DTASelect v2.0.16 /data/1/catclw/Projects/SPB/Phospho-Holinger /garibaldi/people-b/applications/yates/dbase/SGD_S-cerevisiae_na_12-16-2005_con_reversed.fasta SEQUEST 3.0 in SQT format. -p 1 --fp 0.1 --modstat --sp --noxc --nodcn --extra -e con true Use criteria 0.0 Minimum peptide confidence 0.1 Peptide false positive rate 0.0 Minimum protein confidence 1.0 Protein false positive rate 1 Minimum charge state 16 Maximum charge state 0.0 Minimum ion proportion 1000 Maximum Sp rank -1.0 Minimum Sp score Include Modified peptide inclusion Any Tryptic status requirement false Multiple, ambiguous IDs allowed Ignore Peptide validation handling XCorr Purge duplicate peptides by protein false Include only loci with unique peptide true Remove subset proteins Ignore Locus validation handling con Exclude protein names matching 0 Minimum modified peptides per locus 1000 Minimum redundancy for low coverage loci 1 Minimum peptides per locus Locus Sequence Count Spectrum Count Sequence Coverage Length MolWt pI Validation Status Descriptive Name Unique FileName XCorr DeltCN Conf% M+H+ CalcM+H+ TotalIntensity SpR ZScore IonProportion Redundancy Sequence YKL042W 59 87 74.9% 363 42271 7.9 U SPC42 SGDID:S000001525, Chr XI from 358119-359210, Verified ORF, "Central plaque component of spindle pole body (SPB); involved in SPB duplication, may facilitate attachment of the SPB to the nuclear membrane" * 122805-Holinger-03_itms_13.08636.08636.1 2.3232 0.2387 98.1 1668.7871 1669.7876 5702.8 3 5.451 41.7 1 K.SSRLYDDYYNIPY.Q * 122805-Holinger-04_itms_12.08579.08579.2 3.3773 0.2813 98.9 1959.915 1961.0942 3241.4 29 4.613 46.4 2 K.SSRLYDDYYNIPYQY.S * 122805-Holinger-03_itms_13.08662.08662.2 2.3033 0.2279 99.0 1581.754 1582.7094 2408.5 433 4.622 50.0 1 S.SRLYDDYYNIPY.Q * 122805-Holinger-03_itms_13.08746.08746.2 3.0598 0.0954 98.3 1872.8842 1874.016 3017.2 1 4.407 65.4 1 S.SRLYDDYYNIPYQY.S * 122805-Holinger-02_itms_12.08804.08804.1 2.6693 0.2207 97.1 1494.7148 1495.6311 4821.2 42 5.013 50.0 2 S.RLYDDYYNIPY.Q * 122805-Holinger-03_itms_8.06040.06040.2 3.6508 0.2421 99.5 2113.9817 2115.2415 5347.3 21 5.007 47.1 1 Y.QYSNPTPMNRDYNDVGSR.I * 122805-Holinger-03_itms_7.05583.05583.2 3.5949 0.2426 99.5 1822.8435 1823.9347 4670.6 3 5.043 53.3 1 Y.SNPTPMNRDYNDVGSR.I * 122805-Holinger-02_itms_5.04572.04572.2 1.663 0.1422 90.3 895.40625 895.9041 2867.7 41 3.744 66.7 1 M.NRDYNDV.G * 122805-Holinger-02_itms_5.04487.04487.2 3.499 0.2856 99.4 1195.5657 1196.2217 4080.0 7 5.0 77.8 2 M.NRDYNDVGSR.I * 122805-Holinger-02_itms_5.04492.04492.1 2.619 0.2512 98.5 1195.5684 1196.2217 2912.2 4 5.305 66.7 1 M.NRDYNDVGSR.I * 122805-Holinger-02_itms_6.05065.05065.2 3.1351 0.2099 100.0 1422.7003 1423.485 4649.5 2 5.66 63.6 1 M.NRDYNDVGSRIN.A * 122805-Holinger-02_itms_8.06301.06301.2 2.8842 0.198 100.0 998.5686 999.15216 2334.8 60 6.704 87.5 1 R.INADKLVPE.E * 122805-Holinger-03_itms_9.06537.06537.3 5.49 0.2803 100.0 1688.9188 1689.9089 8698.6 4 6.233 51.9 2 R.INADKLVPEEYKRN.T * 122805-Holinger-03_itms_9.06511.06511.2 3.9149 0.2392 98.6 1688.9263 1689.9089 5128.2 2 4.472 73.1 2 R.INADKLVPEEYKRN.T * 122805-Holinger-03_itms_9.06728.06728.3 3.2337 0.1366 96.0 1789.9744 1791.014 6434.4 30 4.12 37.5 1 R.INADKLVPEEYKRNT.E * 122805-Holinger-03_itms_9.06740.06740.2 3.3992 0.1895 99.0 1789.977 1791.014 4781.3 1 4.639 64.3 1 R.INADKLVPEEYKRNT.E * 122805-Holinger-03_itms_12.08348.08348.3 3.566 0.1664 96.8 2293.2212 2294.5693 6507.4 23 4.22 29.2 1 R.INADKLVPEEYKRNTEFIN.K * 122805-Holinger-04_itms_11.08185.08185.3 5.3433 0.3364 100.0 2421.316 2422.7434 8614.7 1 6.102 36.8 6 R.INADKLVPEEYKRNTEFINK.A * 122805-Holinger-03_itms_7.05477.05477.3 4.1409 0.2793 100.0 1347.7489 1348.5419 4934.2 1 5.854 60.0 1 N.ADKLVPEEYKR.N * 122805-Holinger-03_itms_7.05454.05454.3 3.6657 0.2353 100.0 1461.7946 1462.6458 6845.7 19 4.976 50.0 1 N.ADKLVPEEYKRN.T * 122805-Holinger-03_itms_7.05531.05531.3 2.6146 0.2044 99.2 1562.8427 1563.7507 6282.6 181 4.347 37.5 1 N.ADKLVPEEYKRNT.E * 122805-Holinger-03_itms_7.05506.05506.2 2.6878 0.0471 90.5 1562.8463 1563.7507 3865.2 1 3.752 70.8 1 N.ADKLVPEEYKRNT.E * 122805-Holinger-03_itms_10.07088.07088.2 4.6193 0.2957 100.0 2194.19 2195.4802 6840.6 1 5.634 64.7 3 N.ADKLVPEEYKRNTEFINK.A * 122805-Holinger-04_itms_6.05162.05162.2 2.9093 0.1552 99.1 1161.68 1162.3745 3863.1 4 4.657 81.2 3 D.KLVPEEYKR.N * 122805-Holinger-05_itms_5.05049.05049.3 2.1753 0.0931 90.1 1274.9357 1276.4783 4588.4 17 3.844 47.2 1 D.KLVPEEYKRN.T * 122805-Holinger-03_itms_7.05594.05594.2 3.4789 0.2467 98.7 1318.735 1319.5033 6509.5 8 4.579 70.0 1 K.AVQQNKELNFK.L * 122805-Holinger-03_itms_7.05513.05513.2 3.2996 0.1239 97.0 1247.6952 1248.4246 4812.2 458 4.255 72.2 1 A.VQQNKELNFK.L * 122805-Holinger-04_itms_10.07442.07442.2 