 SGDID:S000003490, Chr VII from 1010772-1007677, reverse complement, Verified ORF, "Single-stranded DNA endonuclease, cleaves single-stranded DNA during nucleotide excision repair to excise damaged DNA; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPG protein" 
*	Jamie_Alpha_SPB_87.31028.31028.3	2.4904	0.1899	12.1	2973.4744	2970.055	8693.8	4	4.367	25.0	1	F.TDFEEQEKIMNEVINDEEDESFDY.D
*	Jamie_Alpha_SPB_35.12343.12343.3	2.2077	0.0112	29.9	3308.3044	3311.8267	9134.9	118	3.168	19.0	1	K.SGANNLSQGMYPLRAAKLSFDEVFKVNKPK.L
YDR369C	2	2	5.2%	854	96364	8.2	U	XRS2 SGDID:S000002777, Chr IV from 1217570-1215006, reverse complement, Verified ORF, "Protein required for DNA repair; component of the Mre11 complex, which is involved in double strand breaks, meiotic recombination, telomere maintenance, and checkpoint signaling" 
*	Jamie_Alpha_SPB_16.05710.05710.2	1.4956	0.0573	73.8	1915.3322	1915.2401	5271.8	12	3.302	40.0	1	R.NYVPLKKYSKKDTTTK.W
*	Jamie_Alpha_SPB_79.28288.28288.3	2.5929	0.2129	13.2	3282.2944	3279.6213	6011.5	71	4.37	20.4	1	L.FVVKEMNLRPNLSEECSKQSRHSRSATS.R
YMR089C	2	2	5.2%	825	93276	7.6	U	YTA12 SGDID:S000004695, Chr XIII from 448085-445608, reverse complement, Verified ORF, "Component, with Afg3p, of the mitochondrial inner membrane m-AAA protease that mediates degradation of misfolded or unassembled proteins and is also required for correct assembly of mitochondrial enzyme complexes" 
*	Jamie_Alpha_SPB_20.07093.07093.2	1.8769	0.0266	11.4	1042.7922	1045.1838	3682.9	1	3.412	68.8	1	D.AVLKQESNR.I
*	Jamie_Alpha_SPB_45.16093.16093.3	2.6078	0.2188	14.1	3409.8245	3413.019	9447.8	2	4.91	20.5	1	S.RYEKMGAKIPRGAILSGPPGTGKTLLAKATAGEA.G
YJR004C	2	2	5.2%	650	70340	4.5	U	SAG1 SGDID:S000003764, Chr X from 444775-442823, reverse complement, Verified ORF, "Alpha-agglutinin of alpha-cells, binds to Aga1p during agglutination, N-terminal half is homologous to the immunoglobulin superfamily and contains binding site for a-agglutinin, C-terminal half is highly glycosylated and contains GPI anchor" 
*	Jamie_Alpha_SPB_38.13698.13698.2	1.4823	0.1915	13.7	1093.6721	1092.1913	3936.8	262	4.405	45.5	1	A.STVVAAPTSTTG.W
*	Jamie_Alpha_SPB_92.33019.33019.2	1.51	0.2664	10.0	2308.8123	2309.4485	8798.6	2	4.337	28.6	1	I.SSSAVFETSDASIVNVHTENIT.N
Reverse_YLR088W	2	2	5.2%	614	69221	6.3	U	GAA1 SGDID:S000004078, Chr XII from 316108-317952, Verified ORF, "Subunit of the GPI (glycosylphosphatidylinositol):protein transamidase complex, removes the GPI-anchoring signal and attaches GPI to proteins in the ER" 
*	Jamie_Alpha_SPB_55.19795.19795.2	1.8857	0.0841	21.3	1756.3522	1755.9279	7645.6	51	3.622	37.5	1	R.GFTTIDHGSNGHAKLTV.S
*	Jamie_Alpha_SPB_76.27092.27092.2	1.8942	0.1185	10.9	1477.8522	1475.6879	5277.6	440	3.578	39.3	1	F.RALSVGLAAGGINFE.D
Reverse_YDR148C	2	2	5.2%	463	50431	8.9	U	KGD2 SGDID:S000002555, Chr IV from 755061-753670, reverse complement, Verified ORF, "Dihydrolipoyl transsuccinylase, a component of the mitochondrial alpha-ketoglutarate dehydrogenase complex, which catalyzes a step in the tricarboxylic acid (TCA) cycle, the oxidative decarboxylation of alpha-ketoglutarate to succinyl-CoA" 
*	Jamie_Alpha_SPB_96.34572.34572.2	1.537	0.1452	24.2	1649.5922	1647.9988	6584.8	303	3.513	34.6	1	E.ILEKVTKLFTVAER.G
*	Jamie_Alpha_SPB_15.05142.05142.1	1.9495	0.1128	10.0	1090.3	1089.2922	5525.4	7	3.718	55.6	1	A.MPPVEISTSK.F
Reverse_YJR013W	2	2	5.2%	403	47166	9.1	U	GPI14 SGDID:S000003774, Chr X from 460296-461507, Uncharacterized ORF, "Glycosylphosphatidylinositol-alpha 1,4 mannosyltransferase I, involved in GPI anchor biosynthesis, requires Pbn1p for function; homolog of mammalian PIG-M" 
*	Jamie_Alpha_SPB_25.09006.09006.2	1.2857	0.0317	65.8	1086.1721	1085.2456	5736.3	404	2.747	55.6	1	K.NSVTPQTPIK.I
*	Jamie_Alpha_SPB_13.04590.04590.2	1.5733	0.136	24.3	1327.6322	1327.612	4877.2	28	3.74	55.0	1	T.VFAFTQVFLVR.L
Reverse_YOR304W	2	2	5.1%	1120	130327	6.6	U	ISW2 SGDID:S000005831, Chr XV from 884510-887872, Verified ORF, "Member of the imitation-switch (ISWI) class of ATP-dependent chromatin remodeling complexes; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth" 
*	Jamie_Alpha_SPB_110.39337.39337.3	1.1091	0.1226	33.7	5000.034	5001.7427	3699.8	366	3.307	4.8	1	K.KFYLQEKEQLADLEKPFFQFDQGHIVKPARPAKPQPTQKSASK.S
*	Jamie_Alpha_SPB_41.14611.14611.2	1.7324	0.0755	10.3	1602.9122	1600.8558	6415.6	99	3.19	34.6	1	K.ANLEQTKQEGKKLI.D
Reverse_YLR096W	3	3	5.1%	1147	128338	9.4	U	KIN2 SGDID:S000004086, Chr XII from 332591-336034, Verified ORF, "Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; closely related to Kin1p" 
*	Jamie_Alpha_SPB_25.09007.09007.4	2.9508	0.0102	42.2	3302.6565	3302.5542	6832.2	63	2.859	20.0	1	R.KISSNRSASSATSHYSSSLQSDLSNQLDMAK.G
*	Jamie_Alpha_SPB_60.21327.21327.3	2.0754	0.297	18.5	2931.5344	2932.362	5841.3	17	4.9	21.9	1	A.VQQQQQRQQAQAQLALAQRRQLKAL.K
*	Jamie_Alpha_SPB_22.07632.07632.2	1.6195	0.0603	84.8	1010.53217	1013.2747	5114.9	127	3.17	57.1	1	R.RQLKALKR.A
Reverse_contaminant_UBIQUITIN11	2	2	5.1%	1118	127523	8.5	U	no description
*	Jamie_Alpha_SPB_26.09208.09208.3	2.4337	0.0185	37.6	3413.4844	3409.1042	5839.3	360	3.059	18.5	1	R.GDYSFRKLHVLLVPPLKWIEIKKLSDRR.A
*	Jamie_Alpha_SPB_86.30717.30717.3	1.851	0.0323	27.8	3386.9343	3385.6414	7294.0	15	2.883	18.8	1	K.QIEPTPCRKGRDEVSKKADSTEHESKSQR.K
YER111C	2	2	5.1%	1093	123806	8.8	U	SWI4 SGDID:S000000913, Chr V from 385872-382591, reverse complement, Verified ORF, "DNA binding component of the SBF complex (Swi4p-Swi6p), a transcriptional activator that in concert with MBF (Mbp1-Swi6p) regulates late G1-specific transcription of targets including cyclins and genes required for DNA synthesis and repair" 
*	Jamie_Alpha_SPB_29.10449.10449.2	1.7565	0.0381	78.7	1686.9722	1684.8009	6341.5	392	3.23	34.4	1	R.KKNSSSSTSATTTAANK.K
*	Jamie_Alpha_SPB_81.29108.29108.3	1.037	0.0673	23.6	4573.1943	4577.253	2985.9	343	3.303	6.6	1	K.FSNTVQESYDVNETLRLATELTILQFKRRMTTLKISEAK.S
Reverse_YDL077C	2	2	5.1%	1049	122882	7.1	U	VAM6 SGDID:S000002235, Chr IV from 320120-316971, reverse complement, Verified ORF, "Vacuolar protein that plays a critical role in the tethering steps of vacuolar membrane fusion by facilitating guanine nucleotide exchange on small guanosine triphosphatase Ypt7p" 
*	Jamie_Alpha_SPB_10.03558.03558.4	1.0434	0.0503	22.6	4492.7764	4489.019	2601.3	478	3.584	4.1	1	K.ANFREQLVKGCNYHTIINRGERTFWSISDTGFNSIVKK.C
*	Jamie_Alpha_SPB_91.32780.32780.2	1.5955	0.1069	15.4	1901.2122	1902.2009	7750.1	76	3.297	30.0	1	D.IEDLLIHVAEKHNELK.S
YDR421W	3	3	5.1%	950	108205	6.3	U	ARO80 SGDID:S000002829, Chr IV from 1312030-1314882, Verified ORF, "Zinc finger transcriptional activator of the Zn2Cys6 family; activates transcription of aromatic amino acid catabolic genes in the presence of aromatic amino acids" 
*	Jamie_Alpha_SPB_78.28096.28096.3	2.6984	0.1442	82.5	2494.2244	2492.6956	5298.9	384	3.391	26.2	1	K.VKCDLGPVDNPHDPPCARCKR.E
*	Jamie_Alpha_SPB_28.10012.10012.2	1.4513	0.1278	15.2	1950.5721	1953.2788	3951.7	235	3.306	31.2	1	K.SEGMKWKLELSSMQNAL.E
*	Jamie_Alpha_SPB_113.40496.40496.1	1.4886	0.0345	17.3	972.78	973.11725	4297.8	2	3.401	66.7	1	E.EGLTGVGAIR.R
Reverse_YPR185W	2	2	5.1%	738	83281	7.0	U	ATG13 SGDID:S000006389, Chr XVI from 907214-909430, Verified ORF, "Phosphorylated protein that interacts with Vac8p, required for the cytoplasm-to-vacuole targeting (Cvt) pathway and autophagy" 
*	Jamie_Alpha_SPB_30.10839.10839.2	2.3113	0.2977	66.7	2183.9321	2184.1196	8492.5	15	5.47	30.0	1	M.VGVADNGNHNNNNSNSRNGND.I
*	Jamie_Alpha_SPB_116.41638.41638.2	1.6874	0.0801	10.6	1873.9722	1873.9395	5870.1	14	3.416	37.5	1	Q.EPQNQPGQSNHSVSAHR.A
YGL124C	2	2	5.1%	644	73494	7.3	U	MON1 SGDID:S000003092, Chr VII from 276720-274786, reverse complement, Verified ORF, "Protein required for fusion of cvt-vesicles and autophagosomes with the vacuole; associates, as a complex with Ccz1p, with a perivacuolar compartment; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_87.31060.31060.2	1.5474	0.1467	24.7	2498.652	2497.8284	7331.5	3	3.727	32.5	1	R.PRGHTLHTTDLHLLFCLISHQ.F
*	Jamie_Alpha_SPB_66.23464.23464.2	1.6231	0.1278	24.5	1324.8522	1323.5321	3929.9	249	3.384	50.0	1	K.INTSKGFKLSDI.P
YGR065C	2	2	5.1%	593	69083	8.9	U	VHT1 SGDID:S000003297, Chr VII from 619862-618081, reverse complement, Verified ORF, "High-affinity plasma membrane H+-biotin (vitamin H) symporter; mutation results in fatty acid auxotrophy; 12 transmembrane domain containing major facilitator subfamily member; mRNA levels negatively regulated by iron deprivation and biotin" 
*	Jamie_Alpha_SPB_82.29449.29449.2	1.5357	0.2294	11.7	2123.8123	2121.467	7529.7	149	4.313	28.1	1	I.ILPVMDLGWTWFTFACY.R
*	Jamie_Alpha_SPB_60.21380.21380.2	1.541	0.1401	25.6	1436.3121	1436.6946	3224.5	193	3.251	37.5	1	G.SVTSGLLQSRIFK.S
Reverse_YER036C	2	2	5.1%	610	68377	6.5	U	YER036C SGDID:S000000838, Chr V from 225198-223366, reverse complement, Uncharacterized ORF, "ATPase of the ATP-binding cassette (ABC) family involved in ribosome biogenesis, has similarity to Gcn20p" 
*	Jamie_Alpha_SPB_52.18682.18682.2	1.33	0.0113	63.8	1357.1921	1355.5767	4100.9	82	2.837	37.5	1	K.VLNAYTGASAIFK.K
*	Jamie_Alpha_SPB_34.12057.12057.2	1.5515	0.133	22.8	1973.3722	1971.3286	8076.2	202	3.778	29.4	1	E.REAKKADRKAKSASVPPM.-
YER082C	2	2	5.1%	554	62317	9.4	U	UTP7 SGDID:S000000884, Chr V from 325932-324268, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_73.26275.26275.2	1.7256	0.1356	10.8	1539.8522	1542.6891	5527.4	9	3.616	42.3	1	Y.HDVSTGQLVSELRT.K
*	Jamie_Alpha_SPB_102.36738.36738.2	1.6454	0.1657	13.0	1534.3922	1532.6398	6928.3	336	3.448	38.5	1	P.CFGSMGGNPHRNTP.Y
YDL215C	2	2	5.0%	1092	124332	5.7	U	GDH2 SGDID:S000002374, Chr IV from 73919-70641, reverse complement, Verified ORF, "NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels" 
*	Jamie_Alpha_SPB_15.05181.05181.4	3.4479	0.1546	17.2	4933.3765	4928.6885	8154.3	27	3.754	14.7	1	S.LGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRL.F
*	Jamie_Alpha_SPB_66.23742.23742.2	1.6379	0.1436	10.9	1453.2322	1455.6477	4559.4	235	3.656	45.5	1	A.PESELKLTFVYE.S
YGL013C	3	3	5.0%	1068	121793	6.9	U	PDR1 SGDID:S000002981, Chr VII from 472303-469097, reverse complement, Verified ORF, "Zinc cluster protein that is a master regulator involved in recruiting other zinc cluster proteins to pleiotropic drug response elements (PDREs) to fine tune the regulation of multidrug resistance genes" 
*	Jamie_Alpha_SPB_54.19171.19171.2	1.1792	0.094	71.4	2232.0122	2232.57	8551.2	21	3.501	26.5	1	K.PRSKVSKACDNCRKRKIK.C
*	Jamie_Alpha_SPB_39.13742.13742.3	2.2478	0.0281	38.1	2364.5344	2366.7263	5594.1	92	2.956	26.2	1	R.QGGARIKNLHKTSLEGTTVQVK.E
*	Jamie_Alpha_SPB_65.23301.23301.2	1.5529	0.1273	23.4	1398.4922	1398.6078	4724.5	37	3.027	41.7	1	Q.LPFNGRSAPSPVR.N
Reverse_YLL031C	2	2	5.0%	1017	115634	6.6	U	GPI13 SGDID:S000003954, Chr XII from 80204-77151, reverse complement, Verified ORF, "ER membrane localized phosphoryltransferase that adds phosphoethanolamine onto the third mannose residue of the glycosylphosphatidylinositol (GPI) anchor precursor; similar to human PIG-O protein" 
*	Jamie_Alpha_SPB_84.30067.30067.3	2.6265	0.1833	13.0	2639.8145	2637.0166	6673.1	98	3.764	21.7	1	Y.CGIIIGIATALLTGWFQDVFSPQQ.Y
*	Jamie_Alpha_SPB_30.10666.10666.4	3.1058	0.2075	10.7	2863.7366	2862.054	7737.2	96	3.927	24.4	1	S.ELEDISDGGHNGTHDMGHDGLIVLLTD.D
Reverse_YNL123W	2	2	5.0%	997	110881	6.0	U	YNL123W SGDID:S000005067, Chr XIV from 394687-397680, Uncharacterized ORF, "shows protein sequence similarity to the mammalian Omi/HtrA2 family of serine proteases" 
*	Jamie_Alpha_SPB_76.27156.27156.2	1.451	0.2138	10.4	2722.7922	2720.1638	7145.4	247	4.237	20.5	1	A.SSLFVGRVPLAYFRAMQYSLEHF.T
*	Jamie_Alpha_SPB_48.17032.17032.2	1.4502	0.1188	10.6	2974.4521	2974.427	9120.0	18	3.221	23.1	1	D.GEKIKDYGPGERLVTEAVLLGINEPFK.A
YBR108W	2	2	5.0%	947	103835	9.2	U	YBR108W SGDID:S000000312, Chr II from 454816-457659, Uncharacterized ORF, "Protein interacting with Rsv167p" 
*	Jamie_Alpha_SPB_86.30769.30769.4	2.9491	0.188	16.7	4360.5366	4360.5825	9566.7	299	3.916	15.4	1	N.LQYGTQSSNPAPSPSFQNGLQCHQQPQYVSHGSTNLGQSQ.F
	Jamie_Alpha_SPB_111.39768.39768.1	1.4712	0.1864	42.9	708.51	707.89124	2193.8	26	4.154	50.0	1	K.KAPPPVV.K
Reverse_YJL056C	2	2	5.0%	880	98866	7.0	U	ZAP1 SGDID:S000003592, Chr X from 332989-330347, reverse complement, Verified ORF, "Zinc-regulated transcription factor, binds to zinc-responsive promoter elements to induce transcription of certain genes in the presence of zinc; regulates its own transcription; contains seven zinc-finger domains" 
*	Jamie_Alpha_SPB_40.14270.14270.2	2.4175	0.065	10.4	2385.7322	2388.577	5638.4	281	3.522	28.9	1	N.AFQIDFNIGHQCNIHNVISC.T
*	Jamie_Alpha_SPB_58.20864.20864.2	1.2517	0.0060	63.1	2609.9722	2607.6377	8610.1	317	2.701	21.7	1	R.HHHHQHDTSTAGATNNNSGNLNNK.P
YDR333C	2	2	5.0%	723	83426	5.7	U	YDR333C SGDID:S000002741, Chr IV from 1135424-1133253, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_16.05780.05780.2	1.6829	0.0782	11.6	1415.8522	1416.4935	4805.4	4	3.704	50.0	1	G.ERDTQSNGQPKR.I
*	Jamie_Alpha_SPB_30.10658.10658.2	1.7548	0.1595	13.9	2652.9321	2653.8706	7167.8	32	4.069	26.1	1	S.NDGQDHNNINNLQSPFFIAGIPIN.L
Reverse_YLR337C	2	2	5.0%	817	82594	9.9	U	VRP1 SGDID:S000004329, Chr XII from 805106-802653, reverse complement, Verified ORF, "Proline-rich, actin-associated protein involved in cytoskeletal organization and cytokinesis; related to mammalian Wiskott-Aldrich syndrome protein (WASP)-interacting protein (WIP)" 
*	Jamie_Alpha_SPB_97.34929.34929.2	1.6775	0.1343	26.1	1927.6122	1928.2561	4941.5	1	3.653	34.2	1	T.SFAGPPPPPPPPPAPMSSAK.N
*	Jamie_Alpha_SPB_69.24643.24643.2	1.6892	0.0935	14.8	1765.3522	1763.8993	7081.4	48	3.364	30.0	1	K.SSVTGSSGSASSVVGGGVIPA.S
YMR237W	2	2	5.0%	724	82049	5.4	U	YMR237W SGDID:S000004850, Chr XIII from 743748-745922, Uncharacterized ORF, "Protein that colocalizes with clathrin-coated vesicles; involved in transport at the trans-Golgi" 
*	Jamie_Alpha_SPB_35.12327.12327.3	3.2522	0.2224	11.7	2501.4243	2504.9377	7867.2	8	4.479	28.8	1	S.KISISSWNAFRKYDVNIIVHI.P
*	Jamie_Alpha_SPB_78.27978.27978.3	2.0174	0.1159	65.6	1849.1943	1851.1003	2873.4	354	4.024	32.1	1	R.GNDISKMRSKRLCER.W
Reverse_YGR191W	2	2	5.0%	603	66006	7.4	U	HIP1 SGDID:S000003423, Chr VII from 880425-882236, Verified ORF, "High-affinity histidine permease, also involved in the transport of manganese ions" 
*	Jamie_Alpha_SPB_37.13344.13344.2	1.5663	0.1046	16.5	1352.8522	1355.6409	6696.2	113	3.349	45.5	1	R.NLFKPLNGIHAM.A
*	Jamie_Alpha_SPB_58.20916.20916.2	1.78	0.1687	10.6	1863.9122	1865.0068	8129.6	30	3.836	32.4	1	D.NTTQNIGPSDKSSLPFAS.D
Reverse_YEL013W	2	2	5.0%	578	63208	5.1	U	VAC8 SGDID:S000000739, Chr V from 128825-130561, Verified ORF, "Phosphorylated vacuolar membrane protein that interacts with Atg13p, required for the cytoplasm-to-vacuole targeting (Cvt) pathway; interacts with Nvj1p to form nucleus-vacuole junctions" 
*	Jamie_Alpha_SPB_22.07898.07898.2	1.6325	0.166	31.0	2271.632	2271.5444	6506.4	30	3.751	27.8	1	L.ALEKCKEVAGSEFFEKRNK.E
*	Jamie_Alpha_SPB_18.06524.06524.2	1.9168	0.1215	13.8	1147.6721	1150.3634	4194.5	1	3.81	72.2	1	S.DSQILKVLHP.L
YGL017W	2	2	5.0%	503	57931	6.3	U	ATE1 SGDID:S000002985, Chr VII from 459859-461370, Verified ORF, "Arginyl-tRNA-protein transferase, catalyzes post-translational conjugation of arginine to the amino termini of acceptor proteins which are then subject to degradation via the N-end rule pathway" 
*	Jamie_Alpha_SPB_20.07143.07143.1	1.53	0.1428	23.1	985.02	985.1027	5147.7	153	4.051	50.0	1	P.SMHNEPAAK.C
*	Jamie_Alpha_SPB_17.05936.05936.2	2.3354	0.0432	23.7	1753.5521	1752.9275	5771.6	42	3.12	43.3	1	R.FLCDTPFGPEAVLGTQ.E
YOL125W	2	2	5.0%	476	54095	8.3	U	YOL125W SGDID:S000005485, Chr XV from 83833-85263, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_34.11956.11956.2	1.5629	0.1751	12.2	1242.5322	1240.3123	4772.8	13	3.974	45.5	1	G.YNGENGLLSSSV.K
*	Jamie_Alpha_SPB_16.05480.05480.2	1.567	0.0831	11.1	1429.5122	1427.7399	5923.8	93	3.318	45.5	1	S.KPISCPSIKRIK.I
Reverse_YML008C	2	2	5.0%	383	43431	5.8	U	ERG6 SGDID:S000004467, Chr XIII from 252990-251839, reverse complement, Verified ORF, "Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24" 
*	Jamie_Alpha_SPB_27.09487.09487.2	1.4266	0.0693	76.7	1304.9922	1302.3457	3918.1	144	3.482	44.4	1	K.RHEPNNEDYK.D
*	Jamie_Alpha_SPB_111.39902.39902.1	1.1549	0.1038	20.0	774.33	773.8303	3105.3	316	3.36	37.5	1	R.APGGVGCGV.D
YJL095W	4	4	4.9%	1478	164195	9.5	U	BCK1 SGDID:S000003631, Chr X from 247171-251607, Verified ORF, "Mitogen-activated protein (MAP) kinase kinase kinase acting in the protein kinase C signaling pathway, which controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p" 
*	Jamie_Alpha_SPB_78.27921.27921.3	1.805	0.138	62.8	3835.4043	3839.4949	8015.4	364	3.216	14.8	1	K.TASYTRFQQLLKKTMTKNVTNSHIRQKSASKLK.S
*	Jamie_Alpha_SPB_8.02774.02774.2	1.873	0.0313	11.7	984.8722	987.0978	3775.2	279	2.821	55.6	1	T.EGIASPTSPK.S
*	Jamie_Alpha_SPB_102.36690.36690.2	1.8335	0.1498	11.2	1315.4122	1314.441	4943.9	245	4.104	45.5	1	S.SRTEPSTPSRPV.P
*	Jamie_Alpha_SPB_64.22744.22744.2	1.5926	0.1567	10.5	2129.672	2128.374	9840.9	12	4.252	32.4	1	I.LHRDMKADNLLLDQDGIC.K
YIL115C	2	2	4.9%	1460	158907	4.8	U	NUP159 SGDID:S000001377, Chr IX from 148706-144324, reverse complement, Verified ORF, "Subunit of the nuclear pore complex that is found exclusively on the cytoplasmic side, forms a subcomplex with Nup82p and Nsp1p, required for mRNA export" 
*	Jamie_Alpha_SPB_74.26378.26378.4	2.855	0.0203	45.3	3801.5366	3797.124	8608.4	130	3.455	17.7	1	K.SGHYSINLESLEHEKSLSPTSEKIPIAGQEQEEK.K
*	Jamie_Alpha_SPB_16.05751.05751.3	1.6931	0.0228	24.7	4300.5244	4296.894	6526.3	334	2.881	15.3	1	R.LIESTFQTVEAEFTVLMENIRNMDTFFTDQSSIPLVK.R
Reverse_YOL087C	2	2	4.9%	1116	125382	6.7	U	YOL087C SGDID:S000005447, Chr XV from 158636-155286, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_27.09594.09594.3	1.9364	0.012	25.7	1852.7043	1854.2645	4491.8	254	3.2	31.2	1	K.VRIMGPAVLKVNAESIR.P
*	Jamie_Alpha_SPB_51.18165.18165.4	2.0491	0.0355	33.7	4446.4165	4442.159	8915.3	66	2.636	14.4	1	K.KDKNNKKSESNYGTDLTLSNTLDKKKLSFIKKRLLKDK.Q
Reverse_YML100W	3	3	4.9%	1098	123018	6.6	U	TSL1 SGDID:S000004566, Chr XIII from 70624-73920, Verified ORF, "Large subunit of trehalose 6-phosphate synthase (Tps1p)/phosphatase (Tps2p) complex, which converts uridine-5'-diphosphoglucose and glucose 6-phosphate to trehalose, homologous to Tps3p and may share function" 
*	Jamie_Alpha_SPB_18.06319.06319.2	2.0891	0.1162	94.8	1625.4722	1623.9104	2753.3	29	3.502	46.2	1	R.SSPPEAINFVFMRK.K
*	Jamie_Alpha_SPB_44.15553.15553.3	2.0148	0.0906	51.0	2985.4744	2987.363	9109.0	271	3.455	21.9	1	R.GNYKLEEDHVVDAMLLRNSTQLFHR.A
*	Jamie_Alpha_SPB_84.30286.30286.2	1.973	0.1359	15.6	1603.4321	1602.892	5423.3	19	3.951	42.9	1	A.NKMAGNGKISPVISW.P
Reverse_YMR205C	3	3	4.9%	959	104618	6.7	U	PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" 
*	Jamie_Alpha_SPB_14.04968.04968.2	1.6356	0.1037	23.2	1141.0322	1140.2865	4831.4	228	3.276	62.5	1	S.WGNYIAYPR.H
*	Jamie_Alpha_SPB_34.12295.12295.2	2.1392	0.1232	33.1	1776.9122	1779.1077	7655.7	26	3.648	40.0	1	R.LSMARKFDKAQIAEAV.A
*	Jamie_Alpha_SPB_93.33408.33408.2	1.5621	0.1613	10.7	2126.632	2126.3374	7459.1	40	4.216	28.6	1	D.AGTLSGDGGCVILADVGAEILH.Q
Q0055	2	2	4.9%	854	98008	9.6	U	AI2 SGDID:S000007262, Chr Mito from 13818-13986,16435-18830, Verified ORF, "Reverse transcriptase required for splicing of the COX1 pre-mRNA, encoded by a mobile group II intron within the mitochondrial COX1 gene" 
*	Jamie_Alpha_SPB_108.38887.38887.3	1.3511	0.059	25.3	3594.5344	3598.941	6210.4	1	3.46	14.7	1	K.FENEFNTGNMSNRGRNPIYNSLSSKIYRCK.L
*	Jamie_Alpha_SPB_104.37288.37288.2	1.592	0.0070	68.8	1482.8722	1482.8966	5199.5	109	2.635	45.5	1	K.LLSEKLKLIRLR.D
Reverse_YBR179C	2	2	4.9%	855	97808	7.0	U	FZO1 SGDID:S000000383, Chr II from 589109-586542, reverse complement, Verified ORF, "Mitochondrial integral membrane protein involved in mitochondrial fusion and maintenance of the mitochondrial genome; contains N-terminal GTPase domain" 
*	Jamie_Alpha_SPB_70.25177.25177.4	2.421	0.0202	37.5	3741.4165	3735.5933	8702.3	272	3.084	18.2	1	K.YKISLNMPLARPLDHILYTLGLLSGVVIVPVSLK.K
*	Jamie_Alpha_SPB_40.14248.14248.2	1.4191	0.1731	31.6	943.5722	942.1062	3428.9	352	3.422	64.3	1	A.RASLIEPR.L
Reverse_YOR178C	2	2	4.9%	793	88533	5.7	U	GAC1 SGDID:S000005704, Chr XV from 670241-667860, reverse complement, Verified ORF, "Regulatory subunit for Glc7p type-1 protein phosphatase (PP1), tethers Glc7p to Gsy2p glycogen synthase, binds Hsf1p heat shock transcription factor, required for induction of some HSF-regulated genes under heat shock" 
*	Jamie_Alpha_SPB_47.16647.16647.4	3.4739	0.1542	17.5	3461.2966	3462.6338	5656.6	244	3.658	18.4	1	S.SFTNIFPNTNRHHDILADDSLCASKDDEDL.Y
*	Jamie_Alpha_SPB_108.38895.38895.1	1.1074	0.0111	78.3	1050.36	1050.2432	6159.6	143	3.075	43.8	1	K.VTTLEIAFR.V
YGR264C	2	2	4.9%	751	85678	6.6	U	MES1 SGDID:S000003496, Chr VII from 1021859-1019604, reverse complement, Verified ORF, "Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs" 
*	Jamie_Alpha_SPB_68.24222.24222.4	3.5979	0.2116	10.9	3418.4565	3419.707	7557.7	60	3.987	21.3	1	I.GSVLSADIFARYCKGRNYNALFICGTDEYG.T
*	Jamie_Alpha_SPB_9.03270.03270.2	2.0994	0.0717	30.6	906.39215	907.01404	5745.5	24	2.88	100.0	1	N.QFLQENK.L
YLL008W	2	2	4.9%	752	84843	5.7	U	DRS1 SGDID:S000003931, Chr XII from 131728-133986, Verified ORF, "Nucleolar DEAD-box protein required for ribosome assembly and function, including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles" 
*	Jamie_Alpha_SPB_15.05199.05199.2	1.8406	0.1453	94.6	1672.3522	1671.7576	6800.8	16	3.987	46.4	1	K.ADFYAPETEGDEAKK.Q
*	Jamie_Alpha_SPB_59.21216.21216.2	1.8955	0.0445	11.4	2522.2922	2523.7715	8087.7	248	4.44	23.8	1	K.REEAKADGNGARSYRKTKTDRI.A
Reverse_YMR246W	2	2	4.9%	694	77267	6.6	U	FAA4 SGDID:S000004860, Chr XIII from 759806-761890, Verified ORF, "Long chain fatty acyl-CoA synthetase, regulates protein modification during growth in the presence of ethanol, functions to incorporate palmitic acid into phospholipids and neutral lipids" 
*	Jamie_Alpha_SPB_82.29346.29346.2	2.4382	0.2596	55.6	1945.8322	1943.2451	9121.8	2	5.185	33.3	1	G.LDEVDVLKATITGVLDGAI.G
*	Jamie_Alpha_SPB_22.07933.07933.2	1.8754	0.1472	15.0	1579.9521	1581.8986	6348.2	45	3.861	39.3	1	G.IGAVINYHTLVVGKP.T
YNL112W	2	2	4.9%	546	60999	8.8	U	DBP2 SGDID:S000005056, Chr XIV from 413641-414913,415916-416283, Verified ORF, "Essential ATP-dependent RNA helicase of the DEAD-box protein family, involved in nonsense-mediated mRNA decay and rRNA processing" 
*	Jamie_Alpha_SPB_39.14044.14044.2	1.4667	0.0102	67.1	1233.6322	1231.4528	4065.6	132	2.679	45.5	1	R.SPIMVATDVAAR.G
*	Jamie_Alpha_SPB_32.11442.11442.2	2.1931	0.0702	25.2	1523.8722	1523.6571	10214.9	6	4.088	53.6	1	H.PRYGGGRGGRGGYGR.R
Reverse_YBR139W	2	2	4.9%	508	57639	5.3	U	YBR139W SGDID:S000000343, Chr II from 515658-517184, Uncharacterized ORF, "Putative serine type Carboxypeptidase; green fluorescent protein (GFP)-fusion protein localizes to the vacuole; YBR139W is not an essential gene" 
*	Jamie_Alpha_SPB_16.05599.05599.2	1.8399	0.073	22.9	1016.9522	1017.0891	4554.4	14	3.727	62.5	1	E.GAIHFDNSR.L
*	Jamie_Alpha_SPB_15.05366.05366.2	2.1852	0.0067	82.5	1904.3922	1905.1755	4081.4	78	3.447	43.3	1	K.YDMYGSWQKVTDIGLK.S
Reverse_YNL257C	2	2	4.8%	1229	142819	8.6	U	SIP3 SGDID:S000005201, Chr XIV from 164321-160632, reverse complement, Verified ORF, "Protein that activates transcription through interaction with DNA-bound Snf1p, C-terminal region has a putative leucine zipper motif; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_26.09082.09082.4	2.7192	0.0032	37.8	4481.6963	4479.1455	6260.8	141	3.117	16.2	1	K.EQSEKEMQEFKVLIEENSNPNKIAKNELLYQLKSAILK.Y
*	Jamie_Alpha_SPB_44.15775.15775.3	2.0098	0.014	27.6	2647.7644	2647.0986	6136.4	17	2.432	26.2	1	K.NPCWLAEFKFLLLEEPLKELR.Q
YAR042W	2	2	4.8%	1188	135070	5.6	U	SWH1 SGDID:S000000081, Chr I from 192613-196179, Verified ORF, "Protein similar to mammalian oxysterol-binding protein; contains ankyrin repeats; localizes to the Golgi and the nucleus-vacuole junction" 
*	Jamie_Alpha_SPB_61.21981.21981.3	1.8752	0.028	27.9	4402.4043	4400.9854	9451.3	14	2.894	15.4	1	K.DREILLHNGPYSPSLALSHGLSSKVSNKENLHATSKRLTK.S
*	Jamie_Alpha_SPB_37.13359.13359.2	1.9807	0.153	38.3	1813.0521	1811.1064	6782.6	1	4.091	40.6	1	K.PNNTVIGILMGKPQVDN.S
Reverse_YHR158C	3	3	4.8%	1164	131094	5.4	U	KEL1 SGDID:S000001201, Chr VIII from 417182-413688, reverse complement, Verified ORF, "Protein required for proper cell fusion and cell morphology; functions in a complex with Kel2p to negatively regulate mitotic exit, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_48.17017.17017.3	1.8708	0.0984	50.2	3342.8643	3346.6726	9230.8	2	3.233	20.5	1	K.ITIDVPESLKDIETNNQSLESSENYHKIK.F
*	Jamie_Alpha_SPB_115.41170.41170.1	1.3754	0.019	13.2	909.18	908.0422	5114.6	5	3.32	61.1	1	K.PAPSPASALP.A
*	Jamie_Alpha_SPB_50.18034.18034.2	1.2609	0.166	20.5	1982.5922	1985.3057	8085.3	118	3.706	28.1	1	Y.EEVRAYDFKDGGMILIK.D
Reverse_YPL249C	2	2	4.8%	894	101800	4.8	U	GYP5 SGDID:S000006170, Chr XVI from 79353-76669, reverse complement, Verified ORF, "GTPase-activating protein (GAP) for yeast Rab family members, involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p" 
*	Jamie_Alpha_SPB_83.29821.29821.3	2.5384	0.2363	39.0	3411.6543	3413.6758	9924.1	35	4.484	18.8	1	N.EVENYESLNELFSTFTSKLFSQGEQLSER.T
*	Jamie_Alpha_SPB_36.12972.12972.2	2.1217	0.0993	31.8	1593.0922	1594.7588	6060.2	2	3.96	50.0	1	P.IIAIEEYQDSPTSK.I
YDR385W	3	3	4.8%	842	93289	6.3	U	EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" 
YOR133W	3	3	4.8%	842	93289	6.3	U	EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" 
	Jamie_Alpha_SPB_30.10609.10609.2	3.6644	0.4275	100.0	1775.7722	1775.9221	5271.9	1	7.472	60.0	1	K.STAISLYSEMSDEDVK.E
	Jamie_Alpha_SPB_43.15522.15522.2	2.4222	0.0666	94.8	2181.372	2180.4197	8824.7	1	3.443	42.1	1	K.AEPIDEEVSLAIENGIINPR.D
	Jamie_Alpha_SPB_18.06243.06243.2	2.0134	0.0568	20.7	1603.2322	1602.7875	6872.1	1	3.057	53.8	1	L.AIENGIINPRDDFK.A
Reverse_YDR207C	2	2	4.8%	836	91124	9.5	U	UME6 SGDID:S000002615, Chr IV from 867517-865007, reverse complement, Verified ORF, "Key transcriptional regulator of early meiotic genes, binds URS1 upstream regulatory sequence, couples metabolic responses to nutritional cues with initiation and progression of meiosis, forms complex with Ime1p, and also with Sin3p-Rpd3p" 
*	Jamie_Alpha_SPB_65.23280.23280.2	1.9234	0.1456	12.7	1348.9521	1349.3971	4940.2	4	4.025	46.9	1	S.GTGAGSGAATTGPSSVA.P
*	Jamie_Alpha_SPB_82.29515.29515.3	1.9674	0.1144	58.2	2290.4343	2291.3958	6493.5	8	3.107	28.4	1	K.PDSPTNSPALPSAAAHVANDSDR.R
Reverse_YLR135W	2	2	4.8%	748	84362	5.0	U	SLX4 SGDID:S000004125, Chr XII from 413282-415528, Verified ORF, "Subunit of a complex, with Slx1p, that hydrolyzes 5' branches from duplex DNA in response to stalled or converging replication forks; function overlaps with that of Sgs1p-Top3p" 
*	Jamie_Alpha_SPB_56.19970.19970.3	2.7033	0.2108	13.9	2504.4243	2506.865	6387.7	95	4.105	25.0	1	T.TLNKQPIITPTRTAPVQVQNSAQ.S
*	Jamie_Alpha_SPB_41.14600.14600.2	1.6548	0.1118	23.0	1430.6921	1429.4893	4728.5	226	3.554	41.7	1	R.RKATVNANSHTDD.A
Reverse_YPL167C	4	4	4.7%	1504	172956	8.6	U	REV3 SGDID:S000006088, Chr XVI from 237106-232592, reverse complement, Verified ORF, "Subunit of DNA polymerase zeta, which is involved in DNA repair; required for mutagenesis induced by DNA damage" 
*	Jamie_Alpha_SPB_116.41725.41725.1	1.4547	0.0075	12.5	1011.25	1012.0642	6634.2	216	2.771	50.0	1	N.EIGADSTYR.Y
*	Jamie_Alpha_SPB_71.25516.25516.2	1.4706	0.1765	31.8	2532.8323	2535.1223	7856.5	64	3.906	23.8	1	K.KIMVRVDLIDTLMKSLTSKRVS.T
*	Jamie_Alpha_SPB_113.40676.40676.1	1.1823	0.0894	27.3	1333.47	1334.5175	5771.8	47	3.572	35.0	1	N.TLSEFSFHPLR.K
*	Jamie_Alpha_SPB_71.25378.25378.3	2.4378	0.2317	10.5	3431.9944	3435.8364	8576.3	7	4.72	19.6	1	N.VQDDNKKDQMSNNNIEIQPLRPWLQPLAE.Y
Reverse_YDR011W	3	3	4.7%	1501	168766	7.6	U	SNQ2 SGDID:S000002418, Chr IV from 465916-470421, Verified ORF, "ABC transporter protein involved in multidrug resistance and resistance to singlet oxygen species" 
*	Jamie_Alpha_SPB_30.10774.10774.4	2.9014	0.2031	13.8	4210.8564	4212.664	9520.1	51	4.164	16.2	1	Q.AFEPSNLWYTEFEEATRPVKNEYGPKILHFGNPDTL.A
*	Jamie_Alpha_SPB_55.19537.19537.4	2.5975	0.1919	15.7	3921.3765	3920.439	6427.5	3	3.942	19.6	1	F.ATSKLLNTMIRIAKAYELATSADLGRTANDWCYIS.G
*	Jamie_Alpha_SPB_85.30595.30595.2	1.8111	0.1567	15.4	1835.7922	1837.086	5053.5	249	3.927	31.2	1	I.RIAKAYELATSADLGRT.A
Reverse_YCR011C	3	3	4.7%	1049	117231	5.2	U	ADP1 SGDID:S000000604, Chr III from 136870-133721, reverse complement, Verified ORF, "Putative ATP-dependent permease of the ABC transporter family of proteins" 
*	Jamie_Alpha_SPB_95.34225.34225.2	1.6638	0.0914	11.7	1823.8922	1824.0435	6766.1	129	3.574	33.3	1	R.RKGQPGAEFTIDILYD.A
*	Jamie_Alpha_SPB_40.14233.14233.2	1.6322	0.1896	37.0	1005.6922	1003.1032	3194.9	1	4.475	61.1	1	I.PSKSSGLGNR.F
*	Jamie_Alpha_SPB_93.33393.33393.3	2.6133	0.1742	90.9	2529.8342	2534.1584	5750.6	3	3.381	28.4	1	K.SIYFTAFTFLALVMVATLALVLK.G
YHR082C	3	3	4.7%	1029	117082	6.6	U	KSP1 SGDID:S000001124, Chr VIII from 271550-268461, reverse complement, Verified ORF, "Nonessential putative serine/threonine protein kinase of unknown cellular role; overproduction causes allele-specific suppression of the prp20-10 mutation" 
*	Jamie_Alpha_SPB_93.33525.33525.2	1.8992	0.182	10.1	1916.0521	1915.9916	7417.8	91	4.075	36.7	1	L.SRYNMSYNHNNNSSIN.G
*	Jamie_Alpha_SPB_27.09764.09764.2	1.7962	0.0159	73.8	1869.6122	1871.0753	4445.5	47	3.268	40.6	1	R.SSANESNPLHMNKALEK.L
*	Jamie_Alpha_SPB_13.04694.04694.2	2.3434	0.0395	22.9	1483.6122	1483.6641	4909.9	8	3.392	50.0	1	L.SSSPGAKSSFVGFPK.P
YOR211C	2	2	4.7%	902	101523	8.0	U	MGM1 SGDID:S000005737, Chr XV from 741632-738924, reverse complement, Verified ORF, "Mitochondrial GTPase related to dynamin, present in a complex containing Ugo1p and Fzo1p; required for normal morphology of cristae and for stability of Tim11p; homolog of human OPA1 involved in autosomal dominant optic atrophy" 
*	Jamie_Alpha_SPB_59.21202.21202.2	1.7761	0.1691	34.3	2726.0122	2724.3115	8802.4	7	3.58	25.0	1	V.RLLILRRQLATHPAILYSSPYIK.S
*	Jamie_Alpha_SPB_63.22537.22537.3	2.3003	0.1679	82.8	1907.0643	1903.2463	3676.1	115	3.534	27.8	1	R.LPIYVGGGMAAAGSYIAYK.M
Reverse_YDR351W	2	2	4.7%	864	98971	8.3	U	SBE2 SGDID:S000002759, Chr IV from 1178657-1181251, Verified ORF, "Protein involved in the transport of cell wall components from the Golgi to the cell surface; required for bud growth" 
*	Jamie_Alpha_SPB_85.30342.30342.3	1.9156	0.2634	10.7	4324.4346	4320.643	5988.2	285	4.874	11.2	1	S.SPRRTGINKGNSGTTSSSASSGSRSKSLPLSCSKRETYESL.M
*	Jamie_Alpha_SPB_15.05275.05275.2	1.43	0.1968	12.4	1229.6322	1228.2151	5077.9	78	4.343	46.2	1	N.KGNSGTTSSSASSG.S
YDL148C	2	2	4.7%	810	94302	7.4	U	NOP14 SGDID:S000002307, Chr IV from 190587-188155, reverse complement, Verified ORF, "Nucleolar protein, forms a complex with Noc4p that mediates maturation and nuclear export of 40S ribosomal subunits; also present in the small subunit processome complex, which is required for processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_80.28670.28670.2	1.4449	0.0451	70.4	1530.3121	1528.7953	5910.3	381	2.794	28.6	1	K.AALKARGLTGQTNVK.S
*	Jamie_Alpha_SPB_42.15178.15178.4	3.249	0.2606	11.1	2909.3364	2910.4539	5517.3	393	4.755	21.2	1	A.QLKKERKFTMKEIRKDAKFEARQ.R
YOR373W	3	3	4.7%	851	94104	7.0	U	NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" 
*	Jamie_Alpha_SPB_17.05847.05847.2	2.743	0.2524	100.0	2021.8522	2020.1655	7554.5	1	4.851	47.2	1	K.VPSGFSGTTATSHQEAQWK.Q
*	Jamie_Alpha_SPB_26.09400.09400.2	1.7897	0.1213	93.9	1479.8322	1480.661	6610.5	186	3.756	45.8	1	K.DLSGVLETNTFKR.H
*	Jamie_Alpha_SPB_12.04279.04279.2	1.644	0.0097	73.7	913.1922	913.02136	4221.8	8	3.977	64.3	1	R.NNPITTPR.H
Reverse_YPL158C	2	2	4.7%	758	84846	6.7	U	YPL158C SGDID:S000006079, Chr XVI from 254309-252033, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_17.06014.06014.2	1.417	0.0252	68.7	983.7322	986.1564	4406.2	9	2.921	66.7	1	R.AIANLATSPK.S
*	Jamie_Alpha_SPB_102.36727.36727.3	3.0058	0.1813	14.0	2765.2144	2767.749	6502.7	4	3.64	25.0	1	S.STTNDSINAFSYYGNSSYGSNTNTNS.T
Reverse_YPR179C	2	2	4.7%	655	75463	6.3	U	HDA3 SGDID:S000006383, Chr XVI from 895760-893793, reverse complement, Verified ORF, "Subunit of a possibly tetrameric trichostatin A-sensitive class II histone deacetylase complex that contains an Hda1p homodimer and an Hda2p-Hda3p heterodimer; required for the activity of the complex; has similarity to Hda2p" 
*	Jamie_Alpha_SPB_13.04674.04674.2	2.0937	0.1102	11.0	1644.6122	1642.7227	5812.1	70	3.343	37.5	1	I.NDEIGAVTSSAAKNAGH.R
*	Jamie_Alpha_SPB_41.14794.14794.2	1.8942	0.1159	31.3	1553.0721	1550.7983	5436.0	9	3.704	46.2	1	N.EALHAPVDRTILSK.P
YPL104W	2	2	4.7%	658	75461	8.7	U	MSD1 SGDID:S000006025, Chr XVI from 355697-357673, Verified ORF, "Mitochondrial aspartyl-tRNA synthetase, required for acylation of aspartyl-tRNA; yeast and bacterial aspartyl-, asparaginyl-, and lysyl-tRNA synthetases contain regions with high sequence similarity, suggesting a common ancestral gene" 
*	Jamie_Alpha_SPB_84.30165.30165.3	2.8322	0.2014	15.0	2605.3743	2607.8857	5494.4	240	4.091	25.0	1	L.VPTRTKRSDGKPSFYALDQSPQQ.Y
*	Jamie_Alpha_SPB_16.05538.05538.2	1.9353	0.0143	10.7	1069.1322	1067.279	4641.1	1	3.259	78.6	1	V.WSKFSKKR.G
Reverse_YDL054C	2	2	4.7%	486	53566	9.0	U	MCH1 SGDID:S000002212, Chr IV from 361285-359825, reverse complement, Verified ORF, "Protein with similarity to mammalian monocarboxylate permeases, which are involved in transport of monocarboxylic acids across the plasma membrane; mutant is not deficient in monocarboxylate transport" 
*	Jamie_Alpha_SPB_36.12948.12948.2	1.5749	0.1716	13.7	1232.9722	1233.4247	4286.5	293	3.948	45.5	1	T.PVLGWPSASSTM.K
*	Jamie_Alpha_SPB_15.05173.05173.2	2.0089	0.0564	22.7	1374.2122	1374.499	6169.6	6	3.375	60.0	1	T.QTFKEQVHNSR.E
Reverse_YHR186C	3	3	4.6%	1557	177608	7.8	U	KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors" 
*	Jamie_Alpha_SPB_74.26649.26649.2	1.7523	0.1498	14.8	1351.1522	1350.474	4257.8	325	3.9	45.0	1	Q.EKKFANNDVRE.N
*	Jamie_Alpha_SPB_89.31840.31840.3	1.6536	0.2814	13.2	5392.0444	5388.162	5745.7	2	4.497	10.4	1	T.MTLPNGSNIMASGNTASMGNVGWDPVLVTVFYMYGKEKILESQTNKYDI.S
*	Jamie_Alpha_SPB_73.26182.26182.2	1.8023	0.1194	10.5	1520.7122	1517.7603	5637.4	98	3.351	45.5	1	E.DMALDWSKWMPH.T
Reverse_YLR398C	3	3	4.6%	1287	146058	6.7	U	SKI2 SGDID:S000004390, Chr XII from 919019-915156, reverse complement, Verified ORF, "Putative RNA helicase, involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs; forms complex with Ski3p and Ski8p; required for repressing propagation of dsRNA viruses" 
*	Jamie_Alpha_SPB_20.07212.07212.2	1.9361	0.1516	39.0	1016.65216	1018.1178	4154.2	10	3.882	60.0	1	R.KNSGIAGAGRS.G
*	Jamie_Alpha_SPB_88.31676.31676.2	1.5838	0.1602	31.0	1913.0322	1911.2238	6972.2	33	3.703	34.4	1	K.QNSLAKIPSTYITKTMN.R
*	Jamie_Alpha_SPB_18.06404.06404.4	2.9745	0.1754	17.0	4303.7764	4308.874	6842.3	25	3.785	17.1	1	P.STYITKTMNRHAMAIAYEAVVTKGASTHAAVFVSDGQELH.Y
YBL005W	2	2	4.6%	976	112571	6.6	U	PDR3 SGDID:S000000101, Chr II from 217473-220403, Verified ORF, "Transcriptional activator of the pleiotropic drug resistance network, regulates expression of ATP-binding cassette (ABC) transporters through binding to cis-acting sites known as PDREs (PDR responsive elements)" 
*	Jamie_Alpha_SPB_117.41842.41842.3	2.0136	0.2462	14.8	3746.3044	3746.4407	8181.5	109	4.04	14.8	1	A.FSLRGIGYLIKKNIENTGSSMLIDTKETIYLIL.R
*	Jamie_Alpha_SPB_23.07989.07989.2	1.6219	0.0712	11.2	1274.8322	1276.4789	6600.3	252	3.955	40.9	1	F.SRSSSLVAISIR.I
Reverse_YOR329C	2	2	4.6%	872	97305	7.8	U	SCD5 SGDID:S000005856, Chr XV from 939344-936726, reverse complement, Verified ORF, "Protein required for normal cortical actin organization and endocytosis; multicopy suppressor of clathrin deficiency; acts as a targeting subunit for protein phosphatase type 1" 
*	Jamie_Alpha_SPB_79.28412.28412.3	2.071	0.0447	39.8	2373.8943	2373.6653	5857.0	4	3.398	27.4	1	R.TTKGTLLLSAFSDFDVKQDGTK.A
*	Jamie_Alpha_SPB_85.30578.30578.2	1.9451	0.1096	32.9	1862.9922	1862.0519	5974.7	144	3.649	35.3	1	T.NIGFDFSVSPPGLGNSPR.K
YPL105C	2	2	4.6%	849	94356	7.8	U	YPL105C SGDID:S000006026, Chr XVI from 355409-352860, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_43.15430.15430.2	1.687	0.1607	12.7	2117.7922	2116.422	10900.0	433	3.948	26.3	1	Q.KEILSSAQIPKTQTGSAWGI.K
*	Jamie_Alpha_SPB_23.08088.08088.4	3.0421	0.2096	40.6	2012.2565	2010.3105	3867.6	18	4.426	32.4	1	K.TKMSDKSKQIGSSTSIPTL.K
Reverse_YMR207C	3	3	4.5%	2123	241784	8.0	U	HFA1 SGDID:S000004820, Chr XIII from 683563-677192, reverse complement, Verified ORF, "Mitochondrial acetyl-coenzyme A carboxylase, catalyzes the production of malonyl-CoA in mitochondrial fatty acid biosynthesis" 
*	Jamie_Alpha_SPB_68.24286.24286.4	2.8467	0.2047	16.7	2665.4966	2670.997	5331.1	165	4.349	22.5	1	K.RYKISVVGDPELVGGRSEVDAYME.M
*	Jamie_Alpha_SPB_66.23718.23718.2	1.6957	0.1687	15.0	1364.2322	1364.6774	6205.5	2	3.757	42.3	1	A.IVGVPIGGLRARGV.I
*	Jamie_Alpha_SPB_81.29034.29034.4	1.1195	0.1541	46.0	6476.4165	6477.374	3282.7	113	3.678	4.4	1	K.MIEIEAYQQGAFVHDGSRVLYKVLKGPTPSIVQTPNLEAELFITNSDISLRTGRIDDK.W
Reverse_YER132C	2	2	4.5%	1753	195382	7.8	U	PMD1 SGDID:S000000934, Chr V from 430445-425184, reverse complement, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Mds3p, for growth under alkaline conditions" 
*	Jamie_Alpha_SPB_44.15771.15771.4	2.7698	0.3035	83.3	3877.9766	3883.3994	7682.1	119	4.729	16.7	1	V.STRPSIQTSPAQSFKISSKRFGESIPSSSAFKLAPR.T
*	Jamie_Alpha_SPB_53.18992.18992.4	2.5272	0.1678	10.1	4617.8164	4613.3267	7986.6	74	4.135	14.3	1	N.LPLTLGGHVFVGSRALEVAAGTRCELTLKKRTAEDLNPNPVIP.L
YGR109W-B	5	5	4.5%	1547	178419	8.8	U	YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YIL082W-A	5	5	4.6%	1498	172454	9.2	U	YIL082W-A SGDID:S000003537, Chr IX from 205632-206482,206484-210129, transposable_element_gene, "Hypothetical protein" 
	Jamie_Alpha_SPB_27.09552.09552.2	4.9241	0.5053	100.0	1729.7522	1729.8561	9930.2	1	8.046	78.6	1	K.DAMEEAYQTTALTER.F
	Jamie_Alpha_SPB_115.41409.41409.1	1.2744	0.0298	12.1	956.07	956.1729	5514.3	123	2.741	57.1	1	K.TLPIVHYI.A
	Jamie_Alpha_SPB_31.11150.11150.2	1.7725	0.0959	25.1	1297.6322	1300.587	5209.8	5	3.589	55.0	1	D.YQLLIGNPILR.R
	Jamie_Alpha_SPB_22.07828.07828.2	2.2655	0.0727	30.5	1816.1721	1816.102	6458.8	2	3.522	41.2	1	R.TKTLSLATTTPAAIDPLT.T
	Jamie_Alpha_SPB_48.17036.17036.2	1.4085	0.0587	72.2	1813.9321	1813.1039	7489.4	133	2.809	28.1	1	K.LVGVVGYFSKSLESAQK.N
YHR186C	2	2	4.5%	1557	177608	7.8	U	KOG1 SGDID:S000001229, Chr VIII from 480672-475999, reverse complement, Verified ORF, "Subunit of TORC1, a rapamycin-sensitive complex involved in growth control that contains Tor1p or Tor2p, Lst8p and Tco89p; contains four HEAT repeats and seven WD-40 repeats; may act as a scaffold protein to couple TOR and its effectors" 
*	Jamie_Alpha_SPB_16.05703.05703.4	3.5752	0.1549	15.1	3359.9766	3364.7397	4311.5	264	4.062	17.2	1	A.TGTKQIKIWTTSGDLLNSFKNSHNNGVTSTL.A
*	Jamie_Alpha_SPB_75.26890.26890.4	2.9595	0.2018	13.2	4128.5767	4127.611	7416.3	7	3.956	16.7	1	L.AATGIPKSLSYSSTSDAFLSSMAFHPHRMMIAATNSHDS.I
Reverse_YMR196W	2	2	4.5%	1088	126624	5.4	U	YMR196W SGDID:S000004809, Chr XIII from 655075-658341, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_72.25944.25944.3	1.6532	0.0515	30.1	3061.4644	3065.401	8904.9	235	2.813	19.0	1	K.EENFLKVLNSENDTFLLLPDIDEVEK.D
*	Jamie_Alpha_SPB_89.32080.32080.3	2.0397	0.0954	54.5	2897.6643	2901.1685	9100.6	221	3.353	21.6	1	K.EHNRNERLREEEVTSDVFKDRLK.N
YPL022W	2	2	4.5%	1100	126370	5.5	U	RAD1 SGDID:S000005943, Chr XVI from 506695-509997, Verified ORF, "Single-stranded DNA endonuclease (with Rad10p), cleaves single-stranded DNA during nucleotide excision repair and double-strand break repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); homolog of human XPF protein" 
*	Jamie_Alpha_SPB_89.31864.31864.2	1.9114	0.1012	25.1	1827.6522	1829.2388	6839.1	183	3.682	39.3	1	E.AQLVISYAKKRIFYK.N
*	Jamie_Alpha_SPB_79.28282.28282.4	3.0729	0.0082	45.3	3931.9766	3926.3787	9258.9	102	3.159	17.7	1	K.LVKEVQSQDTFPENATLNVSSTFSKEQVTTKRRR.T
YNL085W	2	2	4.5%	830	94494	5.6	U	MKT1 SGDID:S000005029, Chr XIV from 467133-469625, Verified ORF, "Protein that forms a complex with Pbp1p that may mediate posttranscriptional regulation of HO endonuclease; involved in propagation of M2 dsRNA satellite of L-A virus" 
*	Jamie_Alpha_SPB_30.10843.10843.2	1.9026	0.1098	10.8	1608.3322	1608.8384	6175.9	103	3.64	45.8	1	L.VFLKCDVLKLDEE.V
*	Jamie_Alpha_SPB_17.06138.06138.2	2.4358	0.0771	13.3	2893.5322	2891.2683	8006.1	296	3.557	23.9	1	S.TPNLDEQFVESHRFLLEISKVMQE.L
YLR258W	2	2	4.5%	705	80079	6.4	U	GSY2 SGDID:S000004248, Chr XII from 660718-662835, Verified ORF, "Glycogen synthase, similar to Gsy1p; expression induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regulated by cAMP-dependent, Snf1p and Pho85p kinases as well as by the Gac1p-Glc7p phosphatase" 
*	Jamie_Alpha_SPB_79.28176.28176.2	1.3042	0.0039	63.6	2533.9722	2532.8677	5689.5	158	3.351	25.0	1	R.FKAPDESVEQLVDYMEEFVKK.T
*	Jamie_Alpha_SPB_115.41109.41109.1	1.5205	0.1524	20.0	1080.6	1080.2725	5633.4	46	3.593	45.0	1	K.VARPLSVPGSP.R
YMR037C	2	2	4.5%	704	77861	6.6	U	MSN2 SGDID:S000004640, Chr XIII from 346516-344402, reverse complement, Verified ORF, "Transcriptional activator related to Msn4p; activated in stress conditions, which results in translocation from the cytoplasm to the nucleus; binds DNA at stress response elements of responsive genes, inducing gene expression" 
*	Jamie_Alpha_SPB_79.28330.28330.2	1.4379	0.2023	11.6	2697.632	2695.1587	6931.0	9	4.32	23.9	1	S.LRRRKSAVPLMGTVPLTNQQNNIS.S