2.9508 0.1029 95.4 1363.7285 1361.584 7180.1 38 4.078 70.0 1 A.VQQNKELNFKL.R * 122805-Holinger-04_itms_9.06831.06831.2 3.4238 0.0574 99.3 1433.7999 1434.6353 7724.3 3 4.883 75.0 1 L.REKQNEIFELK.K * 122805-Holinger-05_itms_8.06842.06842.2 2.3613 0.1963 99.3 1351.783 1352.5736 3774.2 17 4.753 60.0 5 L.RSKLEKYVDIT.K * 122805-Holinger-03_itms_8.05899.05899.2 3.8766 0.1125 94.2 1345.8649 1343.523 4910.6 1 3.965 90.0 1 T.KKLEDQNLNLQ.I * 122805-Holinger-05_itms_7.06338.06338.2 5.0588 0.2177 99.3 1583.9421 1584.8564 8474.2 1 4.751 91.7 1 T.KKLEDQNLNLQIK.I * 122805-Holinger-04_itms_11.08082.08082.2 3.6086 0.2122 99.4 1573.9087 1574.815 6197.8 1 4.838 57.7 1 Q.IKISDLEKKLSDAN.S * 122805-Holinger-02_itms_7.05963.05963.2 2.8347 0.1393 99.1 1332.7268 1333.4814 6405.0 1 4.659 72.7 1 K.ISDLEKKLSDAN.S * 122805-Holinger-02_itms_6.05209.05209.1 1.8855 0.2975 98.5 1132.6051 1133.2438 3491.1 8 5.305 55.6 1 S.DLEKKLSDAN.S * 122805-Holinger-02_itms_10.07627.07627.3 5.1313 0.3603 100.0 2517.2227 2518.7546 8665.3 1 6.163 40.5 2 K.VKDPMVDDDPVSENYDQINVPK.H * 122805-Holinger-02_itms_10.07615.07615.2 4.8694 0.2853 100.0 2517.2249 2518.7546 5943.9 1 6.033 61.9 1 K.VKDPMVDDDPVSENYDQINVPK.H * 122805-Holinger-02_itms_7.05987.05987.2 3.2275 0.271 99.8 1090.5876 1091.209 4953.5 1 5.381 87.5 1 E.NYDQINVPK.H * 122805-Holinger-05_itms_6.05594.05594.2 4.4638 0.3892 100.0 1838.9503 1840.0055 5977.4 1 6.939 63.3 2 E.NYDQINVPKHRAPDAT.G * 122805-Holinger-02_itms_7.05765.05765.2 2.5959 0.2113 98.7 976.525 977.1051 6201.4 6 4.524 85.7 1 N.YDQINVPK.H * 122805-Holinger-05_itms_5.05422.05422.2 3.1435 0.3814 100.0 1724.9047 1725.9016 6633.7 1 6.381 60.7 1 N.YDQINVPKHRAPDAT.G * 122805-Holinger-03_itms_5.04428.04428.2 4.1083 0.1688 100.0 1591.8287 1592.7062 4889.7 1 5.77 80.8 2 T.NKVSNTSDQDSRLK.A * 122805-Holinger-03_itms_12.08105.08105.3 2.9367 0.1728 100.0 1631.8971 1632.8142 6616.0 105 5.352 34.6 1 T.SDQDSRLKAIERTL.S * 122805-Holinger-03_itms_11.07798.07798.2 3.8634 0.219 99.3 1884.9237 1886.0465 5385.7 44 4.71 50.0 2 M.RSEDGNNDRMSPLPSPL.N * 122805-Holinger-02_itms_11.08003.08003.2 3.0553 0.1855 99.3 1731.8922 1729.859 5318.4 16 4.732 43.3 2 R.SEDGNNDRMSPLPSPL.N * 122805-Holinger-02_itms_11.08100.08100.2 2.6611 0.1266 95.5 1641.7828 1642.7809 5618.4 4 4.084 46.4 1 S.EDGNNDRMSPLPSPL.N * 122805-Holinger-04_itms_10.07467.07467.2 2.8768 0.1196 98.7 1281.7495 1282.4856 3961.4 32 4.5 65.0 1 L.NTILPINNRLN.F * 122805-Holinger-04_itms_7.05636.05636.2 2.6148 0.2176 98.7 1031.5814 1032.1875 5405.1 1 4.571 85.7 1 R.LNFQEPKR.Y * 122805-Holinger-05_itms_7.06213.06213.2 3.2849 0.1179 99.0 1506.7979 1507.6891 6702.2 1 4.635 72.7 1 R.LNFQEPKRYNPT.V * 122805-Holinger-04_itms_6.05526.05526.2 2.9951 0.0342 94.2 1393.7117 1394.5297 5236.8 17 3.957 65.0 2 L.NFQEPKRYNPT.V * 122805-Holinger-04_itms_6.05539.05539.1 2.3985 0.1134 90.1 1393.7148 1394.5297 3268.1 6 4.723 60.0 1 L.NFQEPKRYNPT.V * 122805-Holinger-04_itms_6.05380.05380.2 2.5969 0.1817 98.2 1279.6669 1280.4258 6041.8 64 4.402 61.1 1 N.FQEPKRYNPT.V * 122805-Holinger-02_itms_8.06271.06271.1 2.3646 0.1853 97.7 1232.6051 1233.3789 7601.1 13 5.135 65.0 1 T.VKVNPSDDDIM.M * 122805-Holinger-04_itms_16.11226.11226.3 3.4643 0.1929 97.1 1784.0625 1785.0941 7601.4 101 4.238 40.4 1 K.RVEEEIEELKRKIL.V * 122805-Holinger-02_itms_7.05588.05588.2 3.4573 0.254 100.0 1700.8297 1701.8486 6286.2 1 5.747 71.4 2 M.MDGDDNIKLDNVSKH.N * 122805-Holinger-02_itms_5.04448.04448.2 2.746 0.2681 94.1 1411.508 1412.2892 4721.3 5 5.852 59.1 1 Q.SSRDYSPS*SDAC.L * 122805-Holinger-02_itms_6.05415.05415.2 4.0279 0.2222 99.5 1384.6274 1385.4364 7526.3 1 5.095 90.0 1 C.LECSNDLYEKN.R * 122805-Holinger-04_itms_5.04434.04434.2 2.9174 0.191 99.5 1304.6497 1305.4485 6308.8 5 5.104 65.0 1 N.RVKPENNMSET.F * 122805-Holinger-04_itms_7.06018.06018.2 2.7786 0.259 99.8 1451.7202 1452.625 6286.6 6 5.217 59.1 4 N.RVKPENNMSETF.A YOR257W 29 41 72.0% 161 18751 4.6 U CDC31 SGDID:S000005783, Chr XV from 811006-811491, Verified ORF, "Component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; interacts with Kar1p" * 122805-Holinger-02_itms_11.08174.08174.2 3.6553 0.3071 99.8 1977.0134 1978.1632 6224.1 47 5.339 40.6 1 Q.SGPLNSELLEEQKQEIY.E * 122805-Holinger-03_itms_15.10045.10045.2 2.6117 0.1264 97.6 1688.7229 1688.8085 8092.8 1 4.322 61.5 2 F.SLFDMNNDGFLDYH.E * 122805-Holinger-03_itms_16.10474.10474.2 4.1559 0.3669 100.0 1929.8717 1931.0834 8614.2 1 6.475 60.0 1 F.SLFDMNNDGFLDYHEL.K * 122805-Holinger-02_itms_9.07043.07043.2 2.4834 0.1963 99.8 980.4267 981.0092 5683.4 1 5.402 92.9 1 N.NDGFLDYH.E * 122805-Holinger-02_itms_12.08742.08742.1 2.4562 0.2617 97.1 1222.558 1223.2842 3103.3 4 5.008 61.1 1 N.NDGFLDYHEL.K * 122805-Holinger-02_itms_12.08728.08728.2 3.3855 0.2047 100.0 1222.5635 1223.2842 