	Jamie_Alpha_SPB_113.40419.40419.1	1.6459	0.0405	22.7	1063.91	1063.2075	5743.3	2	3.804	64.3	1	K.RSEHLKRH.V
YJR092W	3	3	4.4%	1448	165023	5.0	U	BUD4 SGDID:S000003852, Chr X from 598649-602995, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_96.34578.34578.2	1.3858	0.1876	32.8	2469.112	2470.7537	7114.6	244	3.737	26.1	1	P.AAVHQERIKNSVANGALGHANSPK.V
*	Jamie_Alpha_SPB_25.08956.08956.2	1.9446	0.2095	10.1	2119.0723	2118.3264	5831.2	298	3.806	29.4	1	L.NNLKNMAQDIDKLARDEE.K
*	Jamie_Alpha_SPB_76.27384.27384.2	1.5278	0.1894	12.5	2478.8323	2481.6448	9189.3	3	4.026	31.0	1	I.DFKGKAETSSASSERDSYKKCV.I
YER110C	2	2	4.4%	1113	122601	4.6	U	KAP123 SGDID:S000000912, Chr V from 382099-378758, reverse complement, Verified ORF, "Karyopherin beta, mediates nuclear import of ribosomal proteins prior to assembly into ribosomes and import of histones H3 and H4; localizes to the nuclear pore, nucleus, and cytoplasm; exhibits genetic interactions with RAI1" 
*	Jamie_Alpha_SPB_69.24601.24601.4	3.5824	0.176	11.8	3666.8965	3671.2856	5790.2	1	4.037	21.5	1	I.YNYATVALDGLLEFIAYDAIAKYLDPLMNKLF.Y
*	Jamie_Alpha_SPB_94.33678.33678.2	1.6501	0.1684	13.7	1719.8522	1720.9236	4854.3	101	3.57	34.4	1	Q.SKSKNKRSSAVGAASEL.A
YMR189W	2	2	4.4%	1034	114451	7.3	U	GCV2 SGDID:S000004801, Chr XIII from 637499-640603, Verified ORF, "P subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" 
*	Jamie_Alpha_SPB_92.33060.33060.3	2.1514	0.2093	10.8	3558.5942	3562.9731	10077.6	413	4.24	17.2	1	S.RRIFSLTSILANAIENDSCPHELINKTWFD.T
*	Jamie_Alpha_SPB_101.36147.36147.2	1.9733	0.1009	28.0	1835.6721	1833.0996	5726.0	1	3.778	50.0	1	K.RLQDYGFHAPTLAFPV.P
YJR059W	2	2	4.4%	818	91400	8.9	U	PTK2 SGDID:S000003820, Chr X from 545701-548157, Verified ORF, "Putative serine/threonine protein kinase involved in regulation of ion transport across plasma membrane; enhances spermine uptake" 
*	Jamie_Alpha_SPB_29.10305.10305.2	2.5831	0.0657	13.1	1836.0922	1837.1438	9003.4	500	3.158	35.7	1	V.YALKKLNMIYHESPE.K
*	Jamie_Alpha_SPB_31.11114.11114.2	2.235	0.1	12.7	2386.0122	2384.9558	7258.5	3	3.265	32.5	1	A.MDSYALGIMLITMINNIIPFI.D
YLR319C	2	2	4.4%	788	88817	7.8	U	BUD6 SGDID:S000004311, Chr XII from 771684-769318, reverse complement, Verified ORF, "Actin- and formin-interacting protein, involved in actin cable nucleation and polarized cell growth; isolated as bipolar budding mutant; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_9.03039.03039.2	1.1472	0.2629	13.3	2412.8523	2410.7324	3948.9	350	4.849	11.9	1	Q.VLTQWSKGTTSGRLVSDAYVQL.G
*	Jamie_Alpha_SPB_32.11443.11443.3	2.0338	0.0148	30.8	1563.4744	1562.8093	4089.8	252	2.629	37.5	1	R.SNINETIFNILRK.V
Reverse_YOR353C	2	2	4.4%	791	87326	7.4	U	SOG2 SGDID:S000005880, Chr XV from 1000823-998448, reverse complement, Verified ORF, "Protein required for cell morphogenesis and cell separation after mitosis" 
*	Jamie_Alpha_SPB_19.06612.06612.2	2.3986	0.1054	40.8	1251.2122	1251.2926	6140.7	81	3.496	59.1	1	A.KSASGSVQDDEK.I
*	Jamie_Alpha_SPB_39.13870.13870.2	1.6859	0.145	11.1	2736.8523	2735.9292	9756.3	1	4.383	31.8	1	L.RKFYDNYKTHNYLETGNVAGSQE.S
Reverse_YNL197C	2	2	4.4%	661	71253	8.4	U	WHI3 SGDID:S000005141, Chr XIV from 269594-267609, reverse complement, Verified ORF, "RNA binding protein that binds to and sequesters the G1 cyclin CLN3 mRNA; regulates cell fate and dose-dependently inhibits passage through Start by regulating the critical cell size requirement necessary for cell cycle progression" 
*	Jamie_Alpha_SPB_11.03961.03961.3	2.5416	0.1878	16.7	1527.8344	1523.7324	6902.5	140	3.789	34.6	1	S.SLRAPPVKQPTNSQ.N
*	Jamie_Alpha_SPB_68.24369.24369.2	1.6993	0.0861	11.5	1712.9521	1714.925	7302.9	70	3.742	35.7	1	I.SKVGEALAFIAYCER.L
Reverse_YBR127C	2	2	4.4%	517	57749	5.1	U	VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" 
*	Jamie_Alpha_SPB_34.12091.12091.2	1.9362	0.0887	92.1	1752.4922	1749.6556	6820.0	203	3.584	39.3	1	R.TDPDEEDEDADDRAR.D
*	Jamie_Alpha_SPB_114.40923.40923.1	1.4143	0.0596	30.3	960.72	960.13635	6404.9	132	3.353	50.0	1	K.PSIRNLME.K
Reverse_YDR210W-B	3	3	4.3%	1770	202094	8.2	U	YDR210W-B SGDID:S000007393, Chr IV from 872107-873399,873401-877420, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_66.23517.23517.4	3.1721	0.1523	10.0	3525.0166	3525.829	7639.0	9	3.858	21.0	1	R.KQNRATFTSSHRPSTTDSEITGGMETSEKNII.H
	Jamie_Alpha_SPB_71.25389.25389.3	2.7784	0.1853	12.5	2742.8943	2741.9834	6692.3	1	3.946	26.0	1	T.SENIHDSNVRSFKSSTAINHAKAAR.P
	Jamie_Alpha_SPB_7.02303.02303.3	1.9383	0.3051	23.5	2351.6042	2347.486	5022.2	115	4.74	18.1	1	P.YHPDPQYYAPSTQYHSCTM.M
YJR033C	2	2	4.3%	1357	154932	8.2	U	RAV1 SGDID:S000003794, Chr X from 496365-492292, reverse complement, Verified ORF, "Subunit of the RAVE complex (Rav1p, Rav2p, Skp1p), which promotes assembly of the V-ATPase holoenzyme; required for transport between the early and late endosome/PVC and for localization of TGN membrane proteins; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_56.19897.19897.3	2.0431	0.0437	37.7	3337.0745	3332.7068	7279.9	42	2.941	19.4	1	R.WKKEPDQVSKNNTASHALYTLCEDKVLR.I
*	Jamie_Alpha_SPB_31.10915.10915.3	2.0963	0.0677	46.7	3683.3044	3685.3862	6237.6	2	3.383	19.2	1	K.QILLSLWKMAIGHPEQQKMVRFISNDFTVPR.W
Reverse_YNL091W	3	3	4.3%	1240	141514	5.4	U	NST1 SGDID:S000005035, Chr XIV from 452410-456132, Verified ORF, "Protein of unknown function, mediates sensitivity to salt stress; interacts physically with the splicing factor Msl1p and also displays genetic interaction with MSL1" 
*	Jamie_Alpha_SPB_117.41937.41937.2	1.8263	0.3173	44.4	2148.372	2150.4827	10401.9	1	5.463	35.0	1	S.PLLLDHVNFGTPSVPKSAAVS.N
*	Jamie_Alpha_SPB_30.10734.10734.3	2.5494	0.0124	48.4	1217.0044	1217.3677	6669.9	141	2.778	43.8	1	K.KLREKEEER.K
*	Jamie_Alpha_SPB_75.26996.26996.4	2.4456	0.1089	67.9	2813.2966	2819.2944	5382.9	155	2.977	23.5	1	K.KDRGSMFRTFLEKELQSVDKFKK.S
Reverse_YNL087W	2	2	4.3%	1178	132509	8.5	U	TCB2 SGDID:S000005031, Chr XIV from 462413-465949, Verified ORF, "Bud-specific protein with a potential role in membrane trafficking; GFP-fusion protein migrates from the cell surface to intracellular vesicles near vacuole; contains 3 calcium and lipid binding domains; mRNA is targeted to the bud via the mRNA transport system involving She2p" 
*	Jamie_Alpha_SPB_31.10909.10909.2	1.1313	0.1774	11.7	3116.0122	3117.6526	7182.0	137	4.043	18.5	1	D.VEKAEELSLVPVVPYFSLYYTVTGKVGK.K
*	Jamie_Alpha_SPB_37.13168.13168.2	2.3898	0.0177	19.4	2404.9521	2404.7317	6278.6	400	3.201	25.0	1	R.ENTRGRAVGNVSVKAYPSIKGLS.D
Reverse_YOL098C	2	2	4.3%	1037	118392	5.0	U	YOL098C SGDID:S000005458, Chr XV from 135837-132724, reverse complement, Uncharacterized ORF, "Putative metalloprotease" 
*	Jamie_Alpha_SPB_112.40354.40354.1	1.4297	0.0456	89.3	1009.52	1010.9897	5576.8	32	3.886	64.3	1	K.EDDFEAER.Q
*	Jamie_Alpha_SPB_72.25752.25752.3	2.0167	0.0489	39.0	3920.3044	3922.2537	8077.7	323	3.189	15.3	1	K.SFGKWGASSLTYVTQDTDTWANTNSLSLNGATDLLGK.Y
Reverse_YLL003W	2	2	4.3%	946	112978	9.8	U	SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" 
*	Jamie_Alpha_SPB_15.05431.05431.2	1.9626	0.0255	15.6	1032.5721	1032.2089	4342.8	13	3.275	71.4	1	S.PMNRTTRR.P
*	Jamie_Alpha_SPB_64.22910.22910.4	2.6637	0.1461	80.5	4184.2563	4184.7993	7744.3	179	3.781	17.2	1	R.NRWANFLQSQLEREKSKEYVHLIDNLKHRVKFR.T
YIL017C	3	3	4.3%	921	105491	5.9	U	VID28 SGDID:S000001279, Chr IX from 320963-318198, reverse complement, Verified ORF, "Protein involved in proteasome-dependent catabolite degradation of fructose-1,6-bisphosphatase (FBPase); localized to the nucleus and the cytoplasm" 
*	Jamie_Alpha_SPB_116.41713.41713.1	1.3988	0.0301	14.3	949.29	948.1533	5499.7	59	3.163	50.0	1	R.IALQGIPVH.E
*	Jamie_Alpha_SPB_68.24255.24255.2	1.8327	0.1	94.1	1465.9922	1466.5745	5500.3	350	3.583	45.0	1	R.HLMYNCQNEEK.F
*	Jamie_Alpha_SPB_55.19693.19693.2	1.5442	0.1849	12.2	2285.4922	2282.5994	8414.9	73	4.19	28.9	1	V.NLAAVNENKKQLVIEQDEIL.N
YNR047W	2	2	4.3%	893	100546	8.0	U	YNR047W SGDID:S000005330, Chr XIV from 708525-711206, Uncharacterized ORF, "Putative protein kinase that, when overexpressed, interferes with pheromone-induced growth arrest; localizes to the cytoplasm; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_37.13290.13290.2	2.034	0.129	15.8	1588.6522	1589.7477	6463.7	46	3.556	39.3	1	F.QPYANGSGIHFLSTP.T
*	Jamie_Alpha_SPB_55.19681.19681.3	2.7478	0.1872	13.4	2608.6743	2610.9287	7207.3	6	4.019	28.4	1	S.VPPPNSFFPQEPSPKISDFPEPR.R
YER109C	2	2	4.3%	798	86648	9.3	U	FLO8 SGDID:S000000911, Chr V from 377610-375211, reverse complement, Verified ORF, "Transcription factor required for flocculation, diploid filamentous growth, and haploid invasive growth; genome reference strain S288C and most laboratory strains have a mutation in this gene" 
*	Jamie_Alpha_SPB_24.08700.08700.2	1.8995	0.02	12.6	996.0122	993.1105	8303.6	6	2.752	83.3	1	Q.RQEQIYR.S
*	Jamie_Alpha_SPB_60.21656.21656.4	2.8219	0.1794	12.1	2697.4966	2703.0671	4936.1	83	3.288	24.4	1	K.TANSLPFPGINLGSFNKPAVSSPLSSV.T
Reverse_YOR069W	2	2	4.3%	675	76484	5.2	U	VPS5 SGDID:S000005595, Chr XV from 453769-455796, Verified ORF, "Nexin-1 homolog required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to the late Golgi apparatus; structural component of the retromer membrane coat complex; forms a retromer subcomplex with Vps17p" 
*	Jamie_Alpha_SPB_49.17566.17566.2	2.4708	0.0016	11.4	2488.912	2488.8184	6967.4	1	3.659	31.0	1	R.KSNRQARASDFLIRPKGSRRGS.I
*	Jamie_Alpha_SPB_96.34345.34345.2	1.2715	0.1333	11.2	2730.9321	2731.0903	6605.8	11	3.832	22.9	1	R.QARASDFLIRPKGSRRGSISKSTNP.S
YCR061W	2	2	4.3%	631	70922	6.1	U	YCR061W SGDID:S000000657, Chr III from 225558-227453, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" 
*	Jamie_Alpha_SPB_112.40081.40081.1	1.1719	0.0469	13.7	945.21	945.10986	5298.6	62	3.241	56.2	1	S.LALSAARSR.W
*	Jamie_Alpha_SPB_41.14628.14628.2	1.6568	0.088	10.4	2472.0723	2472.9233	6973.6	393	3.013	26.3	1	R.SRWYLPLLFVNLCICISSVM.A
Reverse_YDR292C	2	2	4.3%	621	69278	7.2	U	SRP101 SGDID:S000002700, Chr IV from 1045005-1043140, reverse complement, Verified ORF, "Signal recognition particle (SRP) receptor - alpha subunit; contain GTPase domains; involved in SRP-dependent protein targeting; interacts with SRP102p" 
*	Jamie_Alpha_SPB_67.24174.24174.2	1.7123	0.1798	36.0	1345.7322	1345.5388	3245.0	92	3.735	46.2	1	K.SLNTSKGVGNVGVI.S
*	Jamie_Alpha_SPB_48.17221.17221.2	1.9861	0.0742	24.3	1635.4321	1633.802	5220.3	109	3.408	41.7	1	G.EEDKKSRKSQIER.L
Reverse_YHL009W-B	2	2	4.2%	1802	207969	8.4	U	YHL009W-B SGDID:S000007372, Chr VIII from 85905-86990,86992-91314, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
*	Jamie_Alpha_SPB_101.36122.36122.4	2.1456	0.0726	47.7	5495.177	5491.9297	8378.9	124	3.466	12.4	1	K.VNTGISGEKPFSTEHNTKNFQEQILEPKANHMSEDKNTISEDTIDVCR.S
*	Jamie_Alpha_SPB_58.20739.20739.4	2.7943	0.0083	40.5	3080.6165	3082.5278	6477.6	362	2.681	19.9	1	R.DSIRNEDNIKITNKSGVLKEQIISPIR.H
YJR138W	2	2	4.2%	1584	181948	8.8	U	IML1 SGDID:S000003899, Chr X from 684482-689236, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane" 
*	Jamie_Alpha_SPB_46.16431.16431.3	2.113	0.0218	34.0	1916.0044	1916.19	4953.5	271	2.907	28.1	1	K.IPATATTTHGNTKFIWR.G
*	Jamie_Alpha_SPB_34.12004.12004.4	2.5252	0.0645	54.2	5303.7363	5308.945	4812.8	4	3.777	13.3	1	K.KNLSIFGLPSNEIMSGSPSSYLGSSHTRTSSKLSNMSDKAAFITEGQKSK.H
Reverse_YMR185W	2	2	4.2%	981	113249	5.2	U	YMR185W SGDID:S000004797, Chr XIII from 629024-631969, Uncharacterized ORF, "Protein required for cell viability" 
*	Jamie_Alpha_SPB_27.09720.09720.2	1.6071	0.0815	11.6	1523.2922	1522.8278	6804.7	8	3.041	45.8	1	R.QIYNIFVEGVKLV.D
*	Jamie_Alpha_SPB_14.05086.05086.4	3.2425	0.1649	16.1	3196.6965	3201.6006	5090.5	5	3.745	22.2	1	I.LSKLLSLVVEYYKSSSQEPFHISDTSKN.D
YDL035C	2	2	4.2%	961	110709	7.1	U	GPR1 SGDID:S000002193, Chr IV from 392054-389169, reverse complement, Verified ORF, "Plasma membrane G protein coupled receptor (GPCR) that interacts with the heterotrimeric G protein alpha subunit, Gpa2p, and with Plc1p; sensor that integrates nutritional signals with the modulation of cell fate via PKA and cAMP synthesis" 
*	Jamie_Alpha_SPB_75.26912.26912.2	2.1383	0.1215	12.9	2119.2122	2116.5088	9907.1	219	3.956	26.3	1	T.STFTAPQLLQLRIIAITASA.V
*	Jamie_Alpha_SPB_62.22059.22059.3	2.3933	3.0E-4	30.3	2397.2344	2398.6812	6661.8	25	3.016	30.3	1	K.RIKAQIGDFNHNVLEEEKEK.K
YKL064W	2	2	4.2%	969	109736	7.5	U	MNR2 SGDID:S000001547, Chr XI from 317408-320317, Verified ORF, "Putative magnesium transporter; has similarity to Alr1p and Alr2p, which mediate influx of Mg2+ and other divalent cations" 
*	Jamie_Alpha_SPB_33.11898.11898.3	2.2362	0.013	30.0	3411.3245	3408.869	10348.4	322	3.021	17.5	1	R.PSMSQPREGPQSVSSTVQPQPIMKFSTPSYK.K
*	Jamie_Alpha_SPB_53.18942.18942.2	1.3869	0.0343	68.8	1309.3922	1311.539	5937.4	209	2.59	44.4	1	K.KKMEENEKFK.R
YDL154W	2	2	4.2%	901	102209	5.3	U	MSH5 SGDID:S000002313, Chr IV from 178335-181040, Verified ORF, "Protein of the MutS family, forms a dimer with Msh4p that facilitates crossovers between homologs during meiosis; msh5-Y823H mutation confers tolerance to DNA alkylating agents; homologs present in C. elegans and humans" 
*	Jamie_Alpha_SPB_78.27993.27993.2	1.4401	0.1297	15.1	2321.5322	2318.719	9275.8	9	3.872	31.8	1	R.IIVVTGANASGKSVYLTQNGLIV.Y
*	Jamie_Alpha_SPB_69.24666.24666.2	1.7102	0.1074	22.4	1687.9922	1687.8994	6396.3	266	3.274	35.7	1	K.EGISKQSFGIYCAKV.C
YMR172W	2	2	4.2%	719	79416	8.0	U	HOT1 SGDID:S000004783, Chr XIII from 605980-608139, Verified ORF, "Transcription factor required for the transient induction of glycerol biosynthetic genes GPD1 and GPP2 in response to high osmolarity; targets Hog1p to osmostress responsive promoters; has similarity to Msn1p and Gcr1p" 
*	Jamie_Alpha_SPB_82.29222.29222.2	1.7692	0.109	25.6	1615.2122	1612.7397	5323.4	47	3.479	35.7	1	R.QLGPVINTQANQNQS.Q
*	Jamie_Alpha_SPB_117.42000.42000.2	1.837	0.1393	11.1	1623.0721	1620.719	7303.3	89	4.085	39.3	1	L.HGESATKPNINSDLH.Y
Reverse_YLR072W	2	2	4.2%	693	78212	6.2	U	YLR072W SGDID:S000004062, Chr XII from 278863-280944, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" 
*	Jamie_Alpha_SPB_24.08344.08344.2	1.7543	0.132	33.2	1349.3522	1347.3752	5135.4	287	3.963	50.0	1	R.DSGIESIEAEAEP.K
*	Jamie_Alpha_SPB_39.14096.14096.2	1.8669	0.0539	85.1	1651.1522	1651.8113	6147.1	1	3.123	43.3	1	R.NTVTEVSIASSNTTVK.D
contaminant_IGA4_HAEIN	3	3	4.1%	1849	202956	5.7	U	owl|P45386| IMMUNOGLOBULIN A1 PROTEASE PRECURSOR (EC 3.4.21.72) (IGA1 PROTEASE).... 
*	Jamie_Alpha_SPB_69.24703.24703.4	3.6311	0.1671	14.1	3709.9365	3707.1838	5710.9	32	3.972	18.2	1	G.DLNVEKGTLFLSGRPTPHARDIAGISSTKKDPHF.T
*	Jamie_Alpha_SPB_60.21466.21466.2	1.3332	0.1346	14.2	1212.7122	1213.4347	4119.6	19	3.011	56.2	1	P.KPRSRRTRR.S
*	Jamie_Alpha_SPB_83.29688.29688.4	3.3684	0.1708	14.9	3501.8965	3498.8767	5621.6	46	3.834	19.9	1	Y.HLGEFSITPILSARYDANQGNGKINVSVYDFA.Y
YOL075C	2	2	4.1%	1294	145157	7.1	U	YOL075C SGDID:S000005435, Chr XV from 193541-189657, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_99.35538.35538.4	3.198	0.1734	94.9	3584.2966	3585.9746	7918.9	231	3.601	18.2	1	K.LMVEQLIEELGLKDCADTLVGDNSHRGLSGGEK.R
*	Jamie_Alpha_SPB_39.13875.13875.2	1.7469	0.2326	70.1	2142.132	2139.4983	9686.2	1	4.437	36.8	1	K.ASLVGNMTFTVLSMGCGFFV.N
Reverse_YBR086C	2	2	4.1%	946	105854	9.0	U	IST2 SGDID:S000000290, Chr II from 423035-420195, reverse complement, Verified ORF, "Plasma membrane protein that may be involved in osmotolerance, localizes to the mother cell in small-budded cells and to the bud in medium- and large-budded cells; mRNA is transported to the bud tip by an actomyosin-driven process" 
*	Jamie_Alpha_SPB_16.05654.05654.2	1.5979	0.1354	25.0	2256.2922	2258.499	7140.0	38	3.894	27.5	1	P.NQVNVVHKPVIGNAVDDHSSK.L
*	Jamie_Alpha_SPB_104.37291.37291.2	1.6058	0.1756	12.4	2149.3123	2147.4417	7465.9	8	4.143	32.4	1	T.QLDHGPEIISHINLRKFE.V
YLR014C	2	2	4.1%	904	102724	7.4	U	PPR1 SGDID:S000004004, Chr XII from 174981-172267, reverse complement, Verified ORF, "Zinc finger transcription factor containing a Zn(2)-Cys(6) binuclear cluster domain, positively regulates transcription of genes involved in uracil biosynthesis; activity may be modulated by interaction with Tup1p" 
*	Jamie_Alpha_SPB_18.06450.06450.4	1.853	0.0541	39.5	1893.2965	1889.0721	3659.1	24	2.81	29.2	1	K.IRGNIPATSDDEPFDLK.K
*	Jamie_Alpha_SPB_42.14870.14870.2	1.8422	0.2234	10.3	2264.872	2265.5742	7522.7	8	4.654	31.6	1	T.VATYKRRATKYIASLFSSSD.R
YPL150W	2	2	4.1%	901	100646	9.4	U	YPL150W SGDID:S000006071, Chr XVI from 268187-270892, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_21.07480.07480.2	1.8493	0.1453	11.8	1906.0721	1906.3159	6735.1	205	3.956	31.2	1	F.KIDIWSLGVILYTLITG.Y
*	Jamie_Alpha_SPB_16.05472.05472.2	1.8315	0.0907	89.7	2149.2922	2150.4832	7095.1	35	3.828	28.9	1	K.GLPTPVLQTKGLIENGLNER.D
YLR127C	2	2	4.1%	853	99978	6.7	U	APC2 SGDID:S000004117, Chr XII from 398320-395759, reverse complement, Verified ORF, "Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; similar to cullin Cdc53p" 
*	Jamie_Alpha_SPB_21.07356.07356.2	1.5577	0.1706	11.4	1161.3322	1164.3185	4476.3	144	4.181	55.6	1	N.SLLTWMSPND.A
*	Jamie_Alpha_SPB_70.25099.25099.3	2.8802	0.1875	14.0	3009.8943	3005.3972	7440.8	12	4.824	24.0	1	I.VNEGNTNKELQLQLFSTLKEFYIFQ.V
YML034W	2	2	4.1%	834	95498	5.6	U	SRC1 SGDID:S000004497, Chr XIII from 209525-211444,211571-212155, Verified ORF, "Protein with a putative role in sister chromatid segregation, potentially phosphorylated by Cdc28p; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery" 
*	Jamie_Alpha_SPB_39.14040.14040.3	2.7274	0.1136	76.0	2662.4944	2661.0825	6572.1	268	3.416	23.9	1	K.CKPDYKLAPSRLDFLEIIPAQGK.C
*	Jamie_Alpha_SPB_96.34576.34576.2	1.3244	0.1221	11.3	1326.5521	1325.6091	4756.4	189	3.711	45.0	1	K.LKFQKIKSMSD.P
Reverse_YDR341C	2	2	4.1%	607	69525	6.8	U	YDR341C SGDID:S000002749, Chr IV from 1153618-1151795, reverse complement, Verified ORF, "Cytoplasmic arginyl-tRNA synthetase" 
*	Jamie_Alpha_SPB_12.04261.04261.2	1.8587	0.1496	97.4	857.8722	857.0843	4798.1	39	3.358	71.4	1	K.QVIAKGLK.K
*	Jamie_Alpha_SPB_15.05218.05218.2	1.5813	0.0834	10.7	2065.0122	2067.3696	6584.2	17	3.513	37.5	1	K.GWDGLYNMRIVEWGLKE.Y
YDR440W	2	2	4.1%	582	66201	9.1	U	DOT1 SGDID:S000002848, Chr IV from 1342483-1344231, Verified ORF, "Nucleosomal histone H3-Lys79 methylase, associates with transcriptionally active genes, functions in gene silencing at telomeres, most likely by directly modulating chromatin structure and Sir protein localization" 
*	Jamie_Alpha_SPB_46.16270.16270.2	1.8575	0.1611	39.3	1411.4922	1411.6005	4458.6	4	4.077	54.5	1	K.VDFKRSTAIYNP.M
*	Jamie_Alpha_SPB_24.08359.08359.2	1.6056	0.1482	32.1	1452.6122	1450.6781	7581.8	350	3.884	40.9	1	I.IDHLETIDKIPR.S
Reverse_YFR019W	2	2	4.0%	2278	257448	8.3	U	FAB1 SGDID:S000001915, Chr VI from 184490-191326, Verified ORF, "1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis" 
*	Jamie_Alpha_SPB_93.33520.33520.4	3.8033	0.2166	21.6	4057.4165	4056.2192	7466.8	2	4.369	18.8	1	N.HSTTSVSPSINVSPDGTQTTGGSNGGTKAPAAEATQQQQQQ.Q
*	Jamie_Alpha_SPB_93.33187.33187.4	1.9453	0.2736	11.0	5396.3765	5399.848	6734.6	37	4.431	7.8	1	E.KSLVGNNSTKDKKRNNYFAFLFSKSLSATLSSSASKISSVEDGVDDHDSD.P
Reverse_YFL033C	3	3	4.0%	1770	196530	6.5	U	RIM15 SGDID:S000001861, Chr VI from 74425-69113, reverse complement, Verified ORF, "Glucose-repressible protein kinase involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; originally identified as a regulator of IME2" 
*	Jamie_Alpha_SPB_36.12759.12759.3	2.8712	0.1782	10.9	3243.2344	3241.499	7007.9	25	3.813	21.4	1	R.SIAQLRDSEEASLDSSNTRQSFSKSLVRQ.R
*	Jamie_Alpha_SPB_8.02842.02842.3	1.7699	0.2544	15.4	2149.9744	2153.1982	4027.0	371	4.229	15.8	1	T.NTSPTPTMSHSNSTSSYESH.E
*	Jamie_Alpha_SPB_66.23659.23659.2	1.5691	0.114	19.1	2235.872	2234.6218	6876.9	61	3.705	27.5	1	S.ALNGFSPSGRRPTLSISTMLK.P
YCL014W	4	4	4.0%	1636	184718	6.2	U	BUD3 SGDID:S000000520, Chr III from 96280-101190, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding" 
*	Jamie_Alpha_SPB_107.38326.38326.1	1.1753	0.0492	10.6	1308.94	1307.582	7609.2	85	3.449	40.0	1	E.HIEKKKPNKGK.G
*	Jamie_Alpha_SPB_67.23949.23949.4	2.8346	0.1743	10.1	3128.6165	3125.6816	4271.2	222	3.728	21.2	1	K.EITKPKNFVEGITERKEIFPTIPRLAP.P
*	Jamie_Alpha_SPB_51.18363.18363.4	3.8594	0.1369	15.8	3704.8564	3703.325	7800.1	417	4.048	17.7	1	E.RKEIFPTIPRLAPPASKINFQRSPSYIELFQG.M
*	Jamie_Alpha_SPB_112.40149.40149.1	1.066	0.1124	21.9	806.83	807.79236	4144.9	16	3.98	57.1	1	K.GSKTGNED.V
Reverse_YCL014W	3	3	4.0%	1636	184718	6.2	U	BUD3 SGDID:S000000520, Chr III from 96280-101190, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding" 
*	Jamie_Alpha_SPB_79.28142.28142.2	1.7212	0.1717	12.9	2282.2122	2282.465	8713.0	1	4.428	34.2	1	P.TNPLEEVPFEATPEEAPTYF.R
*	Jamie_Alpha_SPB_22.07962.07962.4	3.2206	0.1707	12.7	2830.1765	2826.0525	6357.0	17	4.295	24.0	1	A.ARLFESQTDIRQDGASTTSVRNATTV.E
*	Jamie_Alpha_SPB_74.26464.26464.2	1.31	0.1272	11.0	2397.2922	2397.65	7537.4	9	3.724	26.3	1	R.HEDTSPHKVEELQHELNKIL.N
YLR310C	3	3	4.0%	1589	179091	7.1	U	CDC25 SGDID:S000004301, Chr XII from 756995-752226, reverse complement, Verified ORF, "Membrane bound guanine nucleotide exchange factor (GEF or GDP-release factor); indirectly regulates adenylate cyclase through activation of Ras1p and Ras2p by stimulating the exchange of GDP for GTP; required for progression through G1" 
*	Jamie_Alpha_SPB_88.31383.31383.4	2.9489	0.047	55.4	3582.4165	3577.0652	6304.1	117	3.241	20.7	1	K.YFDLISDSIVFTQLGCRLMQHEIKAKSCSK.E
*	Jamie_Alpha_SPB_74.26440.26440.2	1.4012	0.1853	32.0	2194.0723	2196.6104	7666.3	79	3.806	27.8	1	K.KYPLTVDTLNTMKKKSSQI.F
*	Jamie_Alpha_SPB_99.35523.35523.2	2.2389	0.1092	12.8	1483.9122	1486.7579	5019.9	36	3.629	46.2	1	D.SRGKIRGGTKEALI.E
Reverse_YDR334W	2	2	4.0%	1514	174530	6.2	U	SWR1 SGDID:S000002742, Chr IV from 1135925-1140469, Verified ORF, "Swi2/Snf2-related ATPase, component of the SWR1 complex; required for the incorporation of Htz1p into chromatin" 
*	Jamie_Alpha_SPB_75.26815.26815.4	2.4787	0.2314	35.6	4309.5767	4314.3696	6823.1	1	3.858	17.1	1	R.DNENQSENESSSYISSEEGTMVSSESSSSEHKDLTPFKE.D
*	Jamie_Alpha_SPB_70.24969.24969.3	2.576	0.2084	95.7	2556.5044	2560.8792	5789.7	367	3.879	25.0	1	K.QPVISKRNSHDSLKYKLEECK.N
Reverse_YIL013C	2	2	4.0%	1411	160537	6.9	U	PDR11 SGDID:S000001275, Chr IX from 332440-328205, reverse complement, Verified ORF, "Membrane protein of the ATP-binding cassette (ABC) transporter superfamily, involved in multiple drug resistance, mediates sterol uptake when sterol biosynthesis is compromised, regulated by Pdr1p, required for anaerobic growth" 
*	Jamie_Alpha_SPB_84.30150.30150.4	3.0628	0.1677	14.9	3290.9766	3292.5066	7068.5	317	3.882	18.8	1	Y.QHSVSPVSSSSTSFNAIPTKPTCVGDNNTIAS.K
*	Jamie_Alpha_SPB_63.22467.22467.2	1.3603	0.1884	30.3	2740.7922	2742.1162	10014.4	3	4.322	25.0	1	K.AMKQTISLFELATASDLGKTSNDWL.Y
Reverse_YAL001C	2	2	4.0%	1160	132108	9.4	U	TFC3 SGDID:S000000001, Chr I from 151168-151099,151008-147596, reverse complement, Verified ORF, "Largest of six subunits of the RNA polymerase III transcription initiation factor complex (TFIIIC); part of the TauB domain of TFIIIC that binds DNA at the BoxB promoter sites of tRNA and similar genes; cooperates with Tfc6p in DNA binding" 
*	Jamie_Alpha_SPB_103.36867.36867.2	1.2912	0.011	63.6	2986.8123	2984.2957	12470.1	3	3.391	20.7	1	R.LSRASFGGFNVVKGKVVTGGNSSPSDEASK.P
*	Jamie_Alpha_SPB_43.15307.15307.2	2.0688	0.1393	35.2	1687.2722	1687.8966	9873.0	95	3.646	36.7	1	S.INGAVSANTSNKVQRK.R
Reverse_YLR383W	2	2	4.0%	1114	128008	7.5	U	SMC6 SGDID:S000004375, Chr XII from 885288-888632, Verified ORF, "Protein involved in structural maintenance of chromosomes; required for interchromosomal and sister chromatid recombination; homologous to S. pombe rad18" 
*	Jamie_Alpha_SPB_82.29234.29234.2	1.6818	0.0872	11.8	2084.672	2086.2693	10391.0	29	4.037	30.6	1	K.NLADVKKRGQDINSQAEAQ.N
*	Jamie_Alpha_SPB_35.12616.12616.4	3.6638	0.146	16.6	3274.4966	3275.5889	6340.4	176	3.81	21.3	1	E.DLTNSNFQTMPAFQHRRRKRQQQQEE.N
YDL040C	2	2	4.0%	854	98905	8.8	U	NAT1 SGDID:S000002198, Chr IV from 381435-378871, reverse complement, Verified ORF, "Subunit of the N-terminal acetyltransferase NatA (Nat1p, Ard1p, Nat5p); N-terminally acetylates many proteins, which influences multiple processes such as the cell cycle, heat-shock resistance, mating, sporulation, and telomeric silencing" 
*	Jamie_Alpha_SPB_85.30516.30516.2	1.3526	0.0502	68.8	2084.7122	2082.4478	8309.9	69	2.933	29.4	1	K.YYKLLEVSLGIQGDNKLK.K
*	Jamie_Alpha_SPB_82.29491.29491.2	2.2005	0.1054	12.8	1938.2322	1940.0758	6849.4	7	3.664	36.7	1	S.ENFPLNEISNNSFDWL.N
Reverse_YJL187C	3	3	4.0%	819	92468	6.3	U	SWE1 SGDID:S000003723, Chr X from 79261-76802, reverse complement, Verified ORF, "Protein kinase that regulates the G2/M transition by inhibition of Cdc28p kinase activity; localizes to the nucleus and to the daughter side of the mother-bud neck; homolog of S. pombe Wee1p; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_113.40605.40605.1	1.2555	0.26	50.0	1145.26	1145.2145	6070.4	220	4.543	44.4	1	S.ESHIDTSSLR.G
*	Jamie_Alpha_SPB_114.40828.40828.1	1.4398	0.0231	13.6	997.63	997.05853	6615.3	14	3.061	64.3	1	L.INTQNNHR.D
*	Jamie_Alpha_SPB_15.05293.05293.2	1.8657	0.1911	52.8	1549.0322	1550.7521	5694.2	1	4.558	53.6	1	E.VFNLPSVSLSSSANK.S
Reverse_YPL180W	2	2	4.0%	799	88845	8.1	U	TCO89 SGDID:S000006101, Chr XVI from 205247-207646, Verified ORF, "Subunit of TORC1 (Tor1p or Tor2p-Kog1p-Lst8p-Tco89p), a complex that regulates growth in response to nutrient availability; cooperates with Ssd1p in the maintenance of cellular integrity; deletion strains are hypersensitive to rapamycin" 
*	Jamie_Alpha_SPB_12.04340.04340.4	3.4442	0.1743	33.3	2064.2966	2066.1082	5192.6	1	4.001	36.1	1	D.KHDTDSSSHAISQADNHSK.K
*	Jamie_Alpha_SPB_74.26592.26592.2	1.7819	0.2135	66.7	1303.7122	1306.4642	4371.1	100	4.147	45.8	1	R.RPKLGFGATGTNS.H
Reverse_YLR274W	2	2	4.0%	775	86411	5.7	U	CDC46 SGDID:S000004264, Chr XII from 691557-693884, Verified ORF, "Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase" 
*	Jamie_Alpha_SPB_22.07660.07660.2	1.7331	0.1625	13.3	2303.672	2303.6292	5663.8	18	4.154	30.6	1	L.AKDLALQSFRHTDVFERRL.T
*	Jamie_Alpha_SPB_36.12981.12981.2	1.9758	0.0492	17.7	1262.5922	1261.4642	5651.4	335	3.107	50.0	1	S.TRSNLVTTIGAK.A
Reverse_YKL168C	2	2	4.0%	734	83656	8.8	U	KKQ8 SGDID:S000001651, Chr XI from 133497-131293, reverse complement, Verified ORF, "Putative serine/threonine protein kinase with unknown cellular role" 
*	Jamie_Alpha_SPB_32.11433.11433.2	1.4855	0.1921	28.9	1311.4922	1310.3658	6394.9	27	3.849	45.8	1	R.TPSNSAGSGTQRF.P
*	Jamie_Alpha_SPB_84.29984.29984.2	1.6977	0.0872	12.0	1850.7522	1852.1067	7467.4	2	3.337	40.0	1	P.IRTVNIPSSDRSRPPR.F
YFL013C	2	2	4.0%	692	78753	5.2	U	IES1 SGDID:S000001881, Chr VI from 109924-107846, reverse complement, Verified ORF, "Subunit of the INO80 chromatin remodeling complex" 
*	Jamie_Alpha_SPB_114.41047.41047.1	1.2862	0.0535	18.6	881.58	882.091	4775.2	14	2.745	64.3	1	K.VTPQLPKV.T
*	Jamie_Alpha_SPB_84.30295.30295.2	1.7487	0.189	37.6	2089.2522	2088.2732	7038.8	164	4.034	26.3	1	V.TPAAPTETEEEITSAAIIDK.N
YNR038W	2	2	4.0%	629	70362	6.3	U	DBP6 SGDID:S000005321, Chr XIV from 695597-697486, Verified ORF, "Essential protein involved in ribosome biogenesis; putative ATP-dependent RNA helicase of the DEAD-box protein family" 
*	Jamie_Alpha_SPB_19.06729.06729.2	1.8502	0.1116	10.6	1273.6522	1274.5033	6844.9	86	3.541	60.0	1	N.ESSIRLSKLLQ.L
*	Jamie_Alpha_SPB_98.35116.35116.2	1.6729	0.1783	10.9	1527.3522	1524.6827	5468.0	201	4.02	34.6	1	V.HRVGRTARANELGS.A
Reverse_YLL058W	2	2	4.0%	575	64223	7.0	U	YLL058W SGDID:S000003981, Chr XII from 23569-25296, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_34.12148.12148.2	1.7756	0.2745	88.9	1239.1322	1240.402	5219.8	254	4.623	50.0	1	E.LHAKSEPGSVSK.V
*	Jamie_Alpha_SPB_59.20983.20983.2	1.8101	0.1441	15.4	1274.7722	1277.3483	4977.3	347	3.216	45.0	1	S.PFPRCNESGRG.F
Reverse_YDL171C	4	4	3.9%	2145	238100	6.6	U	GLT1 SGDID:S000002330, Chr IV from 155641-149204, reverse complement, Verified ORF, "NAD(+)-dependent glutamate synthase (GOGAT), synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source" 
*	Jamie_Alpha_SPB_57.20510.20510.2	1.286	0.0102	63.4	2065.5923	2065.4233	6950.9	445	2.785	27.8	1	K.IPLDRPITSGIAYVVANHK.N
*	Jamie_Alpha_SPB_62.22334.22334.4	3.2832	0.1293	10.0	3370.5366	3375.8901	6402.0	70	3.33	20.3	1	F.KSDKPPKIVIIGGSLGKGVYDNADGNLIFTIGS.A
*	Jamie_Alpha_SPB_54.19354.19354.2	1.4357	0.0531	72.1	1492.1721	1489.7092	5039.6	67	3.101	38.5	1	K.KGDDIAESALKTIK.D
*	Jamie_Alpha_SPB_61.21974.21974.2	1.6097	0.0991	11.6	1981.4922	1979.2526	9182.2	1	4.182	38.2	1	K.KTDVMEGLQTDVLFLDGP.K
Reverse_YIR019C	2	2	3.9%	1367	136110	4.3	U	MUC1 SGDID:S000001458, Chr IX from 393672-389569, reverse complement, Verified ORF, "GPI-anchored cell surface glycoprotein required for diploid pseudohyphal formation and haploid invasive growth, transcriptionally regulated by the MAPK pathway (via Ste12p and Tec1p) and the cAMP pathway (via Flo8p)" 
*	Jamie_Alpha_SPB_20.06910.06910.2	1.3211	0.1325	10.7	2465.0522	2463.7446	8350.0	11	4.287	24.0	1	P.GTLSPSTVVPAVSSASATTALQSTTK.I
*	Jamie_Alpha_SPB_72.25633.25633.4	3.3431	0.1287	10.3	2566.4966	2560.6638	4080.2	48	3.852	23.1	1	E.GASASSVITKASCVSTTEGAANTAASC.E
YBL007C	3	3	3.9%	1244	135848	5.9	U	SLA1 SGDID:S000000103, Chr II from 216369-212635, reverse complement, Verified ORF, "Cytoskeletal protein binding protein required for assembly of the cortical actin cytoskeleton; contains 3 SH3 domains; interacts with proteins regulating actin dynamics and with proteins required for endocytosis" 
*	Jamie_Alpha_SPB_58.20676.20676.2	1.5929	0.1179	21.1	2097.3523	2099.4385	7330.1	90	3.638	30.6	1	P.VRDKKHTESTASGIIKSIK.K
*	Jamie_Alpha_SPB_98.35200.35200.4	3.1787	0.2661	90.0	2892.5764	2889.2322	5917.8	2	4.243	25.3	1	K.ELPPIKPPRPTSTTSVPNTTSVPPAESS.N
*	Jamie_Alpha_SPB_14.04978.04978.4	3.4343	0.1431	12.3	2341.2966	2342.4814	4736.7	137	4.065	25.0	1	P.PRPTSTTSVPNTTSVPPAESSNN.N
Reverse_YPL217C	3	3	3.9%	1183	135571	6.8	U	BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" 
*	Jamie_Alpha_SPB_76.27249.27249.2	1.5361	0.0662	77.7	2085.4521	2083.433	8767.2	8	3.24	33.3	1	K.KVIEINVDIEEVIGTAAIR.F
*	Jamie_Alpha_SPB_101.36354.36354.3	2.205	0.0084	30.0	2240.4543	2241.466	4628.5	88	2.893	28.9	1	K.ELDVAHDKNGEKTVTGDKKR.F
*	Jamie_Alpha_SPB_108.38851.38851.1	1.1498	0.1302	15.0	807.11	807.9652	4312.4	4	3.406	58.3	1	K.KGIDIYV.A
YGR097W	2	2	3.9%	1146	126864	9.3	U	ASK10 SGDID:S000003329, Chr VII from 678699-682139, Verified ORF, "Component of the RNA polymerase II holoenzyme, phosphorylated in response to oxidative stress; has a role in destruction of Ssn8p, which relieves repression of stress-response genes" 
*	Jamie_Alpha_SPB_27.09556.09556.2	1.9743	0.0628	19.9	2169.5723	2171.3464	8997.2	2	3.392	31.8	1	T.LTPMGNKPSGGGGGDDASSIHSK.S
*	Jamie_Alpha_SPB_33.11877.11877.4	2.5681	0.1015	68.3	2097.2966	2103.1697	4685.5	2	3.428	27.8	1	R.QASDVHNSSTTTGGTAGANGIR.G
Reverse_YOL090W	2	2	3.9%	964	108884	6.1	U	MSH2 SGDID:S000005450, Chr XV from 147381-150275, Verified ORF, "Protein that forms heterodimers, with Msh3p and Msh6p, that bind to DNA mismatches to initiate the mismatch repair process; contains a Walker ATP-binding motif required for repair activity; Msh2p-Msh6p binds to and hydrolyzes ATP" 
*	Jamie_Alpha_SPB_80.28791.28791.2	1.9067	0.1355	29.9	1478.6522	1479.5461	5674.7	202	2.873	41.7	1	K.HQSAEETIKSPDH.L
*	Jamie_Alpha_SPB_68.24343.24343.3	3.6276	0.228	25.6	2690.4844	2687.9775	7834.7	225	5.187	21.9	1	L.AFCGIKSAIHEAIAWALGFGDYTST.G
YDL167C	2	2	3.9%	719	79299	6.9	U	NRP1 SGDID:S000002326, Chr IV from 163155-160996, reverse complement, Verified ORF, "Protein of unknown function, rich in asparagine residues" 
*	Jamie_Alpha_SPB_53.19136.19136.4	3.9496	0.211	23.1	2914.3364	2911.0679	5588.9	53	4.656	24.1	1	G.PKSISGDASETNHYIDSSTFGPASRTPS.N
*	Jamie_Alpha_SPB_107.38419.38419.1	1.353	0.0761	19.7	822.4	822.8961	4877.0	13	3.627	64.3	1	S.STFGPASR.T
YPL161C	2	2	3.9%	633	70993	5.0	U	BEM4 SGDID:S000006082, Chr XVI from 246219-244318, reverse complement, Verified ORF, "Protein involved in establishment of cell polarity and bud emergence; interacts with the Rho1p small GTP-binding protein and with the Rho-type GTPase Cdc42p" 
*	Jamie_Alpha_SPB_53.18864.18864.2	1.4322	0.0057	65.3	1399.4521	1399.6708	5111.6	214	3.11	41.7	1	K.VVLGSDLLNDILK.V
*	Jamie_Alpha_SPB_43.15478.15478.2	1.7534	0.1783	37.5	1419.0122	1420.7379	4440.0	4	3.851	50.0	1	L.FHITKTVGIYLK.D
YOL015W	2	2	3.9%	586	67689	9.7	U	YOL015W SGDID:S000005375, Chr XV from 297078-298838, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_12.04370.04370.2	1.699	0.0659	11.1	1163.1522	1163.5101	5059.7	303	3.508	55.6	1	Y.FALMKKVLGR.I
*	Jamie_Alpha_SPB_46.16503.16503.2	1.8154	0.1202	10.0	1724.6921	1721.8328	6899.1	1	3.601	45.8	1	V.CVEKQNSFFRNYE.H
Reverse_YPL231W	4	4	3.8%	1887	206945	5.4	U	FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" 
*	Jamie_Alpha_SPB_47.16827.16827.2	1.5964	0.1926	11.1	2474.4722	2471.7449	7817.7	6	3.859	26.2	1	I.MKATEITNANIYSDKSQINKSN.F
*	Jamie_Alpha_SPB_64.22782.22782.2	1.9527	0.0887	25.8	1811.2322	1813.9591	6254.9	165	3.365	34.4	1	R.TSSSIDQKDAQASIAKY.V
*	Jamie_Alpha_SPB_38.13473.13473.2	1.9378	0.1426	15.0	2417.5322	2419.6257	9081.3	12	4.197	24.1	1	L.AGADIMAAGAAAGAGAAGSASAASSLDVGV.I
*	Jamie_Alpha_SPB_117.42049.42049.3	2.5557	0.2988	17.6	2057.1543	2061.2131	6953.5	429	4.679	22.0	1	A.AGAAAGAGAAGSASAASSLDVGVISA.Y
YJR127C	3	3	3.8%	1380	155062	8.0	U	RSF2 SGDID:S000003888, Chr X from 662974-658832, reverse complement, Verified ORF, "Zinc-finger protein involved in transcriptional control of both nuclear and mitochondrial genes, many of which specify products required for glycerol-based growth, respiration, and other functions" 
*	Jamie_Alpha_SPB_33.11634.11634.3	2.979	0.1615	11.4	2511.3245	2512.8662	8870.5	105	4.375	21.7	1	T.PKNLAGKTSEELKEAVVALAKSNN.V
*	Jamie_Alpha_SPB_61.21877.21877.3	2.5114	0.2035	17.1	2249.2744	2252.6223	6290.2	134	4.225	25.0	1	T.HAKVLANAASTQIRKSLKVSE.K
*	Jamie_Alpha_SPB_21.07470.07470.1	1.2863	0.0408	15.0	1021.98	1023.1516	3782.6	25	3.136	64.3	1	L.KDWSNMNK.A
YKR086W	3	3	3.8%	1071	121652	8.2	U	PRP16 SGDID:S000001794, Chr XI from 599499-602714, Verified ORF, "RNA helicase in the DEAH-box family involved in the second catalytic step of splicing, exhibits ATP-dependent RNA unwinding activity" 
*	Jamie_Alpha_SPB_44.15867.15867.2	1.5924	0.0211	73.6	1030.0521	1027.2552	3353.3	4	3.054	68.8	1	K.KIAPSINKR.K
*	Jamie_Alpha_SPB_34.12224.12224.2	3.0502	0.0172	32.6	2363.372	2362.5957	5808.4	5	3.068	42.1	1	R.KKFKIQLDLDDNEDELDSPV.Q
*	Jamie_Alpha_SPB_113.40508.40508.1	1.1936	0.2365	12.5	1487.44	1488.86	4306.5	105	4.28	31.8	1	L.FKRIDKLKAKQL.R
YGR274C	2	2	3.8%	1066	120696	7.5	U	TAF1 SGDID:S000003506, Chr VII from 1043101-1039901, reverse complement, Verified ORF, "TFIID subunit (145 kDa), involved in RNA polymerase II transcription initiation, has histone acetyltransferase activity, involved in promoter binding and G1/S progression" 
*	Jamie_Alpha_SPB_61.21958.21958.2	1.8473	0.1458	15.0	1467.9922	1467.6647	4849.1	23	3.852	50.0	1	I.SYVAPIYQGKNNL.L
*	Jamie_Alpha_SPB_70.25112.25112.3	1.8241	0.1327	60.8	3270.7744	3271.8367	9068.3	253	3.581	17.3	1	K.RDENGIIQRQTIFIRDPRVIQGYIKIK.E
YGL049C	2	2	3.8%	914	103899	7.6	U	TIF4632 SGDID:S000003017, Chr VII from 409607-406863, reverse complement, Verified ORF, "Translation initiation factor eIF4G, subunit of the mRNA cap-binding protein complex (eIF4F) that also contains eIF4E (Cdc33p); associates with the poly(A)-binding protein Pab1p, also interacts with eIF4A (Tif1p); homologous to Tif4631p" 
*	Jamie_Alpha_SPB_32.11304.11304.3	2.5212	0.2145	42.5	1486.3444	1483.8031	2499.8	1	4.326	38.6	1	S.ANRWIPKSRVKK.T
*	Jamie_Alpha_SPB_48.17223.17223.4	3.3406	0.2161	42.9	2707.5764	2703.931	5794.2	33	3.971	26.5	1	K.HWNSAKKDAGPKTIQQIHQEEEQ.L
Reverse_YDR422C	2	2	3.8%	863	96259	6.6	U	SIP1 SGDID:S000002830, Chr IV from 1317907-1315316, reverse complement, Verified ORF, "Alternate beta-subunit of the Snf1p kinase complex, may confer substrate specificity; vacuolar protein containing KIS (Kinase-Interacting Sequence) and ASC (Association with Snf1 kinase Complex) domains involved in protein interactions" 
*	Jamie_Alpha_SPB_17.06132.06132.2	1.3894	0.0342	68.6	1304.5521	1304.5095	5525.1	206	3.897	44.4	1	K.HVDDYVMRIR.P
*	Jamie_Alpha_SPB_84.30133.30133.3	2.3871	0.0346	41.2	2385.3843	2382.6763	7308.0	299	3.39	23.9	1	R.VPIDISDTKTLAPLSASHVSSSR.T
Reverse_YLR222C	2	2	3.8%	817	91032	5.4	U	UTP13 SGDID:S000004212, Chr XII from 581773-579320, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_27.09541.09541.2	1.7012	0.175	32.4	1882.5721	1882.0095	9420.1	241	4.263	31.2	1	K.LCEGSSCDWIKILGDAG.C
*	Jamie_Alpha_SPB_94.33861.33861.2	1.8263	0.1059	24.4	1604.6322	1601.7258	6672.7	2	3.802	46.2	1	F.SCRQVANTHGELTK.M
YMR216C	2	2	3.8%	742	83238	6.2	U	SKY1 SGDID:S000004829, Chr XIII from 701038-698810, reverse complement, Verified ORF, "SR protein kinase (SRPK) involved in regulating proteins involved in mRNA metabolism and cation homeostasis; similar to human SRPK1" 
*	Jamie_Alpha_SPB_16.05499.05499.2	1.8546	0.1359	33.8	1065.3121	1064.1863	3715.5	126	3.927	68.8	1	F.KGEPYKDAR.Y
*	Jamie_Alpha_SPB_13.04570.04570.2	3.4353	0.0097	14.4	2175.9722	2176.1375	5826.3	60	3.043	41.7	1	N.SKNKNNNNNNSNNNNNEDI.M
YAL054C	2	2	3.8%	713	79141	6.6	U	ACS1 SGDID:S000000050, Chr I from 45023-42882, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform, expressed during growth on nonfermentable carbon sources and under aerobic conditions" 
*	Jamie_Alpha_SPB_21.07557.07557.4	2.566	0.0113	40.9	1953.7765	1957.2046	4777.7	415	2.878	25.6	1	K.AAWPSFARTIWKNHDR.Y
	Jamie_Alpha_SPB_14.04741.04741.2	2.6746	0.2408	100.0	1196.7922	1197.2932	3541.9	4	5.093	75.0	1	R.VDDVVNVSGHR.L
YDR390C	2	2	3.8%	636	71259	5.1	U	UBA2 SGDID:S000002798, Chr IV from 1256837-1254927, reverse complement, Verified ORF, "Nuclear protein that acts as a heterodimer with Aos1p to activate Smt3p (SUMO) before its conjugation to proteins (sumoylation), which may play a role in protein targeting; essential for viability" 
*	Jamie_Alpha_SPB_18.06490.06490.3	2.4049	0.1898	16.5	1398.8944	1400.6615	2840.7	412	4.153	30.8	1	I.VAGASSLISLRVLN.L
*	Jamie_Alpha_SPB_15.05227.05227.2	2.3988	0.11	58.0	1277.3722	1277.3306	6619.4	75	3.55	66.7	1	S.KNEEEEKNEK.G
Reverse_YGL023C	2	2	3.8%	635	70617	7.8	U	PIB2 SGDID:S000002991, Chr VII from 452109-450202, reverse complement, Verified ORF, "Protein binding phosphatidylinositol 3-phosphate, involved in telomere-proximal repression of gene expression; similar to Fab1 and Vps27" 
*	Jamie_Alpha_SPB_40.14433.14433.2	1.4867	0.1807	10.0	1396.0521	1395.5702	5755.7	29	3.751	40.9	1	N.LENIMIFNAQSD.L
*	Jamie_Alpha_SPB_93.33522.33522.2	1.7137	0.0774	12.4	1423.9722	1421.5956	5681.2	101	3.106	45.5	1	R.KSDPIWHDKTPP.N
Reverse_YLR086W	2	2	3.7%	1418	162188	6.2	U	SMC4 SGDID:S000004076, Chr XII from 302244-306500, Verified ORF, "Subunit of the condensin complex, which reorganizes chromosomes during cell division, forms a stable complex with Smc2p that has ATP-hydrolyzing and DNA-binding activity and promotes knotting of circular DNA; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_52.18538.18538.2	1.7396	0.0607	10.9	1426.6522	1426.6703	5388.5	340	3.131	41.7	1	K.KPPMVSFTVGESF.P
*	Jamie_Alpha_SPB_37.13102.13102.4	2.3236	0.0106	30.1	4573.6167	4577.2847	9603.6	480	3.025	13.6	1	K.LKLHASTFNKEGQSREDKLSNLKKKLDLILDQLEQKHTK.K
YOR227W	3	3	3.7%	1246	139457	8.9	U	YOR227W SGDID:S000005753, Chr XV from 762825-766565, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_53.19122.19122.2	1.8335	0.0709	12.8	1796.9321	1794.9103	5510.1	81	3.647	30.6	1	K.ISTPTSTPTTASSKPSSSG.G
*	Jamie_Alpha_SPB_23.08157.08157.2	2.1001	0.0221	11.4	1808.4922	1809.0264	7229.4	142	2.773	40.0	1	I.FDGSLITETAEEVLKR.L
*	Jamie_Alpha_SPB_54.19238.19238.2	1.6986	0.0786	14.3	1284.6122	1283.4299	4317.4	1	3.176	60.0	1	L.LNDLSNVRHSK.T
YOR151C	2	2	3.7%	1224	138751	6.5	U	RPB2 SGDID:S000005677, Chr XV from 616671-612997, reverse complement, Verified ORF, "RNA polymerase II second largest subunit B150, part of central core; similar to bacterial beta subunit" 
*	Jamie_Alpha_SPB_70.24954.24954.4	2.686	0.0224	43.0	3015.8965	3014.578	5561.2	397	2.866	20.8	1	R.LMETLRTLRRKGDINPEVSMIRDIR.E
*	Jamie_Alpha_SPB_102.36568.36568.2	1.4881	0.1929	12.5	2453.8523	2454.7656	7175.2	463	4.115	23.7	1	N.QSSIDRGLFRSLFFRSYMDQ.E
Reverse_YGR094W	2	2	3.7%	1104	125770	7.0	U	VAS1 SGDID:S000003326, Chr VII from 672190-675504, Verified ORF, "Mitochondrial and cytoplasmic valyl-tRNA synthetase" 
*	Jamie_Alpha_SPB_41.14605.14605.2	1.8013	0.0572	11.8	1657.9722	1658.0408	5818.2	134	3.175	42.3	1	G.NKSKKAKELKKQVK.A
*	Jamie_Alpha_SPB_90.32367.32367.3	2.5126	0.034	43.4	3042.8643	3039.3655	8344.5	6	2.947	22.1	1	K.TINLVLDYANASKVDDYESVYVPYSAK.V
YOR048C	2	2	3.7%	1006	115934	6.8	U	RAT1 SGDID:S000005574, Chr XV from 421650-418630, reverse complement, Verified ORF, "Nuclear 5' to 3' single-stranded RNA exonuclease, involved in RNA metabolism, including rRNA and snRNA processing as well as mRNA transcription termination" 
*	Jamie_Alpha_SPB_16.05541.05541.3	2.1511	0.062	47.2	1805.6344	1808.2389	8188.6	3	3.469	34.4	1	R.PRKVLVMAVDGVAPRAK.M
*	Jamie_Alpha_SPB_23.08172.08172.4	2.5433	0.0096	38.6	2126.0166	2125.523	3851.4	2	2.944	29.8	1	K.IVCPIQGGSLPNLSTTLILK.M
Reverse_YEL055C	2	2	3.7%	1022	115894	5.3	U	POL5 SGDID:S000000781, Chr V from 51539-48471, reverse complement, Verified ORF, "Protein with sequence similarity to the human MybBP1A and weak sequence similar to B-type DNA polymerases, not required for chromosomal DNA replication; required for the synthesis of rRNA" 
*	Jamie_Alpha_SPB_29.10155.10155.2	2.3661	0.0556	25.4	1716.4922	1716.8015	7538.7	30	3.152	46.4	1	K.RESSAKENFFSEDVA.M
*	Jamie_Alpha_SPB_47.16822.16822.3	2.2584	0.0238	33.8	3946.2544	3948.5347	9660.6	122	3.18	16.9	1	K.ENFFSEDVAMKWFEPFQISNQVKKNNTKKRKK.S