6762.0 1 5.886 88.9 1 N.NDGFLDYHEL.K * 122805-Holinger-02_itms_12.08764.08764.2 1.793 0.1596 92.8 993.4876 994.0917 6652.3 16 3.903 78.6 1 D.GFLDYHEL.K * 122805-Holinger-04_itms_11.08012.08012.2 2.1612 0.0521 94.3 1201.7162 1202.4392 7487.6 237 3.974 61.1 1 L.GFELPKREIL.D * 122805-Holinger-03_itms_21.13270.13270.2 2.7713 0.1481 90.9 1429.8328 1430.6873 6721.6 122 3.784 59.1 1 L.GFELPKREILDL.I * 122805-Holinger-05_itms_14.10220.10220.2 2.8083 0.118 93.7 1950.0616 1951.2267 7038.9 336 3.944 36.7 1 L.GFELPKREILDLIDEY.D * 122805-Holinger-02_itms_10.07355.07355.2 3.2576 0.2228 99.2 1311.5923 1312.3324 6799.6 1 4.676 80.0 1 L.DLIDEYDSEGR.H * 122805-Holinger-03_itms_11.07999.07999.2 4.701 0.3503 100.0 1561.7393 1562.6329 7879.6 1 6.621 83.3 4 L.DLIDEYDSEGRHL.M * 122805-Holinger-02_itms_6.05432.05432.2 2.342 0.18 98.6 1333.6245 1334.3849 6350.0 3 4.461 60.0 1 L.IDEYDSEGRHL.M * 122805-Holinger-03_itms_14.09176.09176.2 2.6242 0.1996 96.8 1193.5774 1194.3876 7258.5 7 4.196 81.2 1 L.MKYDDFYIV.M * 122805-Holinger-03_itms_14.09697.09697.2 3.1014 0.0962 95.4 1324.6191 1325.5801 5126.8 10 4.078 72.2 3 L.MKYDDFYIVM.G * 122805-Holinger-05_itms_9.07392.07392.2 2.7232 0.0425 95.3 1653.9854 1654.9475 5568.1 10 4.048 57.7 1 M.GEKILKRDPLDEIK.R * 122805-Holinger-05_itms_7.06509.06509.2 3.0764 0.1804 97.9 1339.8181 1340.606 5579.6 21 4.346 70.0 1 K.ILKRDPLDEIK.R * 122805-Holinger-03_itms_8.06143.06143.2 3.2542 0.204 98.6 1141.6509 1142.3005 5720.6 1 4.449 87.5 2 K.RDPLDEIKR.A * 122805-Holinger-04_itms_21.13655.13655.3 3.0684 0.2641 99.4 1359.9138 1360.5559 7272.9 11 4.734 50.0 2 K.RDPLDEIKRAF.Q * 122805-Holinger-03_itms_10.07262.07262.2 1.8753 0.1427 98.3 1088.6284 1089.2798 5860.8 4 4.404 75.0 1 D.PLDEIKRAF.Q * 122805-Holinger-03_itms_11.07921.07921.2 3.2117 0.2843 99.5 1522.7422 1523.6421 6427.4 1 5.024 66.7 1 A.FQLFDDDHTGKIS.I * 122805-Holinger-03_itms_9.06474.06474.2 2.4619 0.122 97.9 1375.6715 1376.4656 3416.3 25 4.353 63.6 1 F.QLFDDDHTGKIS.I * 122805-Holinger-02_itms_7.05828.05828.2 2.8238 0.2478 99.5 1247.6125 1248.3348 5804.1 3 5.029 70.0 1 Q.LFDDDHTGKIS.I * 122805-Holinger-03_itms_6.05007.05007.1 2.2728 0.2719 100.0 1134.5267 1135.1754 5184.1 8 6.434 55.6 1 L.FDDDHTGKIS.I * 122805-Holinger-03_itms_6.04991.04991.2 3.3405 0.3474 100.0 1134.5277 1135.1754 4205.0 1 6.922 83.3 1 L.FDDDHTGKIS.I * 122805-Holinger-02_itms_7.05695.05695.2 2.1344 0.2058 95.5 964.4561 965.06616 6989.6 2 4.086 78.6 1 L.TDEELRAM.I * 122805-Holinger-02_itms_11.08008.08008.1 1.9037 0.2795 97.7 1052.4606 1053.0674 5369.3 1 5.148 68.8 1 M.IEEFDLDGD.G * 122805-Holinger-02_itms_12.08469.08469.2 4.1692 0.297 100.0 1465.6581 1466.498 5362.3 1 6.163 83.3 5 M.IEEFDLDGDGEIN.E * 122805-Holinger-04_itms_11.08332.08332.1 2.7856 0.0925 90.3 1465.6602 1466.498 6019.4 9 4.743 54.2 1 M.IEEFDLDGDGEIN.E YPL124W 29 50 60.1% 253 29280 9.5 U SPC29 SGDID:S000006045, Chr XVI from 316754-317515, Verified ORF, "Inner plaque spindle pole body (SPB) component, links the central plaque component Spc42p to the inner plaque component Spc110p; required for SPB duplication" * 122805-Holinger-03_itms_7.05236.05236.2 2.9501 0.1517 99.4 1136.5886 1137.2377 4910.0 1 4.87 87.5 1 K.KFQDDTLNR.V * 122805-Holinger-05_itms_4.04211.04211.2 3.1632 0.1203 94.7 1238.7098 1239.4172 5884.7 1 4.006 83.3 1 R.VRKEHEEALK.K * 122805-Holinger-04_itms_6.05186.05186.2 2.9133 0.1381 91.7 1224.7157 1225.4307 6372.9 24 3.82 72.2 1 R.KEHEEALKKL.R * 122805-Holinger-03_itms_7.05272.05272.2 2.2321 0.14 95.1 1097.6233 1097.2566 2633.5 446 4.04 75.0 1 K.EHEEALKKL.R * 122805-Holinger-02_itms_6.05123.05123.1 1.8434 0.2304 92.4 1095.5267 1096.1417 1585.3 7 4.851 56.2 1 K.LREENFSSN.T * 122805-Holinger-02_itms_6.05129.05129.2 2.3867 0.1171 94.5 1095.5365 1096.1417 5142.9 1 3.989 81.2 1 K.LREENFSSN.T * 122805-Holinger-03_itms_7.05505.05505.2 4.0518 0.2371 95.7 1791.7883 1792.7704 3592.0 1 5.625 78.6 1 L.REENFSSNT*SELGNK.K * 122805-Holinger-05_itms_6.05659.05659.2 2.4491 0.1754 93.4 1170.7052 1171.3823 5592.9 17 3.933 72.2 1 K.VKSPLDDKLR.R * 122805-Holinger-03_itms_7.05705.05705.2 2.6917 0.1283 98.1 943.5367 944.07574 5071.8 1 4.385 92.9 3 K.SPLDDKLR.R * 122805-Holinger-05_itms_5.05371.05371.2 2.426 0.1889 95.9 1099.642 1100.2632 3759.4 199 4.121 62.5 1 K.SPLDDKLRR.Q * 122805-Holinger-04_itms_10.07370.07370.2 2.7477 0.1621 98.3 1311.6895 1312.4679 6419.3 13 4.406 68.2 2 R.EGNTRLPPPPFS.S * 122805-Holinger-05_itms_10.08085.08085.2 3.8972 0.3147 100.0 1561.793 1562.722 4525.9 1 5.79 65.4 12 R.EGNTRLPPPPFSSY.G * 122805-Holinger-03_itms_16.10525.10525.2 2.1393 0.1406 93.0 1004.5275 1005.1583 3014.1 128 3.911 68.8 1 R.LPPPPFSSY.G * 122805-Holinger-03_itms_14.09350.09350.1 1.9265 0.2391 93.3 1004.52765 1005.1583 2096.7 5 4.9 56.2 3 R.LPPPPFSSY.G * 122805-Holinger-04_itms_6.05314.05314.2 2.8158 0.3034 92.3 1503.7115 1504.5535 4254.3 1 5.504 66.7 1 R.TSS*PVRTDKFASQ.N * 122805-Holinger-02_itms_8.06456.06456.2 3.3419 0.1683 99.4 1342.7554 1343.523 6755.9 1 4.842 80.0 2 Q.NVIDDQRLEIK.Y * 122805-Holinger-02_itms_7.05934.05934.2 2.6273 0.1548 95.3 1228.7122 1229.4191 5669.4 1 4.068 77.8 1 N.VIDDQRLEIK.Y * 122805-Holinger-02_itms_9.07062.07062.2 2.1076 0.0427 94.9 955.541 956.1295 3530.6 2 4.027 91.7 1 K.YLERIVY.D * 122805-Holinger-02_itms_9.06805.06805.2 2.9873 0.0697 97.9 1198.6294 1199.3489 3979.3 1 4.365 87.5 3 K.YLERIVYDQ.G * 122805-Holinger-02_itms_9.06799.06799.1 2.0236 0.263 97.4 1198.6306 1199.3489 2299.9 14 5.238 62.5 1 K.YLERIVYDQ.G * 122805-Holinger-03_itms_11.07799.07799.2 3.2581 0.1656 95.9 1749.9487 1750.9493 8264.7 4 4.123 46.7 1 F.ILNSISDRGDKNFASL.E * 122805-Holinger-03_itms_10.06913.06913.2 3.2841 0.1959 98.7 1523.7715 1524.6304 6268.1 206 4.579 50.0 2 L.NSISDRGDKNFASL.E * 122805-Holinger-03_itms_7.05281.05281.2 2.5469 0.3013 99.6 1209.6079 1210.289 4599.5 1 5.153 75.0 1 N.SISDRGDKNFA.S * 122805-Holinger-03_itms_9.06877.06877.1 2.794 0.1968 90.3 1409.7296 1410.5266 4699.4 1 4.736 58.3 1 N.SISDRGDKNFASL.E * 122805-Holinger-04_itms_9.06717.06717.2 2.4005 0.2276 97.7 1251.5964 1252.3286 6135.1 16 4.337 70.0 1 L.EHSRSFSGFPT.N * 122805-Holinger-03_itms_5.04628.04628.2 2.3095 0.0658 97.0 2056.0159 2057.144 5642.8 1 4.243 55.9 1 S.SDNINKEGAREDRSSQIH.I * 122805-Holinger-03_itms_5.04623.04623.3 3.7014 0.2156 99.5 2057.0173 2057.144 6639.8 1 4.648 47.1 2 S.SDNINKEGAREDRSSQIH.I * 122805-Holinger-02_itms_6.05345.05345.3 2.9595 0.2055 98.1 2298.141 2299.419 6250.4 6 4.285 32.9 1 S.SDNINKEGAREDRSSQIHIE.N * 122805-Holinger-03_itms_15.09823.09823.2 4.0125 0.2829 92.6 1846.9553 1848.0172 6810.3 1 5.482 67.9 1 Q.IHIENES*TEDILKIL.S YDR356W 131 350 55.5% 944 111782 7.1 U SPC110 SGDID:S000002764, Chr IV from 1186098-1188932, Verified ORF, "Inner plaque spindle pole body (SPB) component, ortholog of human kendrin; involved in connecting nuclear microtubules to SPB; interacts with Tub4p-complex and calmodulin; phosphorylated by Mps1p in cell cycle-dependent manner" * 122805-Holinger-03_itms_6.04775.04775.2 3.9169 0.3558 100.0 1681.8447 1682.7875 5136.4 1 6.815 70.0 3 T.KVPNANNGDENEGPVK.K * 122805-Holinger-04_itms_5.04484.04484.2 4.4864 0.347 100.0 1809.9436 1810.9615 4451.6 1 7.495 62.5 2 T.KVPNANNGDENEGPVKK.R * 122805-Holinger-05_itms_4.04419.04419.3 2.7629 0.1476 94.5 1809.9442 1810.9615 3256.7 3 4.093 39.1 1 T.KVPNANNGDENEGPVKK.R * 122805-Holinger-03_itms_5.04599.04599.2 5.1343 0.4455 100.0 1681.8438 1682.7875 5946.0 1 7.598 73.3 1 K.VPNANNGDENEGPVKK.R * 122805-Holinger-04_itms_12.08915.08915.2 3.4451 0.3255 95.0 1542.6414 1543.4979 7534.8 1 5.641 77.3 1 R.S*IDDTIDS*TRLF.S * 122805-Holinger-05_itms_12.09319.09319.2 3.5712 0.3175 95.2 2175.9526 2177.2024 3187.3 1 5.638 56.2 1 T.RLFS*EAS*QFDDSFPEIK.A * 122805-Holinger-02_itms_11.07872.07872.1 2.8608 0.3251 100.0 1312.6349 1313.4064 6860.7 5 6.335 50.0 1 A.SQFDDSFPEIK.A * 122805-Holinger-02_itms_10.07840.07840.2 3.3549 0.4164 100.0 1315.7717 1313.4064 5145.6 1 6.233 85.0 1 A.SQFDDSFPEIK.A * 122805-Holinger-03_itms_20.12857.12857.2 2.7896 0.2583 99.3 1824.1984 1827.1462 6669.7 6 4.786 53.3 1 R.NLIDDLKKDVPMSQPL.K * 122805-Holinger-04_itms_13.09050.09050.3 3.6722 0.1901 99.6 2211.212 2212.5664 8999.1 130 4.444 30.6 1 R.NLIDDLKKDVPMSQPLKEQ.E * 122805-Holinger-04_itms_7.05814.05814.2 2.7309 0.0896 94.2 1142.6445 1143.3868 3954.6 127 3.968 72.2 1 L.KKDVPMSQPL.K * 122805-Holinger-05_itms_5.05198.05198.2 3.7822 0.265 98.9 1527.8518 1528.8071 6472.1 1 4.605 70.8 1 L.KKDVPMSQPLKEQ.E * 122805-Holinger-03_itms_6.04696.04696.2 3.517 0.3572 100.0 1479.7815 1480.6206 4951.5 1 6.459 72.7 1 M.SQPLKEQEVREH.Q * 122805-Holinger-05_itms_4.04772.04772.2 3.2808 0.2377 99.7 1394.7283 1395.5149 5230.1 1 5.192 75.0 1 L.RKEKNDTLNNY.D * 122805-Holinger-04_itms_8.06563.06563.2 3.224 0.2255 99.3 1723.8953 1724.868 5009.2 1 4.828 57.7 2 L.RKEKNDTLNNYDTL.E * 122805-Holinger-03_itms_9.06745.06745.2 3.8827 0.437 100.0 1577.7539 1578.6299 8658.4 1 7.672 75.0 3 Y.DTLEEETDDLKNR.L * 122805-Holinger-03_itms_12.08501.08501.2 3.0378 0.3028 99.8 1690.8431 1691.7893 8775.7 1 5.247 61.5 1 Y.DTLEEETDDLKNRL.Q * 122805-Holinger-03_itms_12.08239.08239.3 2.3064 0.1557 98.5 1818.901 1819.92 4889.3 15 4.292 39.3 1 Y.DTLEEETDDLKNRLQ.A * 122805-Holinger-03_itms_12.08249.08249.2 5.1619 0.2905 100.0 1818.9033 1819.92 8942.9 1 6.022 67.9 6 Y.DTLEEETDDLKNRLQ.A * 122805-Holinger-02_itms_4.03652.03652.2 2.4812 0.2302 100.0 1248.5944 1249.2767 2704.0 27 5.871 72.2 4 L.EEETDDLKNR.L * 122805-Holinger-03_itms_8.06074.06074.2 3.6623 0.2791 99.5 1489.7405 1490.5669 3216.4 1 4.988 77.3 2 