YML010W	2	2	3.7%	1063	115650	5.2	U	SPT5 SGDID:S000004470, Chr XIII from 247677-250868, Verified ORF, "Protein that forms a complex with Spt4p and mediates both activation and inhibition of transcription elongation; Spt4p-Spt5p complex also plays a role in pre-mRNA processing" 
*	Jamie_Alpha_SPB_22.07965.07965.2	1.2075	0.213	27.6	2724.112	2722.8335	5380.3	125	3.958	16.0	1	K.DTVDSGNVTTTESTERAESTSNIPPL.D
*	Jamie_Alpha_SPB_72.25707.25707.2	1.627	0.1349	25.3	1400.7722	1398.559	5368.6	201	3.437	41.7	1	D.VNGDKATVELHSK.N
Reverse_YGR240C	2	2	3.7%	987	107970	6.4	U	PFK1 SGDID:S000003472, Chr VII from 973739-970776, reverse complement, Verified ORF, "Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" 
*	Jamie_Alpha_SPB_33.11913.11913.2	1.9014	0.0637	86.0	2480.652	2482.9004	7110.9	292	3.536	26.3	1	K.KNWQEIFKICKVAFRSATVR.D
*	Jamie_Alpha_SPB_103.36825.36825.2	1.8617	0.1665	36.8	2044.0721	2041.3086	7343.7	10	4.5	34.4	1	Y.LEIFETDRLSIAKDFDK.N
Reverse_YER075C	2	2	3.7%	928	105251	7.2	U	PTP3 SGDID:S000000877, Chr V from 311195-308409, reverse complement, Verified ORF, "Phosphotyrosine-specific protein phosphatase involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm" 
*	Jamie_Alpha_SPB_20.07260.07260.3	2.7233	0.2024	14.4	2379.5044	2381.6072	6830.9	169	3.777	25.0	1	D.KNTDKELSNQNKPFQFNQLS.K
*	Jamie_Alpha_SPB_58.20785.20785.2	1.4875	0.1926	12.0	1368.6921	1366.4828	6768.4	70	3.656	46.2	1	F.LASIPSSSSMPSDS.L
YKL025C	2	2	3.7%	679	76455	6.4	U	PAN3 SGDID:S000001508, Chr XI from 391922-389883, reverse complement, Verified ORF, "Essential subunit of the Pan2p-Pan3p poly(A)-ribonuclease complex, which acts to control poly(A) tail length and regulate the stoichiometry and activity of postreplication repair complexes" 
*	Jamie_Alpha_SPB_19.06853.06853.2	1.9006	0.0593	14.5	1469.5721	1469.7245	4074.0	17	3.112	50.0	1	Q.PSSLKSLLKPNER.S
*	Jamie_Alpha_SPB_32.11521.11521.4	2.4066	0.1339	79.4	2330.1765	2326.661	5622.2	16	3.604	27.2	1	K.SLLKPNERSADQLFIPNNIR.E
Reverse_YDR254W	2	2	3.7%	458	52672	8.8	U	CHL4 SGDID:S000002662, Chr IV from 965107-966483, Verified ORF, "Outer kinetochore protein required for chromosome stability, interacts with kinetochore proteins Ctf19p, Ctf3p, and Iml3p; exhibits a two-hybrid interaction with Mif2p; association with CEN DNA requires Ctf19p" 
*	Jamie_Alpha_SPB_50.18001.18001.2	1.4868	0.1806	13.1	1048.7922	1046.1772	6045.4	399	3.812	56.2	1	D.CLEHLGGFI.D
*	Jamie_Alpha_SPB_114.41037.41037.1	1.4382	0.0246	15.5	918.88	918.124	6080.6	141	3.388	57.1	1	K.APQLKVVY.P
Reverse_YNR016C	3	3	3.6%	2233	250351	6.3	U	ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" 
*	Jamie_Alpha_SPB_14.04906.04906.3	2.5249	0.1784	15.1	1723.3744	1726.9677	3771.6	70	3.563	33.3	1	P.DAPILNEVTRTEVGIV.G
*	Jamie_Alpha_SPB_68.24330.24330.4	3.3164	0.233	22.2	3342.8164	3347.7295	4846.8	3	4.259	22.8	1	Y.QFGKDPNAADNWAVQFLPVIEEAMGIRAGSN.A
*	Jamie_Alpha_SPB_59.21060.21060.4	2.9964	0.192	10.5	4185.6167	4179.7275	7317.6	24	3.966	16.7	1	R.AGSNAALYIRPIGRKRAYETVKNFFEDEQPGFSGIKF.T
Reverse_YKL014C	2	2	3.6%	1764	203286	7.3	U	URB1 SGDID:S000001497, Chr XI from 416556-411262, reverse complement, Verified ORF, "Nucleolar protein required for the normal accumulation of 25S and 5.8S rRNAs, associated with the 27SA2 pre-ribosomal particle; proposed to be involved in the biogenesis of the 60S ribosomal subunit" 
*	Jamie_Alpha_SPB_47.16663.16663.3	2.6216	0.1534	84.5	2338.3145	2336.8408	3978.6	43	3.824	30.6	1	R.EKLYPMNILNLLWEFVGKK.E
*	Jamie_Alpha_SPB_54.19485.19485.4	1.9129	0.0453	33.7	5064.8564	5059.959	8814.4	29	3.127	13.2	1	K.LNIIKNILLTIGFWYSTMKPDYNGNTTLFISYPAVLEPVNELIK.I
YNL091W	2	2	3.6%	1240	141514	5.4	U	NST1 SGDID:S000005035, Chr XIV from 452410-456132, Verified ORF, "Protein of unknown function, mediates sensitivity to salt stress; interacts physically with the splicing factor Msl1p and also displays genetic interaction with MSL1" 
*	Jamie_Alpha_SPB_96.34471.34471.4	3.1412	0.164	15.4	3704.0964	3700.8267	6895.3	492	3.87	17.8	1	H.HYHSTSTHSEDELSEEEYISDIELPHDPHKH.F
*	Jamie_Alpha_SPB_16.05752.05752.2	2.0071	0.0679	90.3	1625.3121	1626.0391	6149.2	11	3.026	50.0	1	R.KLIQIAITKLLQSR.I
YOL045W	2	2	3.6%	1101	124372	5.8	U	PSK2 SGDID:S000005405, Chr XV from 243495-246800, Verified ORF, "One of two (see also PSK1) PAS domain containing S/T protein kinases; regulates sugar flux and translation in response to an unknown metabolite by phosphorylating Ugp1p and Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p (translation)" 
*	Jamie_Alpha_SPB_59.21024.21024.2	1.4231	0.1097	11.3	2344.132	2342.796	7826.8	28	3.515	28.9	1	L.HELKKKAPVIAYPPSLRHTR.N
*	Jamie_Alpha_SPB_57.20461.20461.2	1.4703	0.1145	11.0	2069.0322	2066.2327	8889.5	22	3.69	31.6	1	L.KENEIDVVGSRGSSSASSKK.S
Reverse_YEL061C	2	2	3.6%	1000	113311	8.1	U	CIN8 SGDID:S000000787, Chr V from 39537-36535, reverse complement, Verified ORF, "Kinesin motor protein involved in mitotic spindle assembly and chromosome segregation" 
*	Jamie_Alpha_SPB_99.35479.35479.3	2.4849	0.0482	47.4	2904.9243	2907.2244	6812.2	7	3.286	27.2	1	K.LYQKMNNNEESIDSLNEAINKYFK.Q
*	Jamie_Alpha_SPB_39.14026.14026.2	1.7834	0.2092	98.1	1409.4521	1411.6011	6641.0	106	4.084	45.5	1	K.DLQARLHDITTK.L
Reverse_YOL084W	2	2	3.6%	991	112546	8.6	U	PHM7 SGDID:S000005444, Chr XV from 162355-165330, Verified ORF, "Protein of unknown function, expression is regulated by phosphate levels; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and vacuole" 
*	Jamie_Alpha_SPB_15.05438.05438.2	2.0054	0.0223	81.9	1774.4922	1774.9868	7507.3	1	3.092	53.6	1	K.SVGLPDKCCWVIPDK.E
*	Jamie_Alpha_SPB_37.13244.13244.4	2.8844	0.1443	10.1	2326.0566	2322.6238	4304.2	249	3.598	25.8	1	I.LNAKKLDDKTVPTLIGHTNDQ.E
YMR086W	2	2	3.6%	960	105874	9.7	U	YMR086W SGDID:S000004692, Chr XIII from 439207-442089, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" 
*	Jamie_Alpha_SPB_69.24831.24831.2	1.5933	0.098	10.6	2360.4521	2358.5754	8835.4	7	3.263	33.3	1	K.SKTHQRISYDEAQRTFKDF.G
*	Jamie_Alpha_SPB_34.12188.12188.3	2.6289	0.1763	15.5	1759.2544	1756.9192	4508.9	180	3.586	31.7	1	P.SNANTSKLLRRSNSAH.S
YGR250C	2	2	3.6%	781	89513	5.4	U	YGR250C SGDID:S000003482, Chr VII from 993526-991181, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" 
*	Jamie_Alpha_SPB_116.41558.41558.1	1.4386	0.0497	23.6	1009.27	1008.20886	5462.2	240	3.011	50.0	1	R.LVVNKAVQH.K
*	Jamie_Alpha_SPB_30.10544.10544.2	1.9398	0.1865	58.6	2125.4521	2125.1729	8137.6	20	4.118	36.1	1	K.NKYRQQSNDSSSDNDLPVG.S
Reverse_YKR010C	2	2	3.6%	771	86366	8.0	U	TOF2 SGDID:S000001718, Chr XI from 460882-458567, reverse complement, Verified ORF, "Nonessential mitochondrial protein of unknown function with sequence similarity to Net1p; identified as a topoisomerase I (Top1p) binding protein; displays synthetic genetic interactions with TOP1 and HPR1" 
*	Jamie_Alpha_SPB_56.19892.19892.2	1.6133	0.013	71.8	1302.6322	1302.5167	5510.4	1	3.214	60.0	1	K.NQVKIELSSKR.P
*	Jamie_Alpha_SPB_20.07023.07023.2	1.4635	0.0116	66.4	1873.1122	1874.0177	6117.3	50	2.816	40.6	1	R.KAGDNKQQQTSSPINEK.N
Reverse_YFR009W	2	2	3.6%	752	85027	6.2	U	GCN20 SGDID:S000001905, Chr VI from 162482-164740, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn1p; proposed to stimulate Gcn2p activation by an uncharged tRNA" 
*	Jamie_Alpha_SPB_27.09522.09522.2	1.7188	0.0702	11.8	1774.2922	1773.0953	6954.1	76	2.819	34.4	1	I.KLLTTKGCGNAGVLAIR.S
*	Jamie_Alpha_SPB_16.05544.05544.3	2.5834	0.1725	15.9	1229.0044	1230.4069	3618.6	1	4.319	55.6	1	E.KLRENIKAEE.S
YAL016W	2	2	3.6%	635	70907	4.7	U	TPD3 SGDID:S000000014, Chr I from 124880-126787, Verified ORF, "Regulatory subunit A of the heterotrimeric protein phosphatase 2A, which also contains regulatory subunit Cdc55p and either catalytic subunit Pph21p or Pph22p; required for cell morphogenesis and for transcription by RNA polymerase III" 
*	Jamie_Alpha_SPB_118.42339.42339.2	1.7329	0.181	41.8	1114.7522	1113.2964	4367.7	144	4.112	50.0	1	K.LDTIALALGPE.R
*	Jamie_Alpha_SPB_25.08913.08913.2	1.5186	0.0988	10.4	1397.7722	1399.6732	7428.7	10	3.102	50.0	1	K.DQVINNFLPILL.N
YNR055C	2	2	3.6%	586	65348	5.8	U	HOL1 SGDID:S000005338, Chr XIV from 730187-728427, reverse complement, Verified ORF, "Putative ion transporter similar to the major facilitator superfamily of transporters; mutations in membrane-spanning domains permit nonselective cation uptake" 
*	Jamie_Alpha_SPB_26.09172.09172.2	1.9841	0.0942	10.6	1200.1322	1199.2163	4964.9	8	4.032	65.0	1	C.QSGYEDGTTLQ.N
*	Jamie_Alpha_SPB_15.05281.05281.2	2.0763	0.03	10.8	1735.1721	1735.8081	6818.6	473	2.939	36.7	1	E.DGTTLQNSDNTAVSRR.K
Reverse_YNL102W	2	2	3.5%	1468	166809	6.2	U	POL1 SGDID:S000005046, Chr XIV from 430089-434495, Verified ORF, "Catalytic subunit of the DNA polymerase alpha-primase complex, required for the initiation of DNA replication during mitotic DNA synthesis and premeiotic DNA synthesis" 
*	Jamie_Alpha_SPB_75.27036.27036.2	2.308	0.2112	16.7	1292.5322	1292.5023	5260.9	7	4.05	60.0	1	I.SLSLCRLNPMT.K
*	Jamie_Alpha_SPB_23.08290.08290.3	1.3571	0.0326	23.8	4124.4243	4125.669	10323.0	211	2.826	13.1	1	K.VNVALTAVDTNSQLSKSPTLGKIGIPTGPATVFPSTSPNSR.S
YFL036W	2	2	3.5%	1351	153047	8.9	U	RPO41 SGDID:S000001858, Chr VI from 58781-62836, Verified ORF, "Mitochondrial RNA polymerase; single subunit enzyme similar to those of T3 and T7 bacteriophages; requires a specificity subunit encoded by MTF1 for promoter recognition" 
*	Jamie_Alpha_SPB_61.21770.21770.2	2.1278	0.2478	12.5	1473.6122	1473.7332	5018.4	410	4.53	37.5	1	N.HLGNDMSRGLLIF.W
*	Jamie_Alpha_SPB_38.13664.13664.4	3.3072	0.1513	12.4	3584.8965	3587.8535	6330.8	10	3.332	19.7	1	F.ISHQPVHQDGTCNGLQHYAALGGDVEGATQVNLV.P
YKL129C	3	3	3.5%	1271	142507	9.4	U	MYO3 SGDID:S000001612, Chr XI from 200163-196348, reverse complement, Verified ORF, "One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization" 
*	Jamie_Alpha_SPB_20.07105.07105.3	2.4879	0.1843	14.4	1678.8844	1677.9847	2679.4	108	3.335	28.6	1	K.IKKATFDANKKKEVG.I
*	Jamie_Alpha_SPB_18.06322.06322.2	2.1605	0.0425	19.6	2324.9922	2326.661	7508.4	7	3.325	31.0	1	P.SQKPVNPLSLRATAAQAAYNPK.P
*	Jamie_Alpha_SPB_14.04878.04878.2	1.7891	0.0497	14.1	874.3122	874.0429	3652.0	49	3.438	71.4	1	N.QVSMPPSK.G
Reverse_YDL195W	2	2	3.5%	1273	138703	5.7	U	SEC31 SGDID:S000002354, Chr IV from 107209-111030, Verified ORF, "Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation" 
*	Jamie_Alpha_SPB_69.24756.24756.4	3.4785	0.1769	14.8	3471.0166	3466.022	7174.4	2	3.737	20.7	1	A.PVYPKPPLANASAGPTMGYFPAQMSPISTTSPMG.P
*	Jamie_Alpha_SPB_36.12852.12852.2	1.9942	0.0353	12.4	1258.0322	1257.3081	7633.9	25	3.009	55.0	1	K.NDFSACAFLDP.A
YNL267W	2	2	3.5%	1066	119923	6.5	U	PIK1 SGDID:S000005211, Chr XIV from 140879-144079, Verified ORF, "Phosphatidylinositol 4-kinase; catalyzes first step in the biosynthesis of phosphatidylinositol-4,5-biphosphate; may control cytokineses through the actin cytoskeleton" 
*	Jamie_Alpha_SPB_30.10795.10795.2	1.665	0.1471	11.0	2464.152	2462.7683	8429.2	56	3.753	23.8	1	S.QPLSRQAFKNSKKANSSLSQEI.D
*	Jamie_Alpha_SPB_25.08979.08979.2	1.9153	0.0835	22.9	1591.3322	1589.7429	5365.2	39	3.47	42.9	1	V.TITANEAQVLNSAEK.V
YPR091C	2	2	3.5%	770	87324	7.9	U	YPR091C SGDID:S000006295, Chr XVI from 718466-716154, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_14.04983.04983.1	1.2096	0.0332	10.9	1037.25	1038.1948	5125.6	19	3.006	56.2	1	L.VHAISLQNR.F
*	Jamie_Alpha_SPB_17.06159.06159.2	1.8818	0.1185	32.2	2018.6921	2020.2902	4779.7	18	4.095	32.4	1	L.LELSPEGSTKIAIDVQYR.G
YMR167W	2	2	3.5%	769	87062	7.0	U	MLH1 SGDID:S000004777, Chr XIII from 594885-597194, Verified ORF, "Protein required for mismatch repair in mitosis and meiosis, postmeiotic segregation, and spore viability; forms a complex with Pms1p and Msh2p to repair mismatched DNA; human homolog is associated with hereditary non-polyposis colon cancer" 
*	Jamie_Alpha_SPB_24.08368.08368.4	2.2731	0.0083	30.0	2642.2166	2640.9832	7049.2	441	3.025	23.8	1	K.VKEDRCAWRVSYAEGKMLESPK.P
*	Jamie_Alpha_SPB_12.04022.04022.2	1.1492	0.0713	67.2	1892.4122	1892.2207	4944.8	182	3.666	20.6	1	R.VSYAEGKMLESPKPVAGK.D
YHR031C	2	2	3.5%	723	81581	9.7	U	RRM3 SGDID:S000001073, Chr VIII from 172963-170792, reverse complement, Verified ORF, "DNA helicase involved in rDNA replication and Ty1 transposition; structurally and functionally related to Pif1p" 
*	Jamie_Alpha_SPB_23.08168.08168.2	1.2236	0.0793	72.4	1043.2122	1043.295	3215.5	130	2.788	50.0	1	K.SVILQTIIR.Q
*	Jamie_Alpha_SPB_91.32593.32593.2	2.0264	0.1455	36.9	1732.8922	1735.0331	6062.7	165	3.911	33.3	1	K.PDVELVNGSLGKVLFF.V
YOR147W	2	2	3.5%	622	72028	9.3	U	MDM32 SGDID:S000005673, Chr XV from 606607-608475, Verified ORF, "Mitochondrial inner membrane protein with similarity to Mdm31p, required for normal mitochondrial morphology and inheritance; interacts genetically with MMM1, MDM10, MDM12, and MDM34" 
*	Jamie_Alpha_SPB_24.08678.08678.2	1.7877	0.0565	11.0	1641.2722	1642.7808	6551.9	96	3.454	38.5	1	R.HCIRTYVATNHGNV.R
*	Jamie_Alpha_SPB_11.03756.03756.2	1.9881	0.1054	33.1	1007.6722	1007.2271	3379.0	214	3.283	64.3	1	C.LIAQRHIR.T
Reverse_YHR165C	3	3	3.4%	2413	279502	7.3	U	PRP8 SGDID:S000001208, Chr VIII from 436950-429709, reverse complement, Verified ORF, "Component of the U4/U6-U5 snRNP complex, involved in the second catalytic step of splicing" 
*	Jamie_Alpha_SPB_61.21856.21856.3	2.6456	0.1821	12.7	3382.5842	3382.8787	9156.4	5	4.521	20.5	1	I.KVDSIEIFKKLLNKPLVYVNQEEVFDDAS.V
*	Jamie_Alpha_SPB_16.05701.05701.4	2.7849	0.2534	16.7	2785.2166	2786.977	4930.3	1	4.449	26.5	1	F.FLAPTDYEEDNQIICSVPNNYWP.I
*	Jamie_Alpha_SPB_41.14766.14766.3	2.8869	0.1875	14.2	3583.3442	3582.3562	8918.9	1	4.767	22.4	1	P.PMEAKPTYLNSRKAKKTMKKARKRSKRTVF.T
Reverse_YDR283C	2	2	3.4%	1659	190192	6.4	U	GCN2 SGDID:S000002691, Chr IV from 1030043-1025064, reverse complement, Verified ORF, "Protein kinase, phosphorylates the alpha-subunit of translation initiation factor eIF2 (Sui2p) in response to starvation; activated by uncharged tRNAs and the Gcn1p-Gcn20p complex" 
*	Jamie_Alpha_SPB_79.28396.28396.3	2.0936	0.2091	11.3	4596.744	4597.972	9768.6	4	4.484	14.9	1	K.ERKNAKKSRTAMNPVYIVKQNNTSGAVVDDIDGEQSSGASSNE.D
*	Jamie_Alpha_SPB_14.04948.04948.2	1.7054	0.1007	21.2	1488.1322	1490.807	4529.9	32	3.907	41.7	1	A.FGVQSLMRSVLPR.Q
YOR093C	2	2	3.4%	1648	186906	8.5	U	YOR093C SGDID:S000005619, Chr XV from 502452-497506, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_50.17986.17986.3	2.2375	0.0224	32.8	3619.3145	3620.2192	10161.4	330	2.697	17.5	1	K.WLKNLGCIDAPFCYSPMLTLLDFGGIFISIR.D
*	Jamie_Alpha_SPB_47.16723.16723.4	3.1798	0.154	11.2	2659.8167	2660.9492	5828.4	15	4.099	25.0	1	L.VNSSASNDNNVHKKVSWASFGKIVA.G
YOR011W	2	2	3.4%	1394	157750	7.2	U	AUS1 SGDID:S000005537, Chr XV from 349678-353862, Verified ORF, "Transporter of the ATP-binding cassette family, involved in uptake of sterols and anaerobic growth" 
*	Jamie_Alpha_SPB_69.24895.24895.4	3.4417	0.1565	16.4	3440.7366	3435.7095	6970.3	16	3.676	21.1	1	D.CSETIVPRGPTYNDVPFSHKACAWQGATLGN.D
*	Jamie_Alpha_SPB_25.08943.08943.2	1.6962	0.0701	11.2	2072.872	2074.4426	6446.5	4	3.088	37.5	1	T.RWLPFLNKKRGTRSSAR.N
Reverse_YGR233C	2	2	3.4%	1178	134029	5.8	U	PHO81 SGDID:S000003465, Chr VII from 958213-954677, reverse complement, Verified ORF, "Cyclin-dependent kinase (CDK) inhibitor, regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; required for derepression of PHO5; transcriptionally regulated by Pho4p and Pho2p" 
*	Jamie_Alpha_SPB_40.14274.14274.2	1.554	0.0892	10.9	2066.5923	2066.4026	7794.8	2	3.323	38.2	1	V.TEKSLKSTTLAEDLIFLR.S
*	Jamie_Alpha_SPB_16.05587.05587.4	2.6165	0.0094	39.0	2606.8564	2608.1055	6195.9	239	2.787	23.8	1	R.FNRLLAHKRQVDKVTAINLIEK.Y
Reverse_YPL150W	2	2	3.4%	901	100646	9.4	U	YPL150W SGDID:S000006071, Chr XVI from 268187-270892, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_47.16898.16898.2	1.7476	0.1459	32.5	1670.8322	1671.8448	6468.1	137	3.336	34.4	1	R.PVIAGAVNENLSGISET.R
*	Jamie_Alpha_SPB_74.26667.26667.2	1.9671	0.1033	32.3	1589.7322	1590.6404	6064.2	23	3.513	38.5	1	K.YNGVETLEDSTFQS.Y
YIL169C	2	2	3.4%	995	99736	4.6	U	YIL169C SGDID:S000001431, Chr IX from 26106-23119, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_87.31054.31054.2	1.8181	0.1445	12.5	1500.3922	1502.4888	5407.7	10	3.969	37.5	1	Q.SASSTSGVSSSGSQSVS.S
*	Jamie_Alpha_SPB_17.05959.05959.4	2.6276	0.0241	46.6	1946.1765	1947.2817	3612.0	89	3.327	28.1	1	K.YSFSADLKVYGDLLVKK.S
Reverse_YEL053C	2	2	3.4%	733	84302	5.9	U	MAK10 SGDID:S000000779, Chr V from 56102-53901, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type, required for replication of dsRNA virus; expression is glucose-repressible" 
*	Jamie_Alpha_SPB_35.12614.12614.2	1.5818	0.1591	10.9	1013.2522	1015.2413	2765.2	1	4.007	61.1	1	Q.VLRTGTVLVG.N
*	Jamie_Alpha_SPB_24.08479.08479.2	1.7303	0.0685	11.6	1701.5322	1698.7869	5843.3	25	3.258	39.3	1	S.HIANINSEIDNQSDK.L
YHR207C	2	2	3.4%	526	60547	6.5	U	SET5 SGDID:S000001250, Chr VIII from 516485-514905, reverse complement, Verified ORF, "Zinc-finger protein of unknown function, contains one canonical and two unusual fingers in unusual arrangements; deletion enhances replication of positive-strand RNA virus" 
*	Jamie_Alpha_SPB_17.06028.06028.2	1.9729	0.1139	14.0	1013.4922	1016.0122	3976.7	168	4.19	50.0	1	D.SDQSAVHNGT.E
*	Jamie_Alpha_SPB_23.08036.08036.2	1.6466	0.0595	10.5	961.0522	960.1245	4626.5	50	3.433	71.4	1	G.NVRKTSVR.F
YPR117W	3	3	3.3%	2489	285902	8.3	U	YPR117W SGDID:S000006321, Chr XVI from 760023-767492, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_24.08460.08460.3	2.6829	0.1552	88.5	1845.9543	1848.0684	4027.4	1	4.114	41.7	1	R.SPYNDANTIYGLHIIR.T
*	Jamie_Alpha_SPB_32.11454.11454.4	2.3913	0.0472	46.5	2492.1365	2492.9248	4435.0	306	3.097	25.0	1	R.LISPQVQIKSDVERNAAVILAAR.D
*	Jamie_Alpha_SPB_48.17066.17066.4	3.1354	0.2565	29.4	4778.8564	4783.9995	8148.0	14	4.45	15.9	1	I.HRLLSPDSQNRDNSHILEVEGHNSFYSSTHSSDIRSINSDET.Y
Reverse_YPR164W	3	3	3.3%	1407	161237	5.9	U	MMS1 SGDID:S000006368, Chr XVI from 870699-874922, Verified ORF, "Protein likely involved in protection against replication-dependent DNA damage; mutants are sensitive to methyl methanesulfonate (MMS); implicated in regulation of Ty1 transposition" 
*	Jamie_Alpha_SPB_39.13922.13922.3	1.7303	0.0083	24.0	2847.7144	2851.4265	8474.6	7	2.792	25.0	1	R.LDQNLVLMRNIKDLYLFKKNKSR.T
*	Jamie_Alpha_SPB_110.39508.39508.1	1.5028	0.0316	18.8	867.38	866.0049	5338.2	233	3.1	50.0	1	Q.NASVLSFK.L
*	Jamie_Alpha_SPB_103.36883.36883.2	1.644	0.1737	12.6	1825.3322	1828.0781	6194.9	80	3.759	36.7	1	F.IGNNSVILSFHKQQIE.E
YNL257C	2	2	3.3%	1229	142819	8.6	U	SIP3 SGDID:S000005201, Chr XIV from 164321-160632, reverse complement, Verified ORF, "Protein that activates transcription through interaction with DNA-bound Snf1p, C-terminal region has a putative leucine zipper motif; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_52.18522.18522.2	1.6411	0.1752	13.1	2045.4122	2048.303	8526.9	2	4.538	35.3	1	L.SKDTQVPPKSPEKSGWLY.M
*	Jamie_Alpha_SPB_38.13527.13527.3	2.5615	0.0694	56.6	2506.7043	2505.975	7866.3	211	3.14	23.8	1	K.TLKLYDASGLQMKAIVLFSDYK.L
YPL217C	2	2	3.3%	1183	135571	6.8	U	BMS1 SGDID:S000006138, Chr XVI from 143170-139619, reverse complement, Verified ORF, "Essential conserved nucleolar GTP-binding protein required for synthesis of 40S ribosomal subunits and for processing of the 35S pre-rRNA at sites A0, A1, and A2; interacts with Rcl1p, has similarity to Tsr1p" 
*	Jamie_Alpha_SPB_81.28928.28928.2	1.9598	0.0369	11.5	1637.4922	1635.7803	6346.6	21	3.359	42.3	1	R.RLTFLECPADDLNA.M
*	Jamie_Alpha_SPB_45.16156.16156.2	1.1507	0.032	63.7	2930.372	2930.2249	7228.5	39	2.85	20.8	1	K.EKKKEYFAQNGKRTTMGGDDESRPR.K
Reverse_YGR218W	2	2	3.3%	1084	124104	5.5	U	CRM1 SGDID:S000003450, Chr VII from 932544-935798, Verified ORF, "Major karyopherin, involved in export of proteins, RNAs, and ribosomal subunits from the nucleus" 
*	Jamie_Alpha_SPB_97.34941.34941.2	1.4948	0.0962	11.0	2386.0923	2386.771	7370.1	7	3.735	30.0	1	K.LFRPYQGVVYMIDSAVVAKND.K
*	Jamie_Alpha_SPB_90.32232.32232.2	2.1302	0.0593	22.4	1477.9521	1477.6953	5830.4	62	3.136	42.9	1	R.LLSELTAVILSSSSG.Q
YGL163C	2	2	3.3%	898	101754	9.0	U	RAD54 SGDID:S000003131, Chr VII from 196409-193713, reverse complement, Verified ORF, "DNA-dependent ATPase, stimulates strand exchange by modifying the topology of double-stranded DNA; involved in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; member of the SWI/SNF family" 
*	Jamie_Alpha_SPB_74.26379.26379.2	1.6895	0.1865	37.4	2230.3123	2229.717	8851.9	63	4.021	28.9	1	K.FASVPVVIDPKLAKILRPHQ.V
*	Jamie_Alpha_SPB_47.16840.16840.2	1.7096	0.0090	73.6	1216.0922	1214.4069	4876.4	1	3.15	66.7	1	K.YSAKFSILER.F
YLR115W	2	2	3.3%	859	96254	7.6	U	CFT2 SGDID:S000004105, Chr XII from 377986-380565, Verified ORF, "Subunit of the mRNA cleavage and polyadenlylation factor (CPF); required for pre-mRNA cleavage, polyadenylation and poly(A) site recognition, 43% similarity with the mammalian CPSF-100 protein." 