L.EEETDDLKNRLQ.A * 122805-Holinger-03_itms_6.04886.04886.2 3.2526 0.1444 92.9 1258.724 1259.4453 6017.1 1 3.905 80.0 1 Q.ALEKELDAKNK.I * 122805-Holinger-04_itms_7.05948.05948.2 5.4246 0.3408 100.0 1828.0636 1829.1068 4744.1 1 6.777 73.3 2 Q.ALEKELDAKNKIVNSR.K * 122805-Holinger-05_itms_6.05763.05763.3 3.6303 0.1832 99.5 1831.9927 1829.1068 7318.9 50 4.543 36.7 1 Q.ALEKELDAKNKIVNSR.K * 122805-Holinger-04_itms_5.04520.04520.2 3.182 0.3122 100.0 1315.631 1316.3795 5621.4 1 6.033 80.0 3 S.RKVDDHSGCIE.E * 122805-Holinger-02_itms_5.04564.04564.1 2.4557 0.2966 100.0 1159.521 1160.192 5087.1 1 6.088 72.2 1 R.KVDDHSGCIE.E * 122805-Holinger-03_itms_6.05111.05111.3 3.3541 0.1532 95.8 2246.07 2247.4106 6399.7 279 4.11 30.9 1 R.KVDDHSGCIEEREQMERK.L * 122805-Holinger-05_itms_5.04966.04966.3 3.3059 0.2282 99.4 1486.8865 1487.7397 4301.0 36 4.887 45.5 1 A.ELERKLKTVKDQ.V * 122805-Holinger-05_itms_5.04963.04963.2 2.8597 0.1554 94.6 1486.8873 1487.7397 4512.9 5 4.004 68.2 1 A.ELERKLKTVKDQ.V * 122805-Holinger-04_itms_10.07619.07619.2 3.7885 0.2038 99.5 1285.7975 1286.5547 7045.5 22 4.99 75.0 2 K.LKTVKDQVLEL.E * 122805-Holinger-03_itms_11.07539.07539.2 4.4621 0.2045 100.0 1642.9347 1643.8778 6777.3 1 5.617 80.8 3 K.LKTVKDQVLELENN.S * 122805-Holinger-03_itms_11.07911.07911.2 4.801 0.3736 100.0 2072.1204 2073.3079 7193.5 1 7.014 64.7 1 K.LKTVKDQVLELENNSDVQ.S * 122805-Holinger-02_itms_7.05700.05700.2 3.0953 0.132 92.2 1075.5807 1076.1919 7495.4 75 3.852 81.2 1 R.SKEDELKNL.M * 122805-Holinger-03_itms_8.05867.05867.3 3.1033 0.0909 94.3 1337.6808 1338.457 5512.8 69 4.039 45.0 2 N.AEEKDTQLEFK.K * 122805-Holinger-02_itms_6.05512.05512.2 3.0619 0.1687 97.6 1337.6808 1338.457 7824.2 2 4.326 75.0 3 N.AEEKDTQLEFK.K * 122805-Holinger-02_itms_6.05514.05514.1 3.0761 0.2715 97.8 1337.682 1338.457 6017.0 1 5.541 65.0 2 N.AEEKDTQLEFK.K * 122805-Holinger-03_itms_7.05294.05294.2 3.1848 0.1822 99.4 1579.8254 1580.735 5502.9 22 4.836 58.3 1 N.AEEKDTQLEFKKN.E * 122805-Holinger-03_itms_13.08815.08815.2 2.7137 0.0887 90.9 1715.9243 1716.8888 4156.1 184 3.784 57.7 1 K.QNESKRLKDELNEL.E * 122805-Holinger-02_itms_8.06261.06261.2 2.3399 0.137 91.6 1162.6543 1163.3746 6826.9 169 3.81 72.2 1 S.SAKENELKML.K * 122805-Holinger-03_itms_14.09612.09612.3 5.2686 0.2937 100.0 1631.9148 1632.8516 8120.9 1 7.375 57.7 30 L.KNKIAELEEEISTK.N * 122805-Holinger-03_itms_14.09535.09535.2 5.5349 0.3174 100.0 1631.916 1632.8516 8064.8 1 7.175 92.3 36 L.KNKIAELEEEISTK.N * 122805-Holinger-04_itms_11.07868.07868.3 4.8139 0.1891 100.0 1745.9595 1746.9554 5268.5 1 4.969 48.2 2 L.KNKIAELEEEISTKN.S * 122805-Holinger-04_itms_11.07855.07855.2 5.281 0.3212 100.0 1745.9598 1746.9554 6353.7 1 6.505 75.0 3 L.KNKIAELEEEISTKN.S * 122805-Holinger-02_itms_8.06526.06526.2 3.1833 0.1402 99.4 1389.771 1390.5737 4445.6 1 4.872 68.2 1 N.KIAELEEEISTK.N * 122805-Holinger-02_itms_8.06661.06661.2 3.829 0.3178 100.0 1261.6724 1262.3997 8042.6 1 6.488 90.0 2 K.IAELEEEISTK.N * 122805-Holinger-02_itms_6.05532.05532.1 2.6824 0.2513 91.7 1077.5447 1078.1614 2693.8 2 4.838 75.0 1 A.ELEEEISTK.N * 122805-Holinger-03_itms_5.04451.04451.2 2.5569 0.0974 92.5 829.52783 830.01526 5311.8 18 3.865 78.6 1 L.IAKEGKLA.S * 122805-Holinger-04_itms_5.04733.04733.2 3.4019 0.2128 99.7 1617.8623 1618.7471 4709.8 89 5.177 53.8 2 L.ESKLNQRDSQLGSR.E * 122805-Holinger-03_itms_6.04887.04887.2 2.8321 0.0909 95.6 1746.9064 1747.8625 3757.4 1 4.101 53.6 1 L.ESKLNQRDSQLGSRE.E * 122805-Holinger-04_itms_7.05753.05753.3 2.5429 0.147 97.7 2475.3225 2476.706 5058.9 162 4.278 31.2 1 L.ESKLNQRDSQLGSREEELKKT.N * 122805-Holinger-04_itms_6.05375.05375.2 2.6523 0.0383 90.1 2131.1506 2132.3384 5770.6 61 3.736 41.2 1 K.LNQRDSQLGSREEELKKT.N * 122805-Holinger-03_itms_5.04083.04083.2 2.8795 0.2255 100.0 1160.5991 1161.2198 3384.0 13 5.528 72.2 1 L.NQRDSQLGSR.E * 122805-Holinger-03_itms_6.05164.05164.2 3.3945 0.2873 100.0 1775.9551 1776.9443 4906.2 75 5.797 53.6 1 Q.RDSQLGSREEELKKT.N * 122805-Holinger-03_itms_5.04587.04587.2 3.7492 0.0911 90.3 1602.8987 1603.8131 4617.8 5 3.748 70.8 1 R.EEELKKTNDKLQK.D * 122805-Holinger-04_itms_7.05937.05937.2 2.7092 0.1047 91.9 1313.7782 1314.5277 4919.2 2 3.834 75.0 1 T.NDKLQKDIRIA.R * 122805-Holinger-02_itms_8.06714.06714.3 3.6517 0.1539 99.5 1702.9263 1703.89 6061.9 2 4.575 48.1 2 A.REETVSKDERIIDL.Q * 122805-Holinger-02_itms_9.06886.06886.2 3.4752 0.0799 96.4 1702.9265 1703.89 3692.5 3 4.167 61.5 4 A.REETVSKDERIIDL.Q * 122805-Holinger-03_itms_10.06980.06980.2 3.4025 0.2016 98.9 1830.9918 1832.0208 3579.5 29 4.608 53.6 1 A.REETVSKDERIIDLQ.K * 122805-Holinger-03_itms_9.06820.06820.2 3.3306 0.12 97.5 1959.0851 1960.1948 4884.0 1 4.317 56.7 1 A.REETVSKDERIIDLQK.K * 122805-Holinger-03_itms_11.07892.07892.2 2.8615 0.0708 90.9 1346.7925 1347.5974 