*	Jamie_Alpha_SPB_103.36882.36882.2	1.5325	0.1929	30.1	2088.0322	2086.1482	8069.0	1	4.808	35.3	1	E.DNKNEEEDGYNMSDPISK.R
*	Jamie_Alpha_SPB_19.06603.06603.1	1.1592	0.138	15.8	1166.76	1168.2571	6758.7	5	3.164	55.6	1	K.HRASRYSGFS.G
Reverse_YCR093W	3	3	3.2%	2108	240277	6.4	U	CDC39 SGDID:S000000689, Chr III from 280113-286439, Verified ORF, "Component of the CCR4-NOT complex, which has multiple roles in regulating mRNA levels including regulation of transcription and destabilizing mRNAs by deadenylation; basal transcription factor" 
*	Jamie_Alpha_SPB_64.23080.23080.4	2.141	0.0463	41.1	4127.5767	4127.7705	9223.2	95	3.164	16.7	1	K.YEIGAEIGVHLVIARILKSDVSLFDYGVGKKIDYTDK.Y
*	Jamie_Alpha_SPB_21.07377.07377.2	1.9954	0.0365	10.2	1628.9722	1627.8037	5190.8	3	2.948	50.0	1	L.RSKQLQQQQQQAR.I
*	Jamie_Alpha_SPB_21.07502.07502.2	1.773	0.1483	11.9	2115.612	2118.5889	5516.7	4	4.273	35.3	1	L.LIERVSKALAMQFVRKLD.P
YBR235W	2	2	3.2%	1120	123998	8.5	U	YBR235W SGDID:S000000439, Chr II from 686896-690258, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_25.08977.08977.4	3.004	0.1882	13.7	2889.9365	2890.3171	6788.1	49	4.084	25.8	1	Q.DNIKYWRPQILLFVDNPRTSWNL.I
*	Jamie_Alpha_SPB_101.36391.36391.2	1.7005	0.113	25.4	1413.3722	1414.6445	4421.3	71	3.179	45.8	1	R.KYTSGVQKLGVSF.T
YKL165C	2	2	3.2%	919	105693	6.7	U	MCD4 SGDID:S000001648, Chr XI from 140696-137937, reverse complement, Verified ORF, "Protein involved in glycosylphosphatidylinositol (GPI) anchor synthesis; multimembrane-spanning protein that localizes to the endoplasmic reticulum; highly conserved among eukaryotes" 
*	Jamie_Alpha_SPB_111.39842.39842.1	1.4381	0.0685	20.0	747.15	745.85645	2663.2	134	3.328	58.3	1	A.WGAGLNK.P
*	Jamie_Alpha_SPB_49.17403.17403.3	2.6984	0.1776	13.9	2500.7043	2502.969	5357.8	437	3.529	26.2	1	L.KLNFKDYTISSLIISMSDILSL.N
Reverse_YDR074W	2	2	3.2%	896	102976	8.1	U	TPS2 SGDID:S000002481, Chr IV from 593889-596579, Verified ORF, "Phosphatase subunit of the trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" 
*	Jamie_Alpha_SPB_78.28060.28060.2	1.7376	0.0807	18.4	1628.2722	1625.793	5739.9	53	3.869	40.9	1	R.RPLCRFYENSPW.P
*	Jamie_Alpha_SPB_67.23948.23948.2	1.7747	0.1323	31.8	2046.0122	2048.2542	11758.4	190	3.649	28.1	1	Q.EKTLYLPDDDLDQPKEK.A
YPL084W	2	2	3.2%	844	97276	5.4	U	BRO1 SGDID:S000006005, Chr XVI from 394035-396569, Verified ORF, "Cytoplasmic class E vacuolar protein sorting (VPS) factor that coordinates deubiquitination in the multivesicular body (MVB) pathway by recruiting Doa4p to endosomes" 
*	Jamie_Alpha_SPB_102.36646.36646.2	1.5887	0.0809	11.1	2092.152	2094.2888	8569.8	4	3.988	41.2	1	I.ARENINEDYKNSIANLTK.A
*	Jamie_Alpha_SPB_16.05515.05515.2	1.757	0.041	84.1	1130.3121	1131.2339	5805.7	130	3.231	56.2	1	R.RKAVENEER.E
YER171W	2	2	3.2%	778	89786	5.6	U	RAD3 SGDID:S000000973, Chr V from 527077-529413, Verified ORF, "5' to 3' DNA helicase, involved in nucleotide excision repair and transcription; subunit of RNA polymerase II transcription initiation factor TFIIH; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein" 
*	Jamie_Alpha_SPB_15.05437.05437.4	2.4566	0.0565	53.4	1870.8965	1868.1492	3782.4	457	2.978	26.7	1	R.FTCLDASIAIKPVFER.F
*	Jamie_Alpha_SPB_108.38686.38686.1	1.1084	0.0524	11.2	1078.44	1078.1698	4662.7	49	2.809	43.8	1	R.NDPSIVRNY.G
YLR228C	2	2	3.2%	814	89286	6.6	U	ECM22 SGDID:S000004218, Chr XII from 602465-600021, reverse complement, Verified ORF, "Sterol regulatory element binding protein, regulates transcription of the sterol biosynthetic genes ERG2 and ERG3; member of the fungus-specific Zn[2]-Cys[6] binuclear cluster family of transcription factors; homologous to Upc2p" 
*	Jamie_Alpha_SPB_117.41898.41898.1	1.1268	0.2267	16.7	1182.53	1183.347	6001.9	58	4.255	36.4	1	P.GNSPLSIPITPS.F
*	Jamie_Alpha_SPB_29.10258.10258.2	1.7016	0.111	22.8	1483.7522	1484.7391	7494.7	3	3.825	50.0	1	S.SASRLVPELVGLSR.K
YER140W	2	2	3.2%	556	64794	9.8	U	YER140W SGDID:S000000942, Chr V from 451560-453230, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_105.37735.37735.2	1.5421	0.0607	76.2	2116.2122	2118.314	7023.7	9	3.615	35.3	1	K.VDVSTRIALHSDYNKENR.I
*	Jamie_Alpha_SPB_113.40444.40444.1	1.5879	0.0644	14.0	934.38	933.0086	5311.4	13	3.389	64.3	1	R.IALHSDYN.K
Reverse_YDR299W	2	2	3.2%	534	61203	4.8	U	BFR2 SGDID:S000002707, Chr IV from 1059621-1061225, Verified ORF, "Essential protein possibly involved in secretion; multicopy suppressor of sensitivity to Brefeldin A" 
*	Jamie_Alpha_SPB_15.05456.05456.2	2.1533	0.0877	29.7	1122.5922	1123.2542	5479.1	68	3.278	68.8	1	P.DQVSYNLKR.G
*	Jamie_Alpha_SPB_112.40294.40294.1	1.4005	0.0117	13.4	925.71	925.1161	5410.0	16	2.636	64.3	1	V.PSILEPLR.G
Reverse_YPR117W	3	3	3.1%	2489	285902	8.3	U	YPR117W SGDID:S000006321, Chr XVI from 760023-767492, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_83.29827.29827.2	1.7737	0.1215	25.4	2933.4321	2932.01	9752.5	10	4.711	22.0	1	P.NEQQNFCQLSSISVKNSNTGDSTESR.I
*	Jamie_Alpha_SPB_16.05678.05678.4	3.3001	0.1847	14.0	3383.5764	3380.9856	5812.8	11	4.226	22.0	1	A.TMLLTLKLTSTQIDFTLEQGSKMFLRPEH.L
*	Jamie_Alpha_SPB_93.33278.33278.3	3.0712	0.1735	12.8	2537.6943	2540.9678	6053.2	2	4.643	28.6	1	G.INLKYQKGNPVTLALTHFFTSF.S
Reverse_YJL039C	3	3	3.1%	1683	191534	5.3	U	NUP192 SGDID:S000003576, Chr X from 373715-368664, reverse complement, Verified ORF, "Essential structural subunit of the nuclear pore complex (NPC), localizes to the nuclear periphery of nuclear pores, homologous to human p205" 
*	Jamie_Alpha_SPB_62.22266.22266.2	2.0324	0.1282	14.1	2093.152	2093.3818	9201.9	25	4.277	32.5	1	L.VSILSDLLSTGSSIFTALNPG.L
*	Jamie_Alpha_SPB_37.13204.13204.2	2.102	0.095	10.9	1723.0721	1721.0038	8388.6	177	3.411	35.7	1	Y.NSLNSTLFDLLELKL.A
*	Jamie_Alpha_SPB_67.23906.23906.2	1.8736	0.1404	27.9	1837.2722	1835.9568	8872.4	71	3.849	34.4	1	K.LSIDDLTLDEGSLLSDE.E
Reverse_YEL022W	2	2	3.1%	1459	165667	5.1	U	GEA2 SGDID:S000000748, Chr V from 111421-115800, Verified ORF, "Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs), involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; similar to but not functionally redundant with Gea1p" 
*	Jamie_Alpha_SPB_94.33826.33826.2	1.3457	0.1367	11.2	2672.0122	2671.9917	11005.4	475	3.522	20.8	1	D.ATINSENGFVSAAINSSKICEMAKK.S
*	Jamie_Alpha_SPB_40.14140.14140.2	2.3709	0.0116	12.3	2232.412	2231.6218	8089.6	9	2.956	34.2	1	I.KVTVAIMTSQAANRLVESRR.N
Reverse_YJR137C	2	2	3.1%	1442	161218	5.5	U	ECM17 SGDID:S000003898, Chr X from 683200-678872, reverse complement, Verified ORF, "Sulfite reductase beta subunit, involved in amino acid biosynthesis, transcription repressed by methionine" 
*	Jamie_Alpha_SPB_76.27064.27064.2	1.5315	0.0886	10.2	2213.5723	2212.381	11335.4	3	3.545	31.6	1	G.GSSTDKLNESITGRLFNSER.K
*	Jamie_Alpha_SPB_86.30723.30723.4	3.3872	0.1456	12.1	2606.6565	2607.8713	4613.3	234	4.086	25.4	1	T.LSDTAESLAVKTEENAIELTPFDI.D
YGR270W	2	2	3.1%	1379	157406	5.2	U	YTA7 SGDID:S000003502, Chr VII from 1027376-1031515, Verified ORF, "Protein of unknown function, member of CDC48/PAS1/SEC18 family of ATPases, potentially phosphorylated by Cdc28p" 
*	Jamie_Alpha_SPB_40.14382.14382.4	2.9815	0.1739	16.5	2504.0964	2501.632	5736.5	3	3.617	28.6	1	D.EDDEEGDRISHSASSKRLKRAN.S
*	Jamie_Alpha_SPB_43.15224.15224.2	1.8188	0.0892	21.5	2496.112	2493.6465	7966.5	19	3.745	27.5	1	R.ARKEPKENEDSLQTQVTEENF.S
Reverse_YMR012W	2	2	3.1%	1277	145165	6.4	U	CLU1 SGDID:S000004614, Chr XIII from 291133-294966, Verified ORF, "eIF3 component of unknown function; deletion causes defects in mitochondrial organization but not in growth or translation initiation, can rescue cytokinesis and mitochondrial organization defects of the Dictyostelium cluA- mutant" 
*	Jamie_Alpha_SPB_85.30464.30464.4	3.518	0.1908	10.1	2954.0566	2951.4844	5374.9	169	3.972	22.2	1	N.FISTPAPHHIKPLEYVKLIEALRNY.V
*	Jamie_Alpha_SPB_55.19840.19840.2	1.8873	0.0696	16.4	1681.6921	1681.9731	9062.2	88	3.478	35.7	1	K.PVEKGEQVLKNIKAQ.R
Reverse_YNL273W	2	2	3.1%	1238	141120	6.1	U	TOF1 SGDID:S000005217, Chr XIV from 122883-126599, Verified ORF, "Subunit of a replication-pausing checkpoint complex (Tof1p-Mrc1p-Csm3p) that acts at the stalled replication fork to promote sister chromatid cohesion after DNA damage, facilitating gap repair of damaged DNA; interacts with the MCM helicase" 
*	Jamie_Alpha_SPB_46.16567.16567.3	2.7053	0.2925	31.2	4244.4243	4240.816	9629.1	8	5.541	15.3	1	L.ECSVTLDSVEVTGPLFCPENIKRPISYGILLLLARYD.K
*	Jamie_Alpha_SPB_59.21031.21031.2	1.7833	0.0347	78.7	1736.7722	1736.1075	7869.4	9	3.74	39.3	1	R.PISYGILLLLARYDK.D
Reverse_YDR293C	2	2	3.1%	1250	139954	7.6	U	SSD1 SGDID:S000002701, Chr IV from 1049386-1045634, reverse complement, Verified ORF, "Protein with a role in maintenance of cellular integrity, interacts with components of the TOR pathway; ssd1 mutant of a clinical S. cerevisiae strain displays elevated virulence" 
*	Jamie_Alpha_SPB_27.09434.09434.3	2.2285	0.0687	53.6	1918.3143	1915.0697	7779.2	444	3.228	28.6	1	K.QLEHIEQIYNDNEIR.T
*	Jamie_Alpha_SPB_60.21354.21354.4	2.4125	0.0025	29.8	2737.1765	2743.132	4829.1	377	2.863	21.7	1	K.IKLVGKILEDATNTDFNYGFNQIK.K
Reverse_YML010W	2	2	3.1%	1063	115650	5.2	U	SPT5 SGDID:S000004470, Chr XIII from 247677-250868, Verified ORF, "Protein that forms a complex with Spt4p and mediates both activation and inhibition of transcription elongation; Spt4p-Spt5p complex also plays a role in pre-mRNA processing" 
*	Jamie_Alpha_SPB_85.30606.30606.2	1.69	0.0737	11.6	1368.3722	1366.4764	5195.7	12	3.429	46.7	1	S.VGGGGSGGHANVAPTK.G
*	Jamie_Alpha_SPB_50.18003.18003.2	1.3588	0.1282	10.3	2034.2122	2035.3079	8355.9	19	3.787	37.5	1	A.LEEVTPQINKTEVHQIR.F
Reverse_YMR189W	2	2	3.1%	1034	114451	7.3	U	GCV2 SGDID:S000004801, Chr XIII from 637499-640603, Verified ORF, "P subunit of the mitochondrial glycine decarboxylase complex, required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm" 
*	Jamie_Alpha_SPB_20.07074.07074.4	2.5649	0.2015	15.3	1713.5765	1712.9152	3567.7	1	4.238	35.3	1	L.HSKVCIPAGAPGGGGHPI.S
*	Jamie_Alpha_SPB_48.17098.17098.2	1.6989	0.0859	12.5	1422.8522	1422.5828	4048.5	445	3.201	34.6	1	K.DIVAFFAAHPGGYG.M
Reverse_YDL223C	2	2	3.1%	1046	113616	6.4	U	HBT1 SGDID:S000002382, Chr IV from 60406-57266, reverse complement, Verified ORF, "Substrate of the Hub1p ubiquitin-like protein that localizes to the shmoo tip (mating projection); mutants are defective for mating projection formation, thereby implicating Hbt1p in polarized cell morphogenesis" 
*	Jamie_Alpha_SPB_68.24320.24320.2	1.548	0.0983	11.0	1413.2922	1414.6373	6004.4	428	3.021	37.5	1	K.MHGLETGAKPMNQ.S
*	Jamie_Alpha_SPB_84.30090.30090.2	1.4483	0.1518	23.6	3367.4922	3367.7886	4721.6	2	4.153	14.5	1	K.MHGLETGAKPMNQSGSTGSDFKEKMSSPIVVD.Q
YBR079C	2	2	3.1%	964	110344	6.3	U	RPG1 SGDID:S000000283, Chr II from 398271-395377, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" 
*	Jamie_Alpha_SPB_15.05262.05262.2	2.0701	0.0191	11.2	1560.4922	1559.8467	2782.4	32	3.297	50.0	1	L.IKKNKDDLEKISK.I
*	Jamie_Alpha_SPB_92.32892.32892.3	2.5477	0.05	54.1	1898.9043	1903.1454	4668.9	343	3.102	29.7	1	K.FKEHVSGTKESELAAIR.N
YLR148W	2	2	3.1%	918	107398	7.0	U	PEP3 SGDID:S000004138, Chr XII from 434642-437398, Verified ORF, "Vacuolar peripheral membrane protein that promotes vesicular docking/fusion reactions in conjunction with SNARE proteins, required for vacuolar biogenesis, forms complex with Pep5p that mediates protein transport to the vacuole" 
*	Jamie_Alpha_SPB_36.12688.12688.2	2.0015	0.0574	18.6	1690.0721	1691.0269	8827.2	29	3.625	39.3	1	D.NKFDKALSLKGLTVR.E
*	Jamie_Alpha_SPB_34.12060.12060.3	1.8322	0.0193	28.1	1638.9844	1641.7806	5253.3	307	2.686	33.3	1	K.SNENKYDLNFQLR.L
Reverse_YNL212W	2	2	3.1%	782	88846	5.1	U	VID27 SGDID:S000005156, Chr XIV from 247462-249810, Verified ORF, "Cytoplasmic protein of unknown function; possibly involved in vacuolar protein degradation; not essential for proteasome-dependent degradation of fructose-1,6-bisphosphatase (FBPase); null mutants exhibit normal growth" 
*	Jamie_Alpha_SPB_41.14806.14806.2	1.7451	0.1455	32.1	1524.8322	1523.7288	6122.1	51	4.331	42.3	1	K.VNESAPFSKLFGIN.G
*	Jamie_Alpha_SPB_20.07012.07012.1	1.1823	0.1012	18.3	1195.37	1195.3798	6232.3	58	2.849	44.4	1	K.LDMLLLTSEC.T
Reverse_YFR022W	2	2	3.1%	733	79709	8.3	U	ROG3 SGDID:S000001918, Chr VI from 196821-199022, Verified ORF, "Protein that binds to Rsp5p, which is a hect-type ubiquitin ligase, via its 2 PY motifs; has similarity to Rod1p; mutation suppresses the temperature sensitivity of an mck1 rim11 double mutant" 
*	Jamie_Alpha_SPB_36.13020.13020.2	1.9284	0.1389	33.3	1325.5122	1324.2543	7584.3	32	3.831	55.0	1	E.EEEEQSSNEDK.Q
*	Jamie_Alpha_SPB_79.28384.28384.2	1.7798	0.1141	27.2	1351.5922	1349.4899	5201.2	142	3.776	45.5	1	L.SKLSSTSQARQR.T
YBL079W	2	2	3.0%	1502	169474	6.1	U	NUP170 SGDID:S000000175, Chr II from 75256-79764, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p" 
*	Jamie_Alpha_SPB_55.19680.19680.2	1.5301	0.0932	11.6	1965.1921	1967.2346	5388.4	5	3.848	35.3	1	R.SGRIFFAGQASGLNIWEL.H
*	Jamie_Alpha_SPB_85.30420.30420.4	3.072	0.068	65.6	3257.2166	3252.5708	6273.7	6	3.717	23.1	1	K.EYKIDNDPIEKYVKNSGNNLGICFYKE.-
YBR115C	2	2	3.0%	1392	155345	5.9	U	LYS2 SGDID:S000000319, Chr II from 473920-469742, reverse complement, Verified ORF, "Alpha aminoadipate reductase, catalyzes the reduction of alpha-aminoadipate to alpha-aminoadipate 6-semialdehyde, which is the fifth step in biosynthesis of lysine; activation requires posttranslational phosphopantetheinylation by Lys5p" 
*	Jamie_Alpha_SPB_104.37233.37233.4	3.1331	0.1799	15.9	3220.0566	3224.733	6720.2	18	4.374	21.4	1	M.GQLLTAQATTPFPKLHHAFFVGDILTKRD.C
*	Jamie_Alpha_SPB_61.21939.21939.2	1.5996	0.1474	31.1	1435.7922	1433.6909	4427.6	109	4.157	45.8	1	G.SYILADLLGRSPK.N
Reverse_YPL016W	2	2	3.0%	1314	147938	8.8	U	SWI1 SGDID:S000005937, Chr XVI from 521011-524955, Verified ORF, "One of 11 subunits of the SWI/SNF chromatin remodeling complex that regulates transcription by remodeling chromosomes; required for transcription of many genes, including ADH1, ADH2, GAL1, HO, INO1 and SUC2" 
*	Jamie_Alpha_SPB_117.42018.42018.4	3.6243	0.1917	41.7	2990.5366	2993.3872	6986.4	35	4.251	24.0	1	V.KSYNQQQLLTNKSTSNNINLIIESLK.L
*	Jamie_Alpha_SPB_60.21429.21429.2	1.7959	0.1226	29.9	1590.6122	1592.8357	6764.7	228	4.476	34.6	1	D.YLNNGTNKNLLISK.F
Reverse_YOR227W	3	3	3.0%	1246	139457	8.9	U	YOR227W SGDID:S000005753, Chr XV from 762825-766565, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_106.37886.37886.2	1.8517	0.0951	25.1	1674.9922	1674.854	5825.3	100	3.705	38.5	1	K.SHRVNSLDNLLKDY.K
*	Jamie_Alpha_SPB_30.10629.10629.2	1.7736	0.0976	24.7	1454.8722	1454.6813	7775.4	40	4.075	45.5	1	T.LEDLKFSSDMIR.K
*	Jamie_Alpha_SPB_26.09235.09235.2	1.928	0.0474	11.5	1376.7922	1378.6549	5726.6	91	2.896	45.5	1	S.TELINHPISLLK.S
YER047C	2	2	3.0%	897	100332	9.0	U	SAP1 SGDID:S000000849, Chr V from 246502-243809, reverse complement, Verified ORF, "Putative ATPase of the AAA family, interacts with the Sin1p transcriptional repressor in the two-hybrid system" 
*	Jamie_Alpha_SPB_13.04632.04632.2	1.7272	0.0583	11.1	1317.0521	1317.5712	4913.4	24	3.481	50.0	1	R.QAAKQIFAEIVV.H
*	Jamie_Alpha_SPB_28.10034.10034.2	2.0295	0.1767	58.1	1587.4922	1587.724	6242.5	4	3.808	50.0	1	I.SASSLTSKYLGESEK.L
Reverse_YLR396C	2	2	3.0%	691	79271	5.3	U	VPS33 SGDID:S000004388, Chr XII from 912310-910235, reverse complement, Verified ORF, "ATP-binding protein that is a subunit of the homotypic vacuole fusion and vacuole protein sorting (HOPS) complex; essential for membrane docking and fusion at both the Golgi-to-endosome and endosome-to-vacuole stages of protein transport" 
*	Jamie_Alpha_SPB_113.40533.40533.1	1.7578	0.0024	17.6	938.53	937.1734	5789.1	149	3.532	64.3	1	K.KGLIKQLH.K
*	Jamie_Alpha_SPB_64.22785.22785.2	1.8057	0.0263	79.2	1630.5122	1630.7545	6083.5	492	3.017	33.3	1	K.IFLDNETQHEDIR.K
YKR008W	2	2	3.0%	625	72276	5.2	U	RSC4 SGDID:S000001716, Chr XI from 451844-453721, Verified ORF, "One of 15 subunits of the 'Remodel the Structure of Chromatin' (RSC) complex; found in close proximity to nucleosomal DNA; displaced from the surface of nucleosomal DNA after chromatin remodeling" 
*	Jamie_Alpha_SPB_116.41744.41744.1	1.5204	0.0968	20.0	1045.3	1046.0819	6231.2	72	3.683	50.0	1	T.EAGGSDERPK.Y
*	Jamie_Alpha_SPB_112.40220.40220.1	1.1561	0.0409	10.3	1043.74	1042.2639	5797.9	4	3.401	56.2	1	L.LTINKEPVK.S
Reverse_YKR054C	7	7	2.9%	4092	471351	6.3	U	DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" 
*	Jamie_Alpha_SPB_13.04578.04578.2	2.6296	0.0266	12.0	1100.0322	1099.4026	3261.1	7	2.751	81.2	1	E.QVKLIKKIE.E
*	Jamie_Alpha_SPB_7.02354.02354.2	1.6303	0.11	91.5	1125.6921	1125.2694	3854.0	161	3.435	50.0	1	R.LGDIFYGPSR.P
*	Jamie_Alpha_SPB_76.27283.27283.3	1.8304	0.0461	30.6	3581.8145	3578.262	7256.5	49	2.851	19.0	1	K.KLIMDFDSLNSHRHIKPQVIKLGNLWAVFR.T
*	Jamie_Alpha_SPB_89.31816.31816.2	1.7629	0.162	14.8	2235.0522	2235.7393	9243.0	19	3.773	28.9	1	N.LWAVFRTLITKGTRSAGILM.M
*	Jamie_Alpha_SPB_19.06754.06754.2	1.9498	0.1116	11.3	2607.412	2609.003	6736.5	128	3.498	25.0	1	Y.IQSLSKGSPYGLYLIAAHRTFRE.S
*	Jamie_Alpha_SPB_118.42502.42502.4	2.6994	0.0853	64.8	2688.3765	2687.1487	8923.4	13	3.202	24.6	1	K.TISENFFELIKLAEPPTLTPSIPK.R
*	Jamie_Alpha_SPB_68.24181.24181.2	1.7447	0.0859	21.8	1356.8121	1354.4681	4987.2	276	3.817	44.4	1	R.ELYQCHLYDI.F
YDR150W	5	5	2.9%	2748	313032	5.4	U	NUM1 SGDID:S000002557, Chr IV from 755623-763869, Verified ORF, "Protein required for nuclear migration, localizes to the mother cell cortex and the bud tip; may mediate interactions of dynein and cytoplasmic microtubules with the cell cortex" 
*	Jamie_Alpha_SPB_62.22245.22245.3	2.1903	0.066	47.7	2896.7944	2899.1653	10472.1	212	3.185	21.7	1	K.ELDSTKDLNWDLESKLTNLSMECR.Q
*	Jamie_Alpha_SPB_42.15087.15087.4	2.8029	0.0147	42.4	2658.3765	2658.1172	7300.3	70	2.711	26.5	1	R.TERIKIQKQLDDAKASISSLKRK.V
*	Jamie_Alpha_SPB_13.04651.04651.1	1.2003	0.0548	90.6	1022.02	1022.1864	4915.7	339	3.227	50.0	1	K.PTIDFLSTK.A
*	Jamie_Alpha_SPB_46.16359.16359.2	1.7924	0.051	10.5	1601.5322	1600.8767	5323.5	17	3.437	42.3	1	L.SMGKILVNESTHKR.N
*	Jamie_Alpha_SPB_21.07267.07267.2	1.3153	0.0614	71.7	1100.8121	1101.3347	3410.9	226	3.292	50.0	1	K.RGLQIALTTK.E
Reverse_YGR217W	2	2	2.9%	2039	234597	8.4	U	CCH1 SGDID:S000003449, Chr VII from 924699-930818, Verified ORF, "Voltage-gated calcium channel involved in calcium influx in response to mating pheromones" 
*	Jamie_Alpha_SPB_75.27039.27039.4	1.8059	0.0506	32.0	5493.177	5494.111	7648.0	354	3.563	11.4	1	K.KLYDLKEDEYENLELIYTRGNIDNTETFVVDSNKYFPNNAFMRLR.K
*	Jamie_Alpha_SPB_27.09549.09549.2	1.6892	0.0802	10.4	1999.3322	1998.5248	6501.0	3	4.336	38.2	1	F.MRLRKLSPVGITLKSLGK.K
YLR305C	2	2	2.9%	1900	214605	7.5	U	STT4 SGDID:S000004296, Chr XII from 743865-738163, reverse complement, Verified ORF, "Phosphatidylinositol-4-kinase that functions in the Pkc1p protein kinase pathway; required for normal vacuole morphology, cell wall integrity, and actin cytoskeleton organization" 
*	Jamie_Alpha_SPB_101.36116.36116.4	2.7839	0.1477	11.0	4039.4565	4033.62	8769.7	11	3.767	17.7	1	R.LHKSAKEWVRILLNRSNQDTKILLQSYISDLGEY.S
*	Jamie_Alpha_SPB_95.34004.34004.2	1.372	0.2062	11.4	2582.9321	2583.9214	4774.4	12	4.061	21.4	1	S.VSRDMLGREAVNGLYEYFTSKF.G
Reverse_YJR140C	2	2	2.9%	1648	191679	6.2	U	HIR3 SGDID:S000003901, Chr X from 695611-690665, reverse complement, Verified ORF, "Transcriptional corepressor involved in the cell cycle-regulated transcription of histone genes HTA1, HTB1, HHT1, and HHT2; involved in position-dependent gene silencing and nucleosome reassembly" 
*	Jamie_Alpha_SPB_51.18163.18163.3	2.4173	0.133	78.2	2368.5244	2370.856	5179.4	253	4.044	26.2	1	K.KMESIRSLIPGFALPEPKIDK.Y
*	Jamie_Alpha_SPB_70.24979.24979.4	2.9811	0.1818	13.0	3166.7366	3166.2983	6862.5	3	3.715	23.7	1	N.FSQEIQLERSHEEAEYQEGEINSNLAN.F
YCR089W	2	2	2.9%	1609	166036	4.9	U	FIG2 SGDID:S000000685, Chr III from 267430-272259, Verified ORF, "Cell wall adhesin, expressed specifically during mating; may be involved in maintenance of cell wall integrity during mating" 
*	Jamie_Alpha_SPB_70.24955.24955.3	2.9882	0.1677	15.4	2526.3542	2523.7717	6210.8	4	3.54	27.2	1	C.SHSKCVPTVITEVVTSKGTPSNGH.S
*	Jamie_Alpha_SPB_101.36188.36188.3	2.9471	0.2006	11.8	2330.8743	2334.545	6151.6	82	4.179	28.4	1	T.TYVEQRLSSSGIATSFVAAASST.W
YIL030C	2	2	2.9%	1319	151454	6.3	U	SSM4 SGDID:S000001292, Chr IX from 300008-296049, reverse complement, Verified ORF, "Ubiquitin-protein ligase of the ER/nuclear envelope, required for degradation of Alpha2p and other proteins containing a Deg1 degradation signal; ssm4 mutation suppresses mRNA instability caused by an rna14 mutation" 
*	Jamie_Alpha_SPB_117.42073.42073.2	1.401	0.0492	71.0	1682.6721	1681.9684	10159.4	184	3.264	37.5	1	K.SRLKERFPMMDDR.M
*	Jamie_Alpha_SPB_43.15199.15199.3	2.1124	0.2446	15.8	2849.0044	2846.2764	7568.1	148	4.295	20.8	1	Q.AEELFGQVRDVHAYFVPDGVLMRVP.S
Reverse_YOL075C	2	2	2.9%	1294	145157	7.1	U	YOL075C SGDID:S000005435, Chr XV from 193541-189657, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_82.29317.29317.3	2.4165	0.1925	11.1	3275.7544	3276.9536	7532.8	21	4.803	19.8	1	N.SISTYNHKVPAFFLAFIVGLGPIQAIRAML.S
*	Jamie_Alpha_SPB_14.04821.04821.2	1.92	0.0535	22.7	908.9522	908.9586	3999.8	1	2.737	78.6	1	L.SENDMNAK.W
YPL110C	2	2	2.9%	1223	138014	6.8	U	GDE1 SGDID:S000006031, Chr XVI from 344738-341067, reverse complement, Verified ORF, "Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate after its uptake by Git1p permease, for use as a phosphate source and as a precursor for phosphocholine synthesis" 
*	Jamie_Alpha_SPB_30.10528.10528.3	2.7679	0.1929	15.8	2193.7144	2192.4307	7202.7	1	3.91	36.8	1	N.QFNEIKSTLVVDANKEDAVA.Q
*	Jamie_Alpha_SPB_27.09513.09513.2	2.0203	0.1057	10.5	1567.0122	1565.7666	7505.6	14	4.033	39.3	1	L.NGSVTVPIIANHTLE.I
YER013W	2	2	2.9%	1145	130010	7.8	U	PRP22 SGDID:S000000815, Chr V from 178840-182277, Verified ORF, "DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase, associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes" 
*	Jamie_Alpha_SPB_66.23702.23702.2	1.8455	0.1004	24.5	1509.8522	1511.7557	5445.4	435	3.944	39.3	1	K.LIGAIVGSDDPVIIE.F
*	Jamie_Alpha_SPB_20.07126.07126.3	2.6808	0.2022	15.2	2176.6143	2180.4407	5733.4	67	3.965	26.5	1	S.FDDPTKNKKDSRNEIQML.K
Reverse_YLR382C	2	2	2.9%	894	101920	8.4	U	NAM2 SGDID:S000004374, Chr XII from 884751-882067, reverse complement, Verified ORF, "Mitochondrial leucyl-tRNA synthetase, also has a direct role in splicing of several mitochondrial group I introns; indirectly required for mitochondrial genome maintenance" 
*	Jamie_Alpha_SPB_62.22236.22236.2	1.6613	0.0713	11.4	1349.9521	1352.576	4198.7	193	3.061	45.5	1	R.SYLLHLIAHEVG.G
*	Jamie_Alpha_SPB_44.15721.15721.2	1.6809	0.2233	60.0	1614.4722	1614.8857	6185.6	228	3.933	38.5	1	N.LTDQKPLGRTTKQK.W
Reverse_YPR029C	2	2	2.9%	832	93624	5.5	U	APL4 SGDID:S000006233, Chr XVI from 626964-624466, reverse complement, Verified ORF, "Gamma-adaptin, large subunit of the clathrin-associated protein (AP-1) complex; binds clathrin; involved in vesicle mediated transport" 
*	Jamie_Alpha_SPB_112.40323.40323.1	1.3466	0.0304	13.9	811.86	813.0281	4489.2	94	3.354	50.0	1	K.ALINIGLV.R
*	Jamie_Alpha_SPB_26.09226.09226.2	1.732	0.0834	12.3	1605.6522	1606.8566	5898.4	279	3.425	36.7	1	R.ALEPSSLFGLSTLALS.V
contaminant_KERATIN15	3	4	2.9%	629	64511	6.5	U	no description
*	Jamie_Alpha_SPB_46.16401.16401.1	2.4567	0.3043	100.0	1302.58	1303.4521	11490.9	3	5.907	54.2	1	R.SLDLDSIIAEVGA.Q
*	Jamie_Alpha_SPB_44.15810.15810.2	3.8114	0.3489	100.0	1304.5922	1303.4521	7050.9	2	6.519	79.2	2	R.SLDLDSIIAEVGA.Q
*	Jamie_Alpha_SPB_44.15810.15810.3	2.9312	0.2129	42.4	1956.3844	1952.1223	7050.9	2	4.912	32.4	1	R.SLDLDSIIAEVGAQYEDI.A
YCR093W	2	2	2.8%	2108	240277	6.4	U	CDC39 SGDID:S000000689, Chr III from 280113-286439, Verified ORF, "Component of the CCR4-NOT complex, which has multiple roles in regulating mRNA levels including regulation of transcription and destabilizing mRNAs by deadenylation; basal transcription factor" 
*	Jamie_Alpha_SPB_59.21300.21300.4	2.5059	0.0121	38.1	2624.0166	2624.1448	4789.3	463	2.67	22.7	1	K.ILQRASESKIFKPPNPWTVGILK.L
*	Jamie_Alpha_SPB_85.30640.30640.4	2.4236	0.0596	50.9	3925.6565	3930.4124	8690.9	124	2.778	18.6	1	R.RADQPFITQNTNPYSLSLPEPLGLKNTGVTPQQFR.V
Reverse_YJR138W	2	2	2.8%	1584	181948	8.8	U	IML1 SGDID:S000003899, Chr X from 684482-689236, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane" 
*	Jamie_Alpha_SPB_30.10634.10634.4	3.6555	0.2367	84.6	3727.9365	3724.3486	8757.7	320	4.416	16.1	1	M.VEPQIEERKTKRGKKEKETRLRSRTISGILR.R
*	Jamie_Alpha_SPB_94.33898.33898.2	1.8065	0.1519	15.0	1479.2922	1479.5955	5034.3	125	3.594	41.7	1	L.KRGSARQQSGFQE.K
Reverse_YHR164C	2	2	2.8%	1522	171694	6.5	U	DNA2 SGDID:S000001207, Chr VIII from 429180-424612, reverse complement, Verified ORF, "Essential tripartite DNA replication factor with single-stranded DNA-dependent ATPase, ATP-dependent nuclease, and helicase activities; required for Okazaki fragment processing; involved in DNA repair pathways; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_104.37428.37428.4	3.2502	0.1579	15.4	3108.5764	3111.439	5317.8	473	3.892	21.0	1	L.TFLIDNIGLCTTAVVSTSNIKSLYDNYS.K
*	Jamie_Alpha_SPB_89.31862.31862.2	2.0616	0.1135	28.7	1655.4521	1656.923	7026.8	149	3.302	38.5	1	A.LQTKPNKDDSLLRK.N
YOR153W	2	2	2.8%	1511	170437	7.8	U	PDR5 SGDID:S000005679, Chr XV from 619840-624375, Verified ORF, "Short-lived membrane ABC (ATP-binding cassette) transporter, actively exports various drugs, expression regulated by Pdr1p; also involved in steroid transport, cation resistance, and cellular detoxification during exponential growth" 
*	Jamie_Alpha_SPB_79.28278.28278.2	1.5616	0.1405	25.5	2142.5522	2140.6152	6436.7	3	3.742	40.6	1	R.NMWRLRNNIGFTLFMIL.G
*	Jamie_Alpha_SPB_90.32371.32371.4	3.1607	0.1805	16.9	2992.6165	2996.5637	4111.7	150	3.88	23.3	1	V.EQRKRLTIGVELTAKPKLLVFLDEPT.S
YJL074C	2	2	2.8%	1230	141336	5.8	U	SMC3 SGDID:S000003610, Chr X from 302765-299073, reverse complement, Verified ORF, "Subunit of the multiprotein cohesin complex required for sister chromatid cohesion in mitotic cells; also required, with Rec8p, for cohesion and recombination during meiosis; phylogenetically conserved SMC chromosomal ATPase family member" 
*	Jamie_Alpha_SPB_22.07908.07908.2	2.2573	0.0919	94.9	1490.6921	1489.8223	7086.2	62	3.388	50.0	1	R.MKGGRVTFIPLNR.L
*	Jamie_Alpha_SPB_87.31333.31333.2	1.6118	0.2428	67.6	2406.2722	2408.9797	7850.8	2	4.741	33.3	1	V.KHVFGKTIVVKDLGQGLKLAKK.H
YDR466W	2	2	2.8%	898	100476	9.5	U	PKH3 SGDID:S000002874, Chr IV from 1395111-1397807, Verified ORF, "Protein kinase with similarity to mammalian phosphoinositide-dependent kinase 1 (PDK1) and yeast Pkh1p and Pkh2p, two redundant upstream activators of Pkc1p; identified as a multicopy suppressor of a pkh1 pkh2 double mutant" 
*	Jamie_Alpha_SPB_42.15150.15150.2	2.0586	0.2993	71.4	1249.2722	1247.4832	5416.2	54	4.58	50.0	1	I.PRTKPNVPPLQ.T
*	Jamie_Alpha_SPB_40.14301.14301.2	1.7103	0.1526	31.7	1575.4722	1577.7087	6054.7	5	4.145	42.3	1	Y.EHEGPAMSLNSYNK.I
YMR160W	2	2	2.8%	816	95097	6.9	U	YMR160W SGDID:S000004770, Chr XIII from 575065-577515, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_110.39432.39432.1	1.0269	0.094	19.8	706.97	706.774	5399.9	160	3.048	50.0	1	S.VSGTGSAK.C
*	Jamie_Alpha_SPB_62.22162.22162.3	2.3536	0.2035	16.0	1575.8043	1577.6934	3924.7	3	3.976	39.3	1	L.PLNKYPGEGGNPGYN.V
Reverse_YOR017W	2	2	2.8%	800	93408	9.3	U	PET127 SGDID:S000005543, Chr XV from 361411-363813, Verified ORF, "Protein with a role in mitochondrial RNA stability and/or processing, located in the mitochondrial membrane" 
*	Jamie_Alpha_SPB_17.05965.05965.2	1.2305	0.1489	86.3	903.1322	906.0353	3024.1	231	3.589	58.3	1	R.RGPYTRR.G
*	Jamie_Alpha_SPB_44.15727.15727.2	1.7185	0.1346	29.6	1454.6921	1457.54	5779.4	221	3.702	32.1	1	K.DPTERGSPANTLAAG.F
YJL130C	4	4	2.7%	2214	245123	5.9	U	URA2 SGDID:S000003666, Chr X from 172285-165641, reverse complement, Verified ORF, "Bifunctional carbamoylphosphate synthetase (CPSase)-aspartate transcarbamylase (ATCase), catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP" 
*	Jamie_Alpha_SPB_48.17137.17137.2	2.7473	0.0266	94.0	2613.0322	2610.7502	7738.2	3	4.099	30.4	1	K.EDYDGLFISNGPGDPSVLDDLSQR.L
*	Jamie_Alpha_SPB_35.12352.12352.2	2.8184	0.4103	100.0	1644.4122	1644.8627	6201.8	2	6.918	46.4	1	K.VLGTPIDTIITTEDR.E
*	Jamie_Alpha_SPB_5.01631.01631.2	2.8453	0.1332	100.0	965.53217	966.07886	6221.6	5	4.36	85.7	1	R.TFEEAIQK.A
*	Jamie_Alpha_SPB_17.05961.05961.2	2.509	0.3248	100.0	1646.4521	1646.7539	6107.2	1	5.15	62.5	1	R.VNEIKEEVDYDHR.A
YJL109C	2	2	2.7%	1769	200080	6.5	U	UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_82.29259.29259.3	2.4226	0.106	67.5	2312.3044	2310.7515	5189.9	197	3.258	23.8	1	K.DCQIAAHTILVVFATALPLKK.T
*	Jamie_Alpha_SPB_51.18416.18416.3	2.3854	0.0563	47.6	3138.2344	3140.59	5762.4	23	3.798	22.0	1	K.GNEKEEMEFLLLSFTTALQHVPRHRR.V
YDR464W	2	2	2.7%	1435	161596	8.9	U	SPP41 SGDID:S000002872, Chr IV from 1388862-1393169, Verified ORF, "Protein involved in negative regulation of expression of spliceosome components PRP4 and PRP3" 
*	Jamie_Alpha_SPB_15.05287.05287.2	2.6273	0.0507	33.2	1704.9122	1704.8956	7621.8	27	3.272	43.3	1	R.KNSMQAAHSKGTTTEL.A
*	Jamie_Alpha_SPB_37.13287.13287.2	3.2256	0.1025	75.0	2399.5322	2399.5708	7178.5	21	3.65	31.8	1	I.EDSDANVPPVSIAVSTIEPSQDK.L
Reverse_YLR410W	2	2	2.7%	1146	129755	8.6	U	VIP1 SGDID:S000004402, Chr XII from 937538-940978, Verified ORF, "Protein of unknown function probably involved in the function of the cortical actin cytoskeleton; putative ortholog of S. pombe asp1+" 
*	Jamie_Alpha_SPB_68.24222.24222.3	3.1248	0.1724	94.8	2564.0942	2567.9968	7557.7	469	4.375	23.8	1	R.DAHRIIIALGKFVWKQEKEER.I
*	Jamie_Alpha_SPB_53.19112.19112.2	1.9818	0.0676	25.1	1033.8722	1033.0916	3430.2	10	3.496	61.1	1	R.RGGGGNKSHY.Y
Reverse_YHR079C	2	2	2.7%	1115	126976	6.6	U	IRE1 SGDID:S000001121, Chr VIII from 261593-258246, reverse complement, Verified ORF, "Serine-threonine kinase and endoribonuclease; transmembrane protein that initiates the unfolded protein response signal by regulating synthesis of Hac1p through HAC1 mRNA splicing" 
*	Jamie_Alpha_SPB_59.21055.21055.2	1.3604	0.0185	65.0	2419.7122	2421.8723	9507.5	84	3.162	27.8	1	K.NRLARLLDMLKSSHYKRYR.E
*	Jamie_Alpha_SPB_88.31687.31687.2	1.4249	0.0196	67.7	1256.5521	1256.6146	5162.5	50	2.726	50.0	1	K.SLLVYLPPLIK.F
Reverse_YPR032W	2	2	2.7%	1033	114512	8.4	U	SRO7 SGDID:S000006236, Chr XVI from 634120-637221, Verified ORF, "Protein with roles in exocytosis and cation homeostasis; functions in docking and fusion of post-Golgi vesicles with plasma membrane; homolog of Sro77p and Drosophila lethal giant larvae tumor suppressor; interacts with SNARE protein Sec9p" 
*	Jamie_Alpha_SPB_50.17876.17876.2	1.5613	0.1219	20.8	2185.5122	2183.512	7021.0	85	3.428	26.3	1	K.EVTSIYSLGTAALPYKFGKH.T
*	Jamie_Alpha_SPB_13.04470.04470.1	1.2366	0.0443	13.1	731.39	731.78375	3490.5	131	2.466	57.1	1	K.NQAASLAG.L
Reverse_contaminant_UBIQUITIN03	2	2	2.7%	1011	111720	5.9	U	no description
*	Jamie_Alpha_SPB_92.33135.33135.2	1.9676	0.1278	13.0	1612.5322	1611.708	7534.6	1	3.654	46.7	1	P.YPADESAAASAPARYA.E
*	Jamie_Alpha_SPB_20.07165.07165.2	1.6383	0.0392	77.3	1355.1921	1353.5234	5299.1	18	3.157	55.0	1	R.GVDQSRFLFQR.S
YLL040C	2	2	2.6%	3144	357850	5.6	U	VPS13 SGDID:S000003963, Chr XII from 63644-54210, reverse complement, Verified ORF, "Protein of unknown function; heterooligomeric or homooligomeric complex; peripherally associated with membranes; homologous to human COH1; involved in sporulation, vacuolar protein sorting and protein-Golgi retention" 
*	Jamie_Alpha_SPB_5.01565.01565.4	1.1931	0.1363	42.6	4545.4165	4549.968	3395.0	395	4.079	4.2	1	R.KVSEWELTNQARILSTQSENKTSSSSSEKNNAGFMQSLTTK.I
*	Jamie_Alpha_SPB_77.27525.27525.4	2.7176	0.2019	15.9	4457.3364	4463.0425	7894.4	19	4.013	16.7	1	V.HKFFKASNQHMETIGNIVNAAEATVEGWTTQTRMGIESLL.E
YJL039C	3	3	2.6%	1683	191534	5.3	U	NUP192 SGDID:S000003576, Chr X from 373715-368664, reverse complement, Verified ORF, "Essential structural subunit of the nuclear pore complex (NPC), localizes to the nuclear periphery of nuclear pores, homologous to human p205" 
*	Jamie_Alpha_SPB_33.11617.11617.2	1.9295	0.1154	11.1	1760.0322	1760.0035	7202.5	194	4.019	30.0	1	A.TNSLRILAKLSERSNG.S
*	Jamie_Alpha_SPB_17.06092.06092.1	1.0453	0.0982	22.2	1067.1	1067.0972	7496.9	339	3.334	37.5	1	S.PFDNSTEEK.C
*	Jamie_Alpha_SPB_59.21291.21291.2	1.6215	0.0957	11.8	2213.0923	2213.501	9500.9	23	3.937	33.3	1	L.SSVALRSDFYILANHYLSR.V
Reverse_YHL035C	2	2	2.6%	1592	180925	8.5	U	YHL035C SGDID:S000001027, Chr VIII from 32754-27976, reverse complement, Uncharacterized ORF, "Protein of unknown function, member of the ATP-binding cassette (ABC) family, potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_45.15970.15970.2	2.2273	0.0127	11.5	2387.5322	2386.9302	7586.7	26	3.468	27.3	1	E.LLRFLATIITSKGAGTRGVIGIK.S
*	Jamie_Alpha_SPB_67.24165.24165.2	1.4429	0.1969	12.3	1970.6721	1970.2792	6178.7	40	3.819	32.4	1	E.TITGQNKVKGNELVIAFH.A
YER105C	2	2	2.6%	1391	156649	6.4	U	NUP157 SGDID:S000000907, Chr V from 372009-367834, reverse complement, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), present on both sides of the NPC, has similarity to Nup170p" 
*	Jamie_Alpha_SPB_84.30234.30234.2	1.927	0.1118	33.3	1867.4922	1866.0906	6597.2	295	3.151	32.1	1	S.DFDLKLSERIECLAR.A
*	Jamie_Alpha_SPB_52.18448.18448.2	1.6323	0.1914	33.1	2982.632	2982.2495	8520.6	1	4.191	28.8	1	R.IECLARANGLCDSSTSFDQKPALVQLS.E
YDR104C	2	2	2.6%	1245	145181	9.1	U	SPO71 SGDID:S000002511, Chr IV from 664905-661168, reverse complement, Verified ORF, "Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensable for both nuclear divisions during meiosis" 
*	Jamie_Alpha_SPB_31.10900.10900.2	1.7891	0.0402	85.2	1178.3322	1178.4197	5358.5	16	3.25	62.5	1	R.WKEYIVIAR.S
*	Jamie_Alpha_SPB_37.13356.13356.4	3.3079	0.0645	67.3	2745.5764	2742.0269	5481.2	97	3.193	25.0	1	R.RALSSNRLQKKGNEKQYTQDYGR.Q
Reverse_YKL215C	2	2	2.6%	1286	140427	6.8	U	YKL215C SGDID:S000001698, Chr XI from 30688-26828, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" 
*	Jamie_Alpha_SPB_60.21318.21318.2	1.8361	0.0681	11.8	1789.4722	1788.9982	7037.1	65	3.177	32.4	1	R.DGPQAYITNKGGVNILAG.T
*	Jamie_Alpha_SPB_73.26072.26072.2	1.5489	8.0E-4	66.6	1636.3121	1634.8386	6552.7	437	3.269	30.0	1	R.SGDQGGKIGHPGIVRR.E
YCR033W	2	2	2.6%	1226	138397	9.1	U	SNT1 SGDID:S000000629, Chr III from 186484-190164, Verified ORF, "Subunit of the Set3C deacetylase complex; putative DNA-binding protein" 
*	Jamie_Alpha_SPB_27.09700.09700.2	2.4759	0.0697	32.8	2616.3323	2617.8042	4116.6	144	3.088	30.4	1	R.KIGSRYNPDVERSSSTTSSTPESM.N
*	Jamie_Alpha_SPB_40.14208.14208.2	1.2452	0.0171	64.0	1027.0521	1029.2023	3812.9	114	3.207	57.1	1	R.YSRKTMSR.Y
Reverse_YNL221C	2	2	2.6%	875	100395	9.8	U	POP1 SGDID:S000005165, Chr XIV from 233696-231069, reverse complement, Verified ORF, "Subunit of both RNase MRP, which cleaves pre-rRNA, and nuclear RNase P, which cleaves tRNA precursors to generate mature 5' ends; binds to the RPR1 RNA subunit in Rnase P" 
*	Jamie_Alpha_SPB_115.41126.41126.1	1.3697	0.0391	18.4	1035.69	1034.2931	4580.6	113	3.013	56.2	1	N.LKKPAALHR.P
*	Jamie_Alpha_SPB_60.21565.21565.2	1.3773	0.115	11.3	2314.0723	2311.6145	8335.5	18	3.478	28.9	1	K.PAALHRPDIAEFAFTCRQPL.A
Reverse_YOR112W	2	2	2.6%	761	84769	5.4	U	YOR112W SGDID:S000005638, Chr XV from 531508-533793, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_29.10225.10225.2	1.4807	0.0459	72.1	1530.9922	1531.9279	5243.9	99	3.256	45.5	1	K.PLYILLLFRVQR.D
*	Jamie_Alpha_SPB_114.40776.40776.1	1.5062	0.0321	19.1	830.2	830.95667	5990.9	237	3.171	42.9	1	V.TVPLSDAK.R
YOL081W	3	3	2.5%	3079	351669	7.1	U	IRA2 SGDID:S000005441, Chr XV from 171069-180308, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin" 
*	Jamie_Alpha_SPB_86.30916.30916.2	1.5299	0.1986	12.7	2591.3523	2590.6948	8544.7	107	4.094	20.0	1	N.VNSMITTNQNAHQGSSSPSSSSPSSP.P
*	Jamie_Alpha_SPB_33.11660.11660.2	1.801	0.1464	12.4	3054.0723	3054.6697	6086.5	36	3.907	20.8	1	T.LQDARRIMINIFSIFKRPNSYFIIP.H
*	Jamie_Alpha_SPB_63.22492.22492.4	2.9756	0.1774	17.1	2964.4966	2969.4683	5133.5	295	3.953	23.6	1	F.TYSKIVEGLDPNLDLMKHLFWFSTL.F
YER155C	2	2	2.5%	2167	245428	8.4	U	BEM2 SGDID:S000000957, Chr V from 482843-476340, reverse complement, Verified ORF, "Rho GTPase activating protein (RhoGAP) involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence" 
*	Jamie_Alpha_SPB_37.13266.13266.4	3.5613	0.1547	16.1	3520.3765	3518.0679	6695.0	17	3.589	18.9	1	E.NINLIYMAKIQIGAAEAILHLVKNHYSDFTD.D
*	Jamie_Alpha_SPB_8.02611.02611.3	1.0993	0.0988	25.4	2780.6943	2780.1099	5365.4	488	3.805	9.8	1	R.NYELSWIKASEKLSDPTKGTQNLR.S
YJL207C	3	3	2.5%	2014	229898	5.7	U	YJL207C SGDID:S000003743, Chr X from 47433-41389, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_94.33756.33756.2	1.8214	0.0896	20.7	1673.5122	1675.8761	5950.0	46	3.438	39.3	1	K.FSKLSKTVFDSISTD.E
*	Jamie_Alpha_SPB_99.35562.35562.2	1.5376	0.1752	32.5	2019.6522	2017.27	8001.8	23	3.863	33.3	1	S.YEVNNRSMNTLSRYLR.Y
*	Jamie_Alpha_SPB_21.07612.07612.4	3.1246	0.1365	10.3	4246.3765	4244.7954	5663.0	84	3.591	16.7	1	Y.EVNNRSMNTLSRYLRYFQHMHEVILPHLNDSAKTQ.M
YJL005W	3	3	2.5%	2026	227832	7.3	U	CYR1 SGDID:S000003542, Chr X from 425072-431152, Verified ORF, "Adenylate cyclase, required for cAMP production and cAMP-dependent protein kinase signaling; involved in cell cycle control and glucose and nitrogen repression of sporulation" 
*	Jamie_Alpha_SPB_58.20876.20876.2	1.6008	0.1545	33.2	1794.8121	1795.9523	5694.4	44	3.586	26.7	1	E.TLFKRFSGSNSHDGNK.S
*	Jamie_Alpha_SPB_79.28431.28431.2	1.8895	0.1204	31.6	1370.1522	1371.5363	4902.9	5	3.221	54.2	1	R.KVSSLVRGSSVHD.I
*	Jamie_Alpha_SPB_31.10912.10912.2	1.8332	0.1423	29.7	2451.7522	2451.8152	7662.4	51	3.687	27.5	1	L.SVRMGIHWGCPVPELDLVTQR.M
Reverse_YLR422W	3	3	2.5%	1932	221561	7.8	U	YLR422W SGDID:S000004414, Chr XII from 965893-971691, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_82.29270.29270.2	1.8488	0.0334	10.3	1500.1122	1498.722	6355.7	484	3.509	45.5	1	S.FNRASEKLLYEK.R
*	Jamie_Alpha_SPB_31.10898.10898.2	2.0205	0.2478	86.5	2345.172	2346.6821	5579.8	168	4.704	26.3	1	K.CHNTMTELMSPISEILLIQD.A
*	Jamie_Alpha_SPB_33.11844.11844.2	1.9823	0.0482	11.1	1734.4521	1733.9188	8340.1	149	3.357	36.7	1	V.NEINTDAAPLGYLSVR.G
Reverse_YNL172W	2	2	2.5%	1748	196143	6.0	U	APC1 SGDID:S000005116, Chr XIV from 310638-315884, Verified ORF, "Largest subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition" 
*	Jamie_Alpha_SPB_84.30162.30162.2	1.4678	0.2067	12.9	2300.8323	2302.6414	5491.6	5	4.395	28.6	1	G.TIGTAKKSIRLGSSVGAHFQGW.E
*	Jamie_Alpha_SPB_81.28918.28918.2	1.4383	0.0443	69.4	2265.9922	2263.5132	9563.7	120	3.81	26.2	1	K.QSNGAADLGTKKTSSITLEGKR.S
YHR158C	2	2	2.5%	1164	131094	5.4	U	KEL1 SGDID:S000001201, Chr VIII from 417182-413688, reverse complement, Verified ORF, "Protein required for proper cell fusion and cell morphology; functions in a complex with Kel2p to negatively regulate mitotic exit, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_103.36879.36879.2	1.7501	0.0764	12.0	1596.2722	1593.7831	7101.5	2	3.963	50.0	1	S.ESRIQPSAVPPQQR.N
*	Jamie_Alpha_SPB_88.31567.31567.2	1.9893	0.1363	15.7	1689.4722	1687.8497	6438.4	1	3.568	46.4	1	T.DKNQIYVIGGLHDQS.V
YJR061W	2	2	2.5%	935	108427	6.6	U	YJR061W SGDID:S000003822, Chr X from 550425-553232, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_42.15141.15141.2	1.7381	0.1143	94.0	1233.4722	1231.3483	3509.0	24	3.316	55.0	1	K.GQVLDSVDELR.Y
*	Jamie_Alpha_SPB_85.30523.30523.2	1.6094	0.0767	11.1	1287.2322	1288.4435	4698.2	10	3.037	54.5	1	R.KVVDSNSVQQAI.H
Reverse_YDL117W	2	2	2.5%	885	100621	9.0	U	CYK3 SGDID:S000002275, Chr IV from 248581-251238, Verified ORF, "SH3-domain protein located in the mother-bud neck and the cytokinetic actin ring; mutant phenotype and genetic interactions suggest a role in cytokinesis" 
*	Jamie_Alpha_SPB_22.07897.07897.2	1.9248	0.0971	33.0	1161.3121	1161.3024	4771.9	3	3.241	68.8	1	S.YENGVFLYR.S
*	Jamie_Alpha_SPB_87.31152.31152.2	1.6589	0.0773	10.0	1481.3522	1480.6384	4527.9	122	3.328	41.7	1	S.SRAMHLDNASYSK.K
Reverse_YOR168W	2	2	2.5%	809	93133	8.4	U	GLN4 SGDID:S000005694, Chr XV from 649303-651732, Verified ORF, "Glutamine tRNA synthetase, monomeric class I tRNA synthetase that catalyzes the specific glutaminylation of tRNA(Glu); N-terminal domain proposed to be involved in enzyme-tRNA interactions" 
*	Jamie_Alpha_SPB_12.04350.04350.2	1.8753	0.0637	92.5	904.7922	905.04156	3975.7	28	2.781	71.4	1	K.FSVTHSVK.I
*	Jamie_Alpha_SPB_43.15420.15420.2	1.5436	0.1838	14.1	1433.4521	1430.6041	6406.1	98	3.79	45.5	1	G.DEKIGRGRKIEE.A
YLR106C	7	7	2.4%	4910	559316	5.0	U	MDN1 SGDID:S000004096, Chr XII from 363739-349007, reverse complement, Verified ORF, "Huge dynein-related AAA-type ATPase (midasin), forms extended pre-60S particle with the Rix1 complex (Rix1p-Ipi1p-Ipi3p), may mediate ATP-dependent remodeling of 60S subunits and subsequent export from nucleoplasm to cytoplasm" 
*	Jamie_Alpha_SPB_12.04357.04357.2	1.9315	0.043	15.2	1089.0922	1089.2548	4930.4	24	3.361	66.7	1	C.MNPATDVGKR.D
*	Jamie_Alpha_SPB_61.21942.21942.2	1.6704	0.1542	13.3	1305.3922	1306.3715	4589.8	176	3.497	50.0	1	H.EHTDLQEYLGT.Y
*	Jamie_Alpha_SPB_49.17600.17600.2	1.8202	0.1255	32.7	2777.8123	2778.06	5532.4	146	4.229	21.7	1	P.ISHLGEVGKWANNVLNCTEYSEKK.I
*	Jamie_Alpha_SPB_98.35115.35115.2	1.1289	0.0178	63.0	2678.392	2679.0947	6360.7	19	2.814	25.0	1	K.LELRTWKGLFNSEDAKTRKSIGK.W
*	Jamie_Alpha_SPB_40.14244.14244.2	1.5882	0.0766	10.2	1496.5322	1496.6573	6330.4	14	3.04	50.0	1	K.YSATSEQQKILLD.A
*	Jamie_Alpha_SPB_16.05565.05565.3	3.2632	0.236	27.3	1924.7644	1929.1462	6389.1	23	5.137	34.4	1	D.LEANVPEIETLDLPEDM.N
*	Jamie_Alpha_SPB_56.20198.20198.2	1.4195	0.1541	23.1	2193.912	2194.2886	8029.6	3	3.969	36.1	1	S.ATQDQLQTIDEDMAIDDDR.E
YBR140C	3	3	2.4%	3092	350980	6.6	U	IRA1 SGDID:S000000344, Chr II from 526622-517344, reverse complement, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, mediates membrane association of adenylate cyclase" 
*	Jamie_Alpha_SPB_21.07424.07424.4	2.6693	0.1953	15.7	4729.1367	4731.9707	6224.4	3	4.215	15.2	1	I.LGYPLSPITSTLGQANTSTSTTAATTKTDADTPSTMNTNNNNNNNN.S
*	Jamie_Alpha_SPB_39.13971.13971.2	1.3619	0.0063	64.1	2146.2522	2146.451	9268.9	220	3.088	29.4	1	K.ELNHIDLPKISLYTEGFR.V
*	Jamie_Alpha_SPB_26.09336.09336.2	1.6236	0.1545	32.1	1137.9521	1137.281	7397.5	7	3.886	55.0	1	N.FTASGSVALQR.R
YGL195W	3	3	2.4%	2672	296697	5.3	U	GCN1 SGDID:S000003163, Chr VII from 131531-139549, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn20p; proposed to stimulate Gcn2p activation by an uncharged tRNA" 
*	Jamie_Alpha_SPB_80.28542.28542.2	1.597	0.0804	10.7	1671.7922	1668.8871	5655.2	22	3.115	39.3	1	R.VFLSVNDDEGLHPLL.Q
*	Jamie_Alpha_SPB_65.23352.23352.3	2.3841	0.2897	25.0	3405.5344	3404.9595	7178.2	1	5.196	21.7	1	A.LLEVIMKAGSKLNENSKTNIVNLVEEEMLGS.N
*	Jamie_Alpha_SPB_36.12723.12723.2	1.6971	0.1786	35.0	1996.3722	1996.3206	7676.6	99	3.785	32.4	1	L.QPASNSTDVRRLALVVIR.T
Reverse_YIL149C	2	2	2.4%	1679	195140	6.0	U	MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" 
*	Jamie_Alpha_SPB_90.32334.32334.3	2.2795	0.0236	35.0	3194.3643	3193.764	7378.2	454	3.557	20.0	1	K.RKSIIKQIREESPLRIRKKLNEEAEK.I
*	Jamie_Alpha_SPB_22.07910.07910.2	2.062	0.0223	10.4	1664.5322	1665.7948	5786.4	352	2.838	39.3	1	Y.EAESSTSKNLTEQLK.K
YDR093W	3	3	2.4%	1612	182617	6.2	U	DNF2 SGDID:S000002500, Chr IV from 631277-636115, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport; potential Cdc28p substrate" 
*	Jamie_Alpha_SPB_15.05172.05172.2	1.9614	0.0257	11.8	1258.4521	1260.3898	4137.5	3	3.239	60.0	1	R.LDRTQNDATLL.E
*	Jamie_Alpha_SPB_31.11140.11140.3	2.475	0.1759	11.2	1796.2444	1796.0391	4518.6	153	4.192	33.3	1	E.LKEAKREHGLPQGNFA.V
*	Jamie_Alpha_SPB_22.07852.07852.2	1.4008	0.1058	11.4	1295.3322	1292.4991	6698.0	69	3.323	45.5	1	R.SMASARGNKLRT.S
YLL015W	2	2	2.4%	1559	176873	7.7	U	BPT1 SGDID:S000003938, Chr XII from 116431-121110, Verified ORF, "ABC type transmembrane transporter of MRP/CFTR family, found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p" 
*	Jamie_Alpha_SPB_49.17583.17583.4	2.7522	0.1927	16.5	2018.5765	2014.4564	4382.1	346	4.07	27.8	1	N.AQTIIGAPIQIIVVLTSLY.W
*	Jamie_Alpha_SPB_49.17458.17458.3	2.4407	0.1517	10.3	2037.0844	2041.426	4582.2	171	3.825	30.9	1	Q.LPCMSGSRDSIPPKLIIR.S
Reverse_YGL173C	2	2	2.4%	1528	175459	7.5	U	KEM1 SGDID:S000003141, Chr VII from 180119-175533, reverse complement, Verified ORF, "5'-3' exonuclease involved in mRNA decay, evolutionarily conserved component of cytoplasmic processing (P) bodies, plays a role in microtubule-mediated processes, filamentous growth, and ribosomal RNA maturation" 
*	Jamie_Alpha_SPB_105.37722.37722.1	1.5852	0.0034	13.8	818.88	818.9083	3669.5	26	2.685	66.7	1	I.EGKRSNK.T
*	Jamie_Alpha_SPB_89.31809.31809.4	3.2438	0.1528	12.3	3512.9766	3512.2117	6658.7	1	3.618	24.1	1	Q.NMKARPAVGDIAMYFIKKPKITQFLHDIYT.C
YMR280C	2	2	2.4%	1433	160485	9.0	U	CAT8 SGDID:S000004893, Chr XIII from 831328-827027, reverse complement, Verified ORF, "Zinc cluster transcriptional activator necessary for derepression of a variety of genes under non-fermentative growth conditions, active after diauxic shift, binds carbon source responsive elements" 
*	Jamie_Alpha_SPB_32.11374.11374.2	1.8017	0.0547	11.1	2289.112	2286.2444	6835.6	30	3.649	26.2	1	R.NTSNQRSLSSGNDSKGDSSSQE.N
*	Jamie_Alpha_SPB_94.33786.33786.2	1.6867	0.1045	21.9	1443.4521	1442.488	5528.3	234	3.523	37.5	1	K.NRYNTDRSKSSGG.G
Reverse_YIL126W	2	2	2.4%	1359	156742	6.7	U	STH1 SGDID:S000001388, Chr IX from 117992-122071, Verified ORF, "ATPase component of the ATP-dependent RSC chromatin remodeling complex required for kinetochore function in chromosome segregation; required for expression of early meiotic genes; essential helicase-related protein homologous to Snf2p" 
*	Jamie_Alpha_SPB_82.29370.29370.2	1.655	0.0725	84.0	1553.5521	1550.7521	5092.3	8	3.401	45.8	1	K.DIKDFLIKEDASR.A
*	Jamie_Alpha_SPB_1.00302.00302.2	1.0787	0.0055	61.8	2315.612	2315.5015	4876.7	265	3.038	16.7	1	K.TEYIDQDRSINRFTDEIAK.I
YJL029C	2	2	2.4%	822	95449	5.6	U	VPS53 SGDID:S000003566, Chr X from 390769-388301, reverse complement, Verified ORF, "Component of the GARP (Golgi-associated retrograde protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for the recycling of proteins from endosomes to the late Golgi; required for vacuolar protein sorting" 
*	Jamie_Alpha_SPB_22.07920.07920.2	1.8192	0.1476	37.1	899.65216	899.0348	3659.3	6	3.708	71.4	1	K.NLTHSLTL.F
*	Jamie_Alpha_SPB_13.04627.04627.2	2.3635	0.0641	32.8	1422.1122	1422.6647	6151.9	136	3.418	50.0	1	T.KTKNIYDDLLAK.G
Reverse_YBL088C	2	2	2.3%	2787	321567	6.9	U	TEL1 SGDID:S000000184, Chr II from 59379-51016, reverse complement, Verified ORF, "Protein kinase, primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene" 
*	Jamie_Alpha_SPB_95.34198.34198.2	1.5345	0.1459	25.4	2633.3123	2631.9976	6994.6	126	3.927	25.0	1	R.NYHRKADKRENEPLKTNKYIL.E
*	Jamie_Alpha_SPB_35.12470.12470.4	2.7045	0.1494	82.4	4896.7363	4896.329	7037.3	96	4.01	15.1	1	R.SELLSTLGYFGSDETAKILSEKEEELSTTYNADFDANNFLFRK.W
YNL271C	2	2	2.3%	1953	219701	6.5	U	BNI1 SGDID:S000005215, Chr XIV from 135384-129523, reverse complement, Verified ORF, "Formin, nucleates the formation of linear actin filaments, involved in cell processes such as budding and mitotic spindle orientation which require the formation of polarized actin cables, functionally redundant with BNR1" 
*	Jamie_Alpha_SPB_21.07404.07404.2	1.6475	0.0907	11.0	2244.8123	2244.3423	5032.3	94	3.153	26.3	1	K.LDCTDNSIWGTGKAEKFADD.L
*	Jamie_Alpha_SPB_92.33150.33150.4	2.7083	0.1806	14.6	2791.4165	2792.217	5639.7	256	3.629	23.9	1	L.PEARKKGDLLEDEVKLTIMEFESL.M
Reverse_YDR098C-B	2	2	2.3%	1755	198594	8.4	U	YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
Reverse_YGR038C-B	2	2	2.3%	1755	198520	8.2	U	YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_74.26450.26450.4	2.9186	0.0689	61.7	2806.7766	2810.1482	4218.5	295	2.665	20.7	1	R.KQADVVNIGPNSSASHIHHASRILTR.S
	Jamie_Alpha_SPB_79.28280.28280.2	1.4883	0.1118	10.8	1618.4922	1615.8877	6087.7	297	3.471	34.6	1	F.DNPSTLMPPPRVYK.K