3643.4 4 3.784 70.0 1 K.QLENDLFVIKK.T * 122805-Holinger-03_itms_9.06424.06424.2 4.7192 0.3415 100.0 1962.1115 1963.2358 5721.8 1 6.132 68.8 2 E.SKTITDNELESKDKLIK.I * 122805-Holinger-03_itms_9.06369.06369.3 3.1886 0.2393 99.5 1963.1008 1963.2358 4185.9 21 4.502 35.9 1 E.SKTITDNELESKDKLIK.I * 122805-Holinger-02_itms_6.05381.05381.2 3.1184 0.2175 99.4 1149.5831 1150.2279 2742.7 1 4.961 88.9 3 K.TITDNELESK.D * 122805-Holinger-04_itms_8.06505.06505.2 3.0381 0.1445 99.3 1746.9807 1747.9835 6811.1 6 4.79 50.0 1 K.TITDNELESKDKLIK.I * 122805-Holinger-05_itms_6.05539.05539.2 4.8811 0.2799 99.8 1612.863 1613.8107 4518.3 1 5.446 77.3 8 M.EKELKEREFNYK.I * 122805-Holinger-05_itms_7.06573.06573.2 4.0586 0.3551 100.0 1812.9835 1814.0483 5129.2 5 6.591 61.5 5 M.EKELKEREFNYKIS.E * 122805-Holinger-05_itms_6.05502.05502.2 3.7811 0.1415 97.5 1483.8124 1484.6952 7005.5 3 4.306 75.0 1 E.KELKEREFNYK.I * 122805-Holinger-04_itms_5.04916.04916.2 2.5333 0.1461 95.4 1113.5883 1114.2462 3656.9 1 4.076 78.6 1 L.KEREFNYK.I * 122805-Holinger-02_itms_6.05395.05395.2 3.256 0.1566 99.0 1292.6799 1293.4137 4329.3 19 4.656 70.0 2 S.ESKLEDEKTTL.N * 122805-Holinger-02_itms_6.05396.05396.1 2.8582 0.2444 98.1 1292.6813 1293.4137 3386.0 1 5.48 70.0 1 S.ESKLEDEKTTL.N * 122805-Holinger-02_itms_7.05891.05891.2 3.2284 0.2746 99.8 1863.989 1865.0447 4124.8 9 5.263 50.0 1 S.ESKLEDEKTTLNEKIS.N * 122805-Holinger-05_itms_9.07403.07403.2 3.8921 0.3213 100.0 2091.1208 2092.3079 5467.2 1 6.154 50.0 3 S.ESKLEDEKTTLNEKISNL.A * 122805-Holinger-02_itms_9.06784.06784.2 2.83 0.0392 90.1 1633.8566 1634.7808 5062.5 151 3.736 53.8 1 L.EDEKTTLNEKISNL.A * 122805-Holinger-02_itms_6.05195.05195.2 3.2767 0.2553 100.0 1862.9415 1863.9762 5674.4 165 5.989 37.5 1 A.AENSQLKNKIEDNSTAT.H * 122805-Holinger-02_itms_6.05127.05127.2 2.7918 0.2055 98.8 1791.9203 1792.8975 5259.5 10 4.551 43.3 1 A.ENSQLKNKIEDNSTAT.H * 122805-Holinger-04_itms_5.04659.04659.2 3.3376 0.2349 99.6 1598.8453 1599.741 4724.2 3 5.162 65.4 1 S.QLKNKIEDNSTATH.H * 122805-Holinger-02_itms_10.07720.07720.2 3.5965 0.2697 100.0 1511.7653 1512.718 5922.8 3 5.568 72.7 1 H.MKENYEKQLESL.R * 122805-Holinger-03_itms_6.04758.04758.3 2.9586 0.038 90.3 1296.6636 1297.4075 6159.3 112 3.884 44.4 1 L.RKDIEEYKES.A * 122805-Holinger-03_itms_6.04748.04748.2 2.942 0.1308 99.5 1296.6653 1297.4075 4998.9 1 5.018 83.3 3 L.RKDIEEYKES.A * 122805-Holinger-03_itms_8.06032.06032.2 4.2083 0.297 100.0 1620.8284 1621.7386 5601.6 1 5.855 76.9 1 Y.KESAKDSEDKIEEL.K * 122805-Holinger-02_itms_7.05753.05753.2 3.707 0.2113 99.4 1276.648 1277.3708 8026.7 1 4.853 80.0 2 S.AKDSEDKIEEL.K * 122805-Holinger-05_itms_6.06026.06026.3 3.9517 0.1869 99.6 2246.2407 2247.5107 6717.2 39 4.451 34.7 1 K.VSEKRSKDIKQKDEQISDL.T * 122805-Holinger-05_itms_7.06230.06230.3 4.0754 0.2766 100.0 2060.1357 2061.3 4644.8 33 5.063 40.6 9 S.EKRSKDIKQKDEQISDL.T * 122805-Holinger-05_itms_7.06068.06068.2 4.535 0.351 100.0 2060.1382 2061.3 6404.6 1 6.882 56.2 7 S.EKRSKDIKQKDEQISDL.T * 122805-Holinger-05_itms_7.06365.06365.3 3.3767 0.2533 100.0 2289.2478 2290.5356 6667.2 17 5.67 33.3 3 S.EKRSKDIKQKDEQISDLTQ.N * 122805-Holinger-05_itms_7.06345.06345.2 3.0538 0.13 98.2 2289.2505 2290.5356 5307.0 210 4.399 33.3 1 S.EKRSKDIKQKDEQISDLTQ.N * 122805-Holinger-05_itms_6.05841.05841.2 3.4749 0.1988 99.4 1802.9952 1804.0104 5633.7 1 4.914 64.3 2 K.RSKDIKQKDEQISDL.T * 122805-Holinger-05_itms_6.05758.05758.2 3.9108 0.1963 99.3 2032.106 2033.2462 7738.3 1 4.789 56.2 1 K.RSKDIKQKDEQISDLTQ.N * 122805-Holinger-03_itms_8.05840.05840.2 3.1673 0.2307 98.7 1646.8888 1647.8229 5972.2 15 4.569 57.7 1 R.SKDIKQKDEQISDL.T * 122805-Holinger-02_itms_7.06112.06112.2 3.0379 0.0699 93.3 1431.765 1432.5707 7777.4 152 3.928 63.6 1 K.DIKQKDEQISDL.T * 122805-Holinger-05_itms_24.15942.15942.3 2.6299 0.1533 93.1 1639.9094 1640.8796 5277.1 65 4.004 41.7 1 K.SIIDRYKKDFNQL.K * 122805-Holinger-05_itms_15.10622.10622.2 3.1343 0.0678 92.8 1639.9136 1640.8796 7181.6 1 3.882 66.7 9 K.SIIDRYKKDFNQL.K * 122805-Holinger-02_itms_11.08109.08109.2 4.3056 0.2907 100.0 1674.8895 1674.8456 7792.1 1 5.955 80.8 1 L.NLENKLIESEDELK.S * 122805-Holinger-02_itms_17.11779.11779.2 5.6085 0.372 100.0 1874.013 1875.0831 6845.2 1 6.944 73.3 26 L.NLENKLIESEDELKSL.R * 122805-Holinger-02_itms_17.11594.11594.3 3.2413 0.2952 100.0 1874.0138 1875.0831 5121.1 2 5.119 41.7 4 L.NLENKLIESEDELKSL.R * 122805-Holinger-02_itms_12.08524.08524.2 4.2928 0.2025 100.0 1649.9672 1647.82 5253.2 1 5.662 69.2 3 L.ENKLIESEDELKSL.R * 122805-Holinger-02_itms_7.05750.05750.2 3.7444 0.147 99.5 1162.6039 1163.2671 5040.3 1 5.017 83.3 1 K.LIESEDELKS.L * 122805-Holinger-02_itms_10.07557.07557.2 3.5321 0.2778 99.8 1275.6887 1276.4265 6168.1 1 5.235 85.0 1 K.LIESEDELKSL.R * 122805-Holinger-02_itms_8.06481.06481.2 2.693 0.1694 99.8 1060.5815 1061.1802 5292.4 261 5.254 68.8 1 L.SLENDRLLT.E * 122805-Holinger-02_itms_7.06041.06041.2 3.2172 0.131 98.3 1446.7682 1447.5852 6128.9 3 4.407 68.2 1 L.SLENDRLLTEKE.S * 122805-Holinger-03_itms_13.08914.08914.3 5.649 0.3614 100.0 2775.4885 2777.058 5348.0 2 6.133 32.6 13 L.SLENDRLLTEKESASDKEREISIL.N * 122805-Holinger-03_itms_10.07024.07024.2 3.6513 0.3209 100.0 1834.9725 1836.0062 6459.1 1 6.025 53.3 2 L.TEKESASDKEREISIL.N * 122805-Holinger-02_itms_8.06382.06382.2 3.5978 0.2919 100.0 1733.9211 1734.9011 6231.2 1 5.728 60.7 4 T.EKESASDKEREISIL.N * 122805-Holinger-03_itms_10.07086.07086.2 3.966 0.3165 100.0 1604.8778 1605.7856 5471.1 1 6.124 69.2 2 E.KESASDKEREISIL.N * 122805-Holinger-03_itms_10.07275.07275.2 2.9796 0.2353 98.6 1347.7336 1348.4961 7895.5 215 4.443 59.1 1 E.SASDKEREISIL.N * 122805-Holinger-05_itms_9.07357.07357.3 3.2968 0.179 99.5 1947.0095 1948.2041 6309.3 18 4.553 41.1 1 L.NRKLDEMDKEKWNLQ.E * 122805-Holinger-05_itms_9.07379.07379.2 3.6201 0.3656 100.0 1947.0104 1948.2041 6255.7 1 6.539 67.9 1 L.NRKLDEMDKEKWNLQ.E * 122805-Holinger-02_itms_5.04519.04519.2 3.0865 0.1509 99.3 1135.5847 1136.3057 4034.4 6 4.717 81.2 1 R.KLDEMDKEK.W * 122805-Holinger-04_itms_5.04639.04639.2 2.5402 0.1501 96.9 1437.7983 1438.6237 2947.3 44 4.22 65.0 1 Q.ESKEKYKRELQ.K * 122805-Holinger-05_itms_10.08035.08035.2 3.5501 0.2464 99.7 1702.6129 1700.8918 5305.4 1 5.198 57.7 1 R.HNNDLKVINDYLNK.V * 122805-Holinger-02_itms_11.08156.08156.2 4.0601 0.2867 100.0 1320.7034 1321.4729 7942.1 1 5.671 85.0 1 N.NDLKVINDYLN.K * 122805-Holinger-03_itms_11.07888.07888.2 3.319 0.1273 93.4 1448.8016 1449.647 8224.2 16 3.933 59.1 1 N.NDLKVINDYLNK.V * 122805-Holinger-02_itms_11.08334.08334.2 3.5663 0.3292 100.0 1629.7887 1630.7057 3660.2 1 5.617 73.1 1 S.LNISLPDDDELDRD.Y * 122805-Holinger-03_itms_13.08854.08854.2 2.3776 0.1794 93.1 1792.8566 1793.8816 4180.4 6 3.912 50.0 1 S.LNISLPDDDELDRDY.Y * 122805-Holinger-03_itms_13.09105.09105.2 3.1336 0.1467 98.7 1955.9229 1957.0576 4117.7 1 4.523 53.3 1 S.LNISLPDDDELDRDYY.N * 122805-Holinger-03_itms_13.08834.08834.2 4.8201 0.2711 100.0 2069.9683 2071.1614 5035.2 1 6.698 62.5 5 S.LNISLPDDDELDRDYYN.S * 122805-Holinger-02_itms_12.08935.08935.2 4.1922 0.3644 100.0 2156.999 2158.2395 4778.5 1 6.264 52.9 6 S.LNISLPDDDELDRDYYNS.H * 122805-Holinger-02_itms_12.08490.08490.2 4.8826 0.3659 100.0 2294.0562 2295.3806 6573.7 1 6.809 63.9 6 S.LNISLPDDDELDRDYYNSH.V * 122805-Holinger-03_itms_13.08935.08935.2 3.205 0.1094 94.6 2557.1855 2557.6892 7093.9 1 4.01 45.0 1 S.LNISLPDDDELDRDYYNSHVY.T * 122805-Holinger-02_itms_10.07407.07407.2 2.8584 0.1287 95.0 1516.6934 1517.5463 4186.6 1 4.032 70.8 1 L.NISLPDDDELDRD.Y * 122805-Holinger-02_itms_11.08194.08194.2 4.3292 0.2872 100.0 1956.878 1958.002 5246.0 1 6.686 63.3 2 L.NISLPDDDELDRDYYN.S * 122805-Holinger-02_itms_11.08207.08207.2 4.4231 0.3703 100.0 2043.9137 2045.0802 5440.6 1 7.175 59.4 2 L.NISLPDDDELDRDYYNS.H * 122805-Holinger-03_itms_11.07897.07897.2 4.8498 0.409 100.0 2180.9736 2182.2212 7349.7 1 7.609 61.8 6 L.NISLPDDDELDRDYYNSH.V * 122805-Holinger-02_itms_11.08096.08096.2 4.4302 0.266 100.0 1842.8356 1843.8982 6982.5 1 6.274 67.9 1 N.ISLPDDDELDRDYYN.S * 122805-Holinger-02_itms_11.08114.08114.2 3.9829 0.3189 100.0 1929.8657 1930.9763 7542.5 1 6.196 56.7 1 N.ISLPDDDELDRDYYNS.H * 122805-Holinger-03_itms_11.07825.07825.2 4.5748 0.2841 100.0 2066.9312 2068.1174 8973.0 1 5.575 62.5 5 N.ISLPDDDELDRDYYNSH.V * 122805-Holinger-03_itms_12.08531.08531.2 2.77 0.2287 99.4 1402.6678 1403.5364 5926.7 6 4.933 77.8 1 R.YHDYEYPLRF.N * 122805-Holinger-03_itms_11.07978.07978.3 2.5392 0.1829 96.9 1516.7091 1517.6403 4909.4 82 4.165 42.5 1 R.YHDYEYPLRFN.L * 122805-Holinger-03_itms_11.07979.07979.2 3.9115 0.3302 100.0 1516.7102 1517.6403 8246.8 1 5.905 85.0 5 R.YHDYEYPLRFN.L * 122805-Holinger-03_itms_12.08221.08221.2 2.5344 0.1969 99.7 1239.6005 1240.3605 5615.3 1 5.18 87.5 1 Y.HDYEYPLRF.N * 122805-Holinger-04_itms_10.07647.07647.2 2.4999 0.2321 99.6 1353.6482 1354.4644 7289.4 2 5.128 66.7 1 Y.HDYEYPLRFN.L YIL002W-A 21 37 53.6% 69 7729 4.7 U YIL002W-A SGDID:S000028835, Chr IX from 350298-350507, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" * 122805-Holinger-03_itms_11.07951.07951.2 5.0233 0.3267 100.0 1786.0251 1787.0636 6976.5 1 6.424 80.0 7 L.NLLKGGEEKISEVELK.L * 122805-Holinger-03_itms_11.07830.07830.3 5.17 0.1488 99.2 1786.0269 1787.0636 7873.5 1 4.408 50.0 6 L.NLLKGGEEKISEVELK.L * 122805-Holinger-03_itms_8.06169.06169.3 3.6635 0.1203 93.5 1558.8959 1559.8003 4173.8 5 4.019 51.9 1 L.LKGGEEKISEVELK.L * 122805-Holinger-03_itms_8.06170.06170.2 4.3471 0.2141 99.8 1558.8981 1559.8003 8123.4 1 5.224 76.9 1 L.LKGGEEKISEVELK.L * 122805-Holinger-02_itms_6.05436.05436.2 