Reverse_YJL042W	2	2	2.3%	1398	155207	7.3	U	MHP1 SGDID:S000003578, Chr X from 361165-365361, Verified ORF, "Microtubule-associated protein involved in assembly and stabilization of microtubules; overproduction results in cell cycle arrest at G2 phase; similar to Drosophila protein MAP and to mammalian MAP4 proteins" 
*	Jamie_Alpha_SPB_29.10279.10279.2	1.8043	0.1081	33.1	1199.1122	1196.3085	4113.3	206	3.87	55.6	1	A.EPSKLTNNHR.Q
*	Jamie_Alpha_SPB_54.19198.19198.4	2.4635	0.0107	35.6	2461.6165	2457.7002	3461.9	21	2.84	23.0	1	K.DITLHSATKSVTVEEENNTVIR.K
Reverse_YBL005W	2	2	2.3%	976	112571	6.6	U	PDR3 SGDID:S000000101, Chr II from 217473-220403, Verified ORF, "Transcriptional activator of the pleiotropic drug resistance network, regulates expression of ATP-binding cassette (ABC) transporters through binding to cis-acting sites known as PDREs (PDR responsive elements)" 
*	Jamie_Alpha_SPB_36.12880.12880.2	1.6381	0.0873	11.8	1468.8722	1471.6091	5907.1	2	3.743	54.5	1	-.LFPYSTNDNWLT.H
*	Jamie_Alpha_SPB_16.05479.05479.2	2.0173	0.1107	14.9	1045.4722	1047.2395	4903.4	23	3.628	61.1	1	F.FDGVIQAIAL.E
Reverse_YOL081W	2	2	2.2%	3079	351669	7.1	U	IRA2 SGDID:S000005441, Chr XV from 171069-180308, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin" 
*	Jamie_Alpha_SPB_100.35864.35864.3	2.5871	0.2655	14.8	3297.9243	3298.7756	5787.5	292	5.447	19.2	1	N.RIISSPGGLAHRARPAVLHSLYPDSSLNKPS.S
*	Jamie_Alpha_SPB_7.02262.02262.4	1.3284	0.1645	56.2	3912.6565	3916.2876	5256.3	145	3.408	7.2	1	R.STSSGVLSLTNMPCIDTDLGLPSVPTMSSQSTSGSRSR.T
Reverse_YJL109C	2	2	2.2%	1769	200080	6.5	U	UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" 
*	Jamie_Alpha_SPB_58.20878.20878.2	1.6649	0.0552	10.1	1317.1322	1319.4695	4691.2	111	3.091	45.0	1	F.ANKSTSSRRRR.R
*	Jamie_Alpha_SPB_29.10275.10275.3	2.3125	0.0761	53.7	3174.8044	3176.5654	8516.4	138	3.491	21.3	1	R.EAAINALQEYDSNLASLVFDIMFSQKEK.P
Reverse_YDR150W	2	2	2.1%	2748	313032	5.4	U	NUM1 SGDID:S000002557, Chr IV from 755623-763869, Verified ORF, "Protein required for nuclear migration, localizes to the mother cell cortex and the bud tip; may mediate interactions of dynein and cytoplasmic microtubules with the cell cortex" 
*	Jamie_Alpha_SPB_70.24946.24946.2	1.4978	0.154	24.3	2754.612	2754.0562	8150.8	118	3.698	20.0	1	L.SATRSASGARSMFSAVIDRRSAPTNR.S
*	Jamie_Alpha_SPB_68.24500.24500.3	1.7565	0.0195	25.1	3707.8145	3706.1895	9380.6	394	2.908	16.9	1	K.EQMYDIDPSDIMQKMRDLEVESVLEYGLASAK.E
YJR066W	4	4	2.1%	2470	281138	7.2	U	TOR1 SGDID:S000003827, Chr X from 559330-566742, Verified ORF, "PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis" 
*	Jamie_Alpha_SPB_99.35571.35571.2	1.8544	0.0573	10.2	1723.4321	1724.9138	4598.3	56	3.188	33.3	1	S.RFDGVVIGSNGDVNFK.P
*	Jamie_Alpha_SPB_38.13444.13444.2	1.5422	0.0724	80.1	1855.8522	1853.1687	7876.6	429	2.981	32.1	1	K.PILEKIFRELTSDYK.E
*	Jamie_Alpha_SPB_27.09434.09434.2	1.7056	0.0887	15.3	1279.2122	1281.5406	7779.2	116	3.934	38.5	1	K.LIAPLAAGAAWGLG.E
	Jamie_Alpha_SPB_111.39768.39768.1	1.4712	0.1864	42.9	708.51	707.89124	2193.8	26	4.154	50.0	1	F.KAPPPVV.Y
YDR170C	2	2	2.1%	2009	226884	4.8	U	SEC7 SGDID:S000002577, Chr IV from 802217-796188, reverse complement, Verified ORF, "Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles" 
*	Jamie_Alpha_SPB_55.19791.19791.4	3.7653	0.2866	40.0	3676.0964	3674.0159	9818.9	97	5.025	17.6	1	L.VNPPDSLASNDQRQDAADGITPPPKQKIIDAAIDT.I
*	Jamie_Alpha_SPB_14.04945.04945.2	1.6194	0.0817	19.5	1013.65216	1013.2284	5125.8	4	3.493	71.4	1	D.RVELQIVR.A
Reverse_YMR306W	2	2	2.1%	1785	207482	8.1	U	FKS3 SGDID:S000004923, Chr XIII from 881158-886515, Verified ORF, "Protein of unknown function, has similarity to 1,3-beta-D-glucan synthase catalytic subunits Fks1p and Gsc2p" 
*	Jamie_Alpha_SPB_12.04378.04378.3	2.592	0.1802	12.5	2446.4944	2449.914	6164.6	424	4.067	25.0	1	Y.LLKIAKSYNMFGSLTRYLTQT.R
*	Jamie_Alpha_SPB_102.36478.36478.2	1.5567	0.0479	73.7	1972.8522	1972.298	7663.0	4	3.501	40.0	1	K.ENWQKIQEKISVGRKK.A
YBL100W-B	2	2	2.1%	1770	202214	7.7	U	YBL100W-B SGDID:S000002149, Chr II from 29932-31224,31226-35245, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YLR410W-B	2	2	2.1%	1770	202121	8.2	U	YLR410W-B SGDID:S000007380, Chr XII from 941480-942772,942774-946793, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_64.22788.22788.2	1.6306	0.0847	11.0	2668.892	2669.972	6412.1	4	3.897	29.5	1	L.VNDFSSQSMNPLQLDHEPVQKVR.A
	Jamie_Alpha_SPB_75.26703.26703.2	1.6737	0.1245	25.2	1803.5322	1802.9747	6244.9	91	3.671	34.6	1	C.CDMQEVRGWSCVFK.N
YPR184W	2	2	2.1%	1536	174971	5.8	U	GDB1 SGDID:S000006388, Chr XVI from 902040-906650, Verified ORF, "Glycogen debranching enzyme containing glucanotranferase and alpha-1,6-amyloglucosidase activities, required for glycogen degradation" 
*	Jamie_Alpha_SPB_24.08649.08649.2	1.6476	0.1385	33.6	1208.0521	1209.3873	5248.2	5	3.823	66.7	1	L.KSWGYPTELK.N
*	Jamie_Alpha_SPB_4.01299.01299.3	1.923	0.2378	10.3	2637.8643	2639.751	4651.6	5	4.392	16.7	1	R.DIKAHWNDESNESYSFPENIKD.I
Reverse_YDR127W	2	2	2.1%	1588	174754	6.3	U	ARO1 SGDID:S000002534, Chr IV from 704479-709245, Verified ORF, "Pentafunctional arom protein, catalyzes steps 2 through 6 in the biosynthesis of chorismate, which is a precursor to aromatic amino acids" 
*	Jamie_Alpha_SPB_66.23721.23721.2	2.0193	0.1447	38.1	1502.8922	1500.6227	6443.7	56	3.956	41.7	1	K.FEEDPFNGGQKMT.R
*	Jamie_Alpha_SPB_42.15034.15034.2	1.8479	0.1259	33.6	2349.8523	2352.723	7633.0	10	4.643	28.9	1	D.ANWICATKIVEAMGNIFERK.A
YPL167C	2	2	2.1%	1504	172956	8.6	U	REV3 SGDID:S000006088, Chr XVI from 237106-232592, reverse complement, Verified ORF, "Subunit of DNA polymerase zeta, which is involved in DNA repair; required for mutagenesis induced by DNA damage" 
*	Jamie_Alpha_SPB_30.10550.10550.2	1.8985	0.0834	23.3	1612.6721	1614.8132	4473.7	144	3.019	41.7	1	R.IQLNNQDYYMSKP.T
*	Jamie_Alpha_SPB_31.11152.11152.2	2.5213	0.0707	28.5	2147.152	2148.193	11043.8	40	3.328	30.6	1	R.VGTSATCCNCGEELTKICS.L
YDR180W	2	2	2.1%	1493	171101	6.8	U	SCC2 SGDID:S000002588, Chr IV from 821290-825771, Verified ORF, "Putative protein kinase and subunit of cohesin loading factor (Scc2p-Scc4p), a complex required for the loading of cohesin complexes onto chromosomes; involved in establishing sister chromatid cohesion during DSB repair via histone H2AX" 
*	Jamie_Alpha_SPB_19.06552.06552.3	1.935	0.0284	30.9	1726.1044	1727.915	4551.6	247	3.043	31.7	1	K.ANNEEAAIVVDGKLQR.L
*	Jamie_Alpha_SPB_92.32848.32848.2	1.7327	0.1712	12.3	1860.3522	1862.1791	5426.9	19	3.582	33.3	1	D.LGTYLLHLYGLRDDVL.L
Reverse_YLR320W	2	2	2.1%	1454	167682	6.2	U	MMS22 SGDID:S000004312, Chr XII from 771940-776304, Verified ORF, "Protein involved in resistance to ionizing radiation; acts with Mms1p in a repair pathway that may be involved in resolving replication intermediates or preventing the damage caused by blocked replication forks" 
*	Jamie_Alpha_SPB_99.35469.35469.2	2.0252	0.085	24.3	1772.5322	1773.9055	7915.6	299	3.248	32.1	1	S.LIDGAENFSDWFACK.E
*	Jamie_Alpha_SPB_13.04437.04437.3	2.5133	0.1971	16.4	1638.0543	1639.8176	3946.3	428	4.198	30.4	1	F.SSEFINEQSMAVLSP.Y
Reverse_YPR022C	2	2	2.1%	1133	130117	7.1	U	YPR022C SGDID:S000006226, Chr XVI from 607309-603908, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_78.27806.27806.2	1.6292	0.1527	12.4	1242.6122	1241.2195	3988.6	15	3.971	55.6	1	S.DDPQFCEDKS.A
*	Jamie_Alpha_SPB_92.32827.32827.2	1.9893	0.1232	12.5	1502.0521	1500.6506	5196.0	391	3.475	38.5	1	F.QFAYVVAVGGNYPD.K
Reverse_YLR106C	2	2	2.0%	4910	559315	5.0	U	MDN1 SGDID:S000004096, Chr XII from 363739-349007, reverse complement, Verified ORF, "Huge dynein-related AAA-type ATPase (midasin), forms extended pre-60S particle with the Rix1 complex (Rix1p-Ipi1p-Ipi3p), may mediate ATP-dependent remodeling of 60S subunits and subsequent export from nucleoplasm to cytoplasm" 
*	Jamie_Alpha_SPB_89.31802.31802.4	1.6555	0.0329	25.6	6284.8965	6288.2964	10352.2	42	2.587	11.0	1	K.NGTINALATILSTKGVGPSGELLIPKHVQMARVVRVLNSATTPATLNFSSSQADPFRPIK.F
*	Jamie_Alpha_SPB_38.13633.13633.4	2.0846	0.0343	33.1	3875.4565	3875.5034	8467.6	16	2.706	16.7	1	R.LSIVGSTANGGGLKKGFWESFKVIPNALDKLDELLR.S
Reverse_YIL177C	2	2	2.0%	1758	197510	7.4	U	YIL177C SGDID:S000001439, Chr IX from 6147-4987,4598-483, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
Reverse_YJL225C	2	2	2.0%	1758	197563	7.5	U	YJL225C SGDID:S000003760, Chr X from 6130-4970,4581-466, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
	Jamie_Alpha_SPB_34.11966.11966.2	2.1159	0.0925	10.7	2212.8523	2213.4067	8443.1	1	3.838	35.7	1	T.SSNISKTTTASTRVNISATTTA.S
	Jamie_Alpha_SPB_94.33806.33806.2	1.7411	0.0019	70.8	1727.3722	1729.9976	5359.6	230	3.359	38.5	1	K.EFSRKRDMAGTRFK.V
Reverse_YLR001C	2	2	2.0%	862	97618	6.4	U	YLR001C SGDID:S000003991, Chr XII from 153976-151388, reverse complement, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_17.06096.06096.2	1.4381	0.046	73.5	896.8522	894.96655	3575.1	138	2.948	57.1	1	K.LNTTCGTK.L
*	Jamie_Alpha_SPB_18.06435.06435.1	1.0795	0.0844	20.8	1004.9	1005.19977	5991.5	14	3.138	56.2	1	S.EKITSVSIK.T
Reverse_YLL040C	2	2	1.9%	3144	357850	5.6	U	VPS13 SGDID:S000003963, Chr XII from 63644-54210, reverse complement, Verified ORF, "Protein of unknown function; heterooligomeric or homooligomeric complex; peripherally associated with membranes; homologous to human COH1; involved in sporulation, vacuolar protein sorting and protein-Golgi retention" 
*	Jamie_Alpha_SPB_95.34134.34134.2	1.2177	0.1804	88.7	2507.9321	2508.8572	6523.8	142	4.006	23.7	1	K.MKWSFTQYAKSENYRLEIGR.M
*	Jamie_Alpha_SPB_75.26995.26995.4	1.9913	0.0195	27.7	4939.8164	4945.5737	8044.9	3	2.943	16.7	1	K.REFEHSFQIKDTSEEEEGNDEKETMKNLLTTVRKFILMALR.I
Reverse_YER172C	2	2	1.9%	2163	246183	5.5	U	BRR2 SGDID:S000000974, Chr V from 536016-529525, reverse complement, Verified ORF, "RNA-dependent ATPase RNA helicase involved in the facilitation and disruption of snRNA interactions, required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis" 
*	Jamie_Alpha_SPB_77.27768.27768.4	3.1808	0.1911	13.5	2988.1765	2990.4617	6092.9	400	3.948	20.8	1	E.FAMQLMSFNFSIHEVDKFSQINIEL.P
*	Jamie_Alpha_SPB_65.23240.23240.2	1.5587	0.1161	19.4	1923.6322	1923.182	8030.5	31	3.775	31.2	1	D.TIIIGEGFTDYRPRGAR.G
YJR140C	2	2	1.9%	1648	191679	6.2	U	HIR3 SGDID:S000003901, Chr X from 695611-690665, reverse complement, Verified ORF, "Transcriptional corepressor involved in the cell cycle-regulated transcription of histone genes HTA1, HTB1, HHT1, and HHT2; involved in position-dependent gene silencing and nucleosome reassembly" 
*	Jamie_Alpha_SPB_24.08494.08494.2	1.7604	0.1372	33.8	2382.7522	2384.7952	8016.6	147	3.6	26.5	1	K.KWQHRPRYRIARILFDDL.G
*	Jamie_Alpha_SPB_50.17726.17726.2	1.524	0.1429	26.1	1550.0521	1548.8662	6387.1	40	3.48	38.5	1	F.AIKDFNTTGLVIKK.L
YGL173C	2	2	1.9%	1528	175459	7.5	U	KEM1 SGDID:S000003141, Chr VII from 180119-175533, reverse complement, Verified ORF, "5'-3' exonuclease involved in mRNA decay, evolutionarily conserved component of cytoplasmic processing (P) bodies, plays a role in microtubule-mediated processes, filamentous growth, and ribosomal RNA maturation" 
*	Jamie_Alpha_SPB_19.06877.06877.2	2.5104	0.0892	10.0	1770.5322	1771.1094	6744.0	1	4.592	53.6	1	Q.WLKYVSSKFIAVSLE.S
*	Jamie_Alpha_SPB_27.09685.09685.3	2.378	0.2292	11.3	1531.1344	1533.7709	3727.8	15	4.186	34.6	1	L.RTNRGLGLDASFLL.N
YPL160W	2	2	1.9%	1090	124141	5.8	U	CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA" 
*	Jamie_Alpha_SPB_17.06170.06170.2	1.9712	0.1498	37.5	1533.7122	1535.9169	4973.8	24	3.709	46.2	1	V.TKFKAKKSKAAAKK.G
	Jamie_Alpha_SPB_20.07188.07188.1	2.246	0.1052	100.0	758.87	758.8931	4323.8	4	3.258	83.3	1	K.NLLAEAK.K
YHR099W	4	4	1.8%	3744	433182	6.5	U	TRA1 SGDID:S000001141, Chr VIII from 302764-313998, Verified ORF, "Subunit of SAGA and NuA4 histone acetyltransferase complexes; interacts with acidic activators (e.g., Gal4p) which leads to transcription activation; similar to human TRRAP, which is a cofactor for c-Myc mediated oncogenic transformation" 
*	Jamie_Alpha_SPB_65.23414.23414.2	1.9227	0.0953	25.6	1755.1921	1755.8785	6934.6	267	3.18	30.0	1	T.FYEAGKAEQGDLDSPK.E
*	Jamie_Alpha_SPB_70.24910.24910.4	3.6149	0.1988	44.4	3500.3765	3497.0872	6869.5	487	4.04	19.4	1	N.HAISHNVVRILGKLGGRNRQFLKPPTDLTEK.T
*	Jamie_Alpha_SPB_78.28048.28048.2	1.6567	0.0793	11.3	1602.1122	1599.8468	6625.7	119	3.225	40.9	1	K.WLLHGFQQYMEF.L
*	Jamie_Alpha_SPB_112.40087.40087.1	1.0754	0.1895	33.3	1056.82	1056.2474	5137.3	48	4.282	33.3	1	R.LTPNIQSLIG.D
YJR031C	2	2	1.8%	1408	159437	5.0	U	GEA1 SGDID:S000003792, Chr X from 490726-486500, reverse complement, Verified ORF, "Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs), involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; similar to but not functionally redundant with Gea2p" 
*	Jamie_Alpha_SPB_14.04914.04914.2	1.5754	0.1076	87.2	1331.9922	1331.5956	5771.8	117	3.415	50.0	1	R.KTAEVTIAGITVK.L
*	Jamie_Alpha_SPB_16.05712.05712.2	1.887	0.113	11.0	1606.7722	1607.9823	6571.9	9	3.851	45.8	1	N.VKFWNFLRILISA.K
YJL076W	2	2	1.8%	1189	128531	7.8	U	NET1 SGDID:S000003612, Chr X from 295161-298730, Verified ORF, "Core subunit of the RENT complex, which is a complex involved in nucleolar silencing and telophase exit; stimulates transcription by RNA polymerase I and regulates nucleolar structure" 
*	Jamie_Alpha_SPB_115.41145.41145.1	1.2833	0.0237	12.9	873.94	873.05817	5078.5	98	2.707	66.7	1	K.KLKMTDH.L
*	Jamie_Alpha_SPB_44.15849.15849.3	2.2023	0.1159	73.1	1492.1044	1495.7618	3871.1	17	3.872	36.5	1	K.KPSGGFASLIKDFK.K
Reverse_YLR024C	2	2	1.7%	1872	216777	6.3	U	UBR2 SGDID:S000004014, Chr XII from 193282-187664, reverse complement, Verified ORF, "Cytoplasmic ubiquitin-protein ligase (E3)" 
*	Jamie_Alpha_SPB_22.07704.07704.4	2.2101	0.0534	45.3	2614.3765	2618.8997	7155.9	19	3.011	25.4	1	R.MHDTCEGQLYGQLAISKQIHCK.Q
*	Jamie_Alpha_SPB_42.15044.15044.2	1.57	0.0897	13.8	1196.9922	1196.4843	4217.6	113	3.234	50.0	1	L.LLLLQHFRR.K
YLR024C	2	2	1.7%	1872	216777	6.3	U	UBR2 SGDID:S000004014, Chr XII from 193282-187664, reverse complement, Verified ORF, "Cytoplasmic ubiquitin-protein ligase (E3)" 
*	Jamie_Alpha_SPB_74.26497.26497.2	1.6844	0.1129	22.9	1652.2122	1651.9177	4934.6	13	3.279	42.3	1	F.FFSSILIMTDGYTR.S
*	Jamie_Alpha_SPB_56.20000.20000.2	1.3535	0.106	81.0	2096.912	2095.3135	7636.7	23	3.96	32.4	1	R.EQTTSYTPGILWPTKEDK.S
YPL231W	2	2	1.7%	1887	206945	5.4	U	FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" 
*	Jamie_Alpha_SPB_16.05676.05676.2	1.736	0.1744	37.1	1377.2922	1376.5065	7135.1	5	3.782	54.2	1	K.DSTKEVASLPNKS.T
*	Jamie_Alpha_SPB_30.10815.10815.2	4.8329	0.3774	100.0	2290.3323	2290.4888	4095.8	1	7.035	63.9	1	L.KLEAEEIPSEDQNEFLLER.T
YBR012W-B	2	2	1.7%	1756	198868	8.5	U	YBR012W-B SGDID:S000002155, Chr II from 259867-261171,261173-265138, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YGR161C-D	2	2	1.7%	1755	198558	8.5	U	YGR161C-D SGDID:S000007368, Chr VII from 823020-821716,821714-817752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YGR038C-B	2	2	1.7%	1755	198520	8.2	U	YGR038C-B SGDID:S000007408, Chr VII from 567471-566167,566165-562203, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YGR027W-B	2	2	1.7%	1755	198656	8.2	U	YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YER160C	2	2	1.7%	1755	198568	8.5	U	YER160C SGDID:S000000962, Chr V from 498119-496818,496816-492851, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YER138C	2	2	1.7%	1755	198561	8.1	U	YER138C SGDID:S000000940, Chr V from 449020-447719,447717-443752, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR365W-B	2	2	1.7%	1755	198658	8.0	U	YDR365W-B SGDID:S000007401, Chr IV from 1206987-1208291,1208293-1212255, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR316W-B	2	2	1.7%	1755	198526	8.2	U	YDR316W-B SGDID:S000007399, Chr IV from 1096059-1097363,1097365-1101327, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR261C-D	2	2	1.9%	1604	181660	7.5	U	YDR261C-D SGDID:S000007395, Chr IV from 992343-991039,991037-987528, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YDR098C-B	2	2	1.7%	1755	198594	8.4	U	YDR098C-B SGDID:S000007391, Chr IV from 651121-649817,649815-645853, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_13.04401.04401.2	5.1018	0.3174	100.0	2075.2122	2076.098	5108.7	1	10.863	65.8	1	R.AHNVSTSNNSPSTDNDSISK.S
	Jamie_Alpha_SPB_21.07386.07386.2	1.621	0.1598	29.6	1085.5922	1085.292	6297.0	173	3.561	55.6	1	T.IVRNSLASPK.S
YMR190C	2	2	1.7%	1447	163837	6.3	U	SGS1 SGDID:S000004802, Chr XIII from 645257-640914, reverse complement, Verified ORF, "Nucleolar DNA helicase of the RecQ family involved in maintenance of genome integrity, regulates chromosome synapsis and meiotic crossing over; has similarity to human BLM and WRN helicases implicated in Bloom and Werner syndromes" 
*	Jamie_Alpha_SPB_21.07528.07528.2	2.3806	0.0664	32.4	1512.0122	1511.5853	9183.1	19	3.942	45.8	1	N.NGIEYLSDSDLER.F
*	Jamie_Alpha_SPB_26.09250.09250.2	1.3871	0.1215	11.2	1190.1721	1191.416	4419.8	273	3.312	45.0	1	S.SYVKVGPNAKK.L
YLR419W	2	2	1.7%	1435	163044	9.1	U	YLR419W SGDID:S000004411, Chr XII from 958424-962731, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_82.29238.29238.2	1.6044	0.1253	23.1	1942.5521	1942.2372	9303.9	64	3.7	31.2	1	A.DFMVLPLHSALTPEDQK.R
*	Jamie_Alpha_SPB_111.39973.39973.1	1.2464	0.0764	31.2	745.54	746.98663	2967.7	11	2.984	66.7	1	S.VKAMGIK.D
Reverse_YGL195W	2	2	1.6%	2672	296696	5.3	U	GCN1 SGDID:S000003163, Chr VII from 131531-139549, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn20p; proposed to stimulate Gcn2p activation by an uncharged tRNA" 
*	Jamie_Alpha_SPB_92.32924.32924.2	1.5822	0.0906	11.1	1854.2322	1855.9739	7833.1	176	3.27	31.2	1	R.DSFMTEADGGAAIRERE.V
*	Jamie_Alpha_SPB_80.28760.28760.4	3.0845	0.1668	15.8	2584.3765	2588.8718	4547.2	15	4.159	25.7	1	V.RDLALELAGKTSEDESTGIIADVLA.N
Reverse_YPL082C	2	2	1.6%	1867	209975	6.6	U	MOT1 SGDID:S000006003, Chr XVI from 404080-398477, reverse complement, Verified ORF, "Essential abundant protein involved in regulation of transcription, removes Spt15p (TBP) from DNA via its C-terminal ATPase activity, forms a complex with TBP that binds TATA DNA with high affinity but with altered specificity" 
*	Jamie_Alpha_SPB_31.11024.11024.2	1.6827	0.138	28.5	2314.172	2311.5596	7771.5	148	4.537	28.9	1	R.HQSIVNQIPFNQDQSAKKDI.D
*	Jamie_Alpha_SPB_18.06498.06498.2	1.7774	0.0116	78.2	973.77216	975.19434	4253.0	19	2.906	68.8	1	K.ASNIAMLVR.H
Reverse_YML072C	2	2	1.6%	1545	171075	7.1	U	TCB3 SGDID:S000004537, Chr XIII from 129367-124730, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; localized to the bud; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; mRNA is targeted to the bud via the mRNA transport system involving She2p; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" 
*	Jamie_Alpha_SPB_96.34369.34369.2	1.6574	0.1743	14.6	1558.5521	1560.895	6028.0	192	3.701	38.5	1	F.LMPGINSNIINKVF.S
*	Jamie_Alpha_SPB_7.02181.02181.2	1.7979	0.0557	11.6	1043.0122	1042.2206	5115.1	283	3.544	50.0	1	L.KGLDDLVGPK.T
Reverse_YGR296W	2	2	1.5%	1859	211113	7.2	U	YRF1-3 SGDID:S000003528, Chr VII from 1084870-1084888,1085037-1090597, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" 
Reverse_YPR202W	2	2	11.8%	238	27858	7.1	U	YPR202W SGDID:S000006406, Chr XVI from 943028-943046,943195-943892, Uncharacterized ORF, "similar to other subtelomerically-encoded proteins" 
Reverse_YPL283C	2	2	1.5%	1859	211113	7.2	U	YRF1-7 SGDID:S000006204, Chr XVI from 6007-5989,5840-280, reverse complement, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" 
Reverse_YNL339C	2	2	1.5%	1859	211097	7.2	U	YRF1-6 SGDID:S000005283, Chr XIV from 6098-6080,5931-371, reverse complement, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p" 
	Jamie_Alpha_SPB_94.33806.33806.2	1.7411	0.0019	70.8	1727.3722	1729.9976	5359.6	230	3.359	38.5	1	K.EFSRKRDMAGTRFK.V
	Jamie_Alpha_SPB_26.09297.09297.2	2.2429	0.0843	31.2	1576.0122	1574.8168	7446.6	17	3.656	42.3	1	K.KVLFGDIYVFSQGT.E
YHL009W-B	2	2	1.5%	1802	207969	8.4	U	YHL009W-B SGDID:S000007372, Chr VIII from 85905-86990,86992-91314, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
YJL113W	2	2	1.5%	1803	207708	8.0	U	YJL113W SGDID:S000003649, Chr X from 197834-198919,198921-203246, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_36.12817.12817.2	1.7732	0.0914	20.5	2278.2322	2278.7185	5924.3	2	3.502	34.2	1	K.TKIVNGVIHVKMNELIERPS.D
	Jamie_Alpha_SPB_15.05145.05145.1	1.4904	0.0804	95.8	946.67	947.03845	5267.6	35	3.523	66.7	1	K.YDEKVHR.I
Reverse_YBR012W-B	2	2	1.5%	1756	198868	8.5	U	YBR012W-B SGDID:S000002155, Chr II from 259867-261171,261173-265138, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
Reverse_YDR210C-D	2	2	1.5%	1755	198838	8.4	U	YDR210C-D SGDID:S000007410, Chr IV from 883922-882618,882616-878654, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 
	Jamie_Alpha_SPB_90.32366.32366.2	1.7582	0.1527	14.2	1275.8522	1275.3789	4701.6	2	3.789	54.5	1	P.VDLRHMGGSDTS.E
	Jamie_Alpha_SPB_79.28280.28280.2	1.4883	0.1118	10.8	1618.4922	1615.8877	6087.7	297	3.471	34.6	1	F.DNPSTLMPPPRVYK.K
Reverse_YJR031C	2	2	1.5%	1408	159437	5.0	U	GEA1 SGDID:S000003792, Chr X from 490726-486500, reverse complement, Verified ORF, "Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs), involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; similar to but not functionally redundant with Gea2p" 
*	Jamie_Alpha_SPB_48.17005.17005.2	1.3954	0.1954	12.8	1038.4321	1038.2042	3421.3	51	3.404	50.0	1	A.KASSQALTTM.E
*	Jamie_Alpha_SPB_20.07158.07158.2	1.6659	0.062	11.1	1158.1522	1159.3713	5761.4	15	3.181	55.0	1	T.IGAITVEATKR.L
YBL088C	2	2	1.4%	2787	321568	6.9	U	TEL1 SGDID:S000000184, Chr II from 59379-51016, reverse complement, Verified ORF, "Protein kinase, primarily involved in telomere length regulation; contributes to cell cycle checkpoint control in response to DNA damage; functionally redundant with Mec1p; homolog of human ataxia telangiectasia (ATM) gene" 
*	Jamie_Alpha_SPB_18.06346.06346.4	2.4827	0.0781	56.4	2830.5764	2829.3525	7777.1	78	3.303	22.7	1	K.SLLDAVSVHLSFALDALIKSDPFKLK.F
*	Jamie_Alpha_SPB_63.22394.22394.2	2.0085	0.0544	21.2	1486.2322	1488.7264	6276.0	49	3.29	45.5	1	K.WNLELGDWKLLT.P
YKL010C	2	2	1.2%	1483	167842	4.9	U	UFD4 SGDID:S000001493, Chr XI from 425518-421067, reverse complement, Verified ORF, "Ubiquitin-protein ligase (E3) that interacts with Rpt4p and Rpt6p, two subunits of the 19S particle of the 26S proteasome; cytoplasmic E3 involved in the degradation of ubiquitin fusion proteins" 
*	Jamie_Alpha_SPB_59.21159.21159.2	1.8487	0.1213	10.0	1719.6122	1720.92	5749.2	26	3.31	36.7	1	L.HQIEGVVSILENPSTP.D
*	Jamie_Alpha_SPB_16.05640.05640.2	1.6591	0.0745	19.3	889.03217	887.9219	2443.3	273	2.986	57.1	1	L.ENPSTPDK.T
YLR087C	2	2	1.0%	2958	338258	5.9	U	CSF1 SGDID:S000004077, Chr XII from 315732-306856, reverse complement, Verified ORF, "Protein required for fermentation at low temperature" 
*	Jamie_Alpha_SPB_25.08937.08937.2	1.6168	0.1756	12.3	2306.0322	2305.5122	7730.5	2	3.785	34.2	1	I.NLGDLCIDSDIEFIKGFFNS.F
*	Jamie_Alpha_SPB_45.16087.16087.2	1.63	0.1471	33.3	1310.7522	1310.452	5585.7	1	3.463	70.0	1	K.HIFSREVSTSF.E
YLR422W	2	2	0.9%	1932	221562	7.8	U	YLR422W SGDID:S000004414, Chr XII from 965893-971691, Uncharacterized ORF, "Hypothetical protein" 
*	Jamie_Alpha_SPB_14.04788.04788.1	1.5394	0.0043	10.4	905.44	905.9805	6772.9	11	3.412	71.4	1	M.NLTTEAEK.I
*	Jamie_Alpha_SPB_35.12435.12435.2	1.9059	0.0437	14.1	1052.7722	1050.1594	4092.4	24	3.352	55.6	1	K.NPNKKASFSG.R
YKR054C	2	2	0.8%	4092	471351	6.3	U	DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" 
*	Jamie_Alpha_SPB_51.18295.18295.2	1.5221	0.0985	11.7	2679.1921	2680.9312	9725.2	32	3.791	25.0	1	K.YNQFLSSIPIDEVRQASNLEDLQ.E
*	Jamie_Alpha_SPB_107.38474.38474.1	1.3708	0.0313	14.4	832.64	834.0185	4013.4	151	3.005	57.1	1	K.EAVLTMIG.V
	Proteins	Peptide IDs	Spectra
Unfiltered	11208	81080	85795
Filtered	771	2102	2181
Forward matches	443	1368	1446
Decoy matches	328	734	735
Forward FP rate	74.04	53.65	50.83

Classification	Nonredundant Proteins	Redundant Proteins
Unclassified	0	0