4.3374 0.2079 99.5 1445.8087 1446.6409 7566.8 2 5.037 83.3 2 L.KGGEEKISEVELK.L * 122805-Holinger-02_itms_7.05793.05793.2 4.0072 0.1353 96.4 1317.7178 1318.4668 8906.6 11 4.169 81.8 3 K.GGEEKISEVELK.L * 122805-Holinger-02_itms_7.05798.05798.3 5.0602 0.1926 100.0 1317.7202 1318.4668 7401.8 6 5.045 70.5 1 K.GGEEKISEVELK.L * 122805-Holinger-02_itms_7.05801.05801.1 3.0135 0.2761 98.4 1317.7213 1318.4668 6912.9 6 5.38 68.2 1 K.GGEEKISEVELK.L * 122805-Holinger-02_itms_7.05745.05745.2 2.3137 0.056 98.3 1203.6677 1204.3629 2481.6 3 4.41 83.3 1 G.EEKISEVELK.L * 122805-Holinger-03_itms_9.06853.06853.3 2.8554 0.1892 94.5 1893.0154 1894.0946 5343.6 2 4.094 45.0 1 L.LVQLEDLHRDNNDLAK.S * 122805-Holinger-03_itms_9.06854.06854.2 4.4204 0.2358 100.0 1893.0162 1894.0946 7707.5 1 5.905 63.3 1 L.LVQLEDLHRDNNDLAK.S * 122805-Holinger-03_itms_9.06897.06897.2 4.8915 0.4447 100.0 2067.0803 2068.251 9251.2 1 7.423 64.7 1 L.LVQLEDLHRDNNDLAKSS.S * 122805-Holinger-02_itms_5.04535.04535.2 2.586 0.1547 94.9 1011.5035 1012.0672 3385.0 109 4.029 78.6 1 Q.LEDLHRDN.N * 122805-Holinger-03_itms_7.05220.05220.2 2.8745 0.2223 100.0 1552.7986 1553.672 7855.1 43 5.594 58.3 2 Q.LEDLHRDNNDLAK.S * 122805-Holinger-02_itms_5.04994.04994.2 3.3854 0.2113 99.5 1639.852 1640.7501 7027.9 2 5.094 65.4 2 Q.LEDLHRDNNDLAKS.S * 122805-Holinger-03_itms_6.05078.05078.3 3.89 0.1559 99.6 2070.058 2071.2114 5760.3 18 4.464 39.7 1 Q.LEDLHRDNNDLAKSSSQK.- * 122805-Holinger-03_itms_6.05068.05068.2 3.661 0.2967 100.0 2070.124 2071.2114 3082.5 3 5.543 47.1 1 Q.LEDLHRDNNDLAKSSSQK.- * 122805-Holinger-02_itms_5.04670.04670.2 2.8942 0.2426 99.4 1613.78 1614.669 5917.6 44 4.877 50.0 1 L.EDLHRDNNDLAKSS.S * 122805-Holinger-03_itms_5.04559.04559.3 2.5502 0.2223 97.1 1310.6671 1311.397 5159.6 79 4.246 47.5 1 E.DLHRDNNDLAK.S * 122805-Holinger-03_itms_6.04662.04662.2 3.4254 0.3266 100.0 1484.7355 1485.5535 6591.9 1 6.483 70.8 1 E.DLHRDNNDLAKSS.S * 122805-Holinger-03_itms_4.03670.03670.2 2.1959 0.1045 93.1 1082.5558 1083.1489 5259.0 21 3.919 62.5 1 L.HRDNNDLAK.S YNL225C 68 111 53.2% 581 67400 6.0 U CNM67 SGDID:S000005169, Chr XIV from 224470-222725, reverse complement, Verified ORF, "Component of the spindle pole body outer plaque; required for spindle orientation and mitotic nuclear migration" * 122805-Holinger-05_itms_9.07590.07590.3 3.1876 0.1092 94.6 2215.1177 2216.4148 3961.5 2 4.09 37.5 1 M.NFPFHERLDSPVSENGEIK.D * 122805-Holinger-04_itms_10.07762.07762.2 4.8316 0.3236 100.0 2215.119 2216.4148 6273.9 1 5.927 50.0 2 M.NFPFHERLDSPVSENGEIK.D * 122805-Holinger-03_itms_8.05971.05971.2 4.4009 0.3366 100.0 1709.8732 1710.8412 6442.6 1 5.893 71.4 1 F.HERLDSPVSENGEIK.D * 122805-Holinger-03_itms_8.05963.05963.3 3.593 0.3265 100.0 1709.8744 1710.8412 6431.4 1 6.753 41.1 2 F.HERLDSPVSENGEIK.D * 122805-Holinger-05_itms_9.07517.07517.2 3.4273 0.1417 95.5 1433.836 1434.6787 4146.2 1 4.092 70.8 1 W.LNENHVGKSILPL.F * 122805-Holinger-04_itms_10.07644.07644.2 2.2897 0.1654 93.5 1206.7073 1207.4154 6104.6 2 3.938 75.0 1 N.ENHVGKSILPL.F * 122805-Holinger-02_itms_11.08129.08129.2 2.7987 0.1635 99.8 1206.5695 1207.2916 4064.8 5 5.279 77.8 1 L.FVNPEDVINC.N * 122805-Holinger-03_itms_6.04974.04974.2 3.723 0.3045 100.0 1889.9728 1891.0476 7062.8 1 6.575 60.0 1 T.SYQESPGLQERPKNEK.D * 122805-Holinger-04_itms_7.05673.05673.3 3.6206 0.1802 99.4 2703.3723 2704.9102 7540.3 1 4.825 32.6 1 T.SYQESPGLQERPKNEKDKSPIGTD.V * 122805-Holinger-04_itms_7.05714.05714.2 3.6156 0.2036 99.3 2704.3765 2704.9102 5411.0 1 4.896 37.0 1 T.SYQESPGLQERPKNEKDKSPIGTD.V * 122805-Holinger-04_itms_6.05345.05345.3 2.8048 0.0673 92.8 2456.2825 2454.656 4763.8 4 3.967 29.8 1 Y.QESPGLQERPKNEKDKSPIGTD.V * 122805-Holinger-04_itms_5.04583.04583.3 3.2543 0.2845 100.0 1713.9047 1714.8729 5526.4 1 5.609 44.6 1 Q.ERPKNEKDKSPIGTD.V * 122805-Holinger-04_itms_5.04661.04661.2 2.9024 0.176 92.0 1713.9105 1714.8729 4904.0 5 3.844 53.6 4 Q.ERPKNEKDKSPIGTD.V * 122805-Holinger-05_itms_5.05346.05346.2 2.743 0.1171 98.7 1812.9796 1814.0055 5033.6 1 4.521 56.7 1 Q.ERPKNEKDKSPIGTDV.H * 122805-Holinger-05_itms_8.06773.06773.2 2.8036 0.1914 99.6 1282.6785 1283.4294 4838.4 2 5.138 75.0 1 K.DVPNFIHSTPR.E * 122805-Holinger-02_itms_8.06235.06235.2 3.6518 0.2298 99.8 1797.8474 1798.8578 7034.4 1 5.455 56.2 1 Q.ASAQPTDEHTSPDISIE.D * 122805-Holinger-02_itms_8.06238.06238.2 2.6606 0.1552 99.3 1726.8057 1727.7789 6296.1 12 4.691 43.3 1 A.SAQPTDEHTSPDISIE.D * 122805-Holinger-02_itms_8.06230.06230.2 2.4083 0.1034 93.1 1639.7744 1640.7008 5899.6 19 3.92 53.6 1 S.AQPTDEHTSPDISIE.D * 122805-Holinger-02_itms_8.06374.06374.1 3.2956 0.323 100.0 1242.5697 1243.2695 5680.5 1 6.325 65.0 2 T.DEHTSPDISIE.D * 122805-Holinger-04_itms_4.03746.03746.2 3.0107 0.2321 99.4 1457.7533 1458.5338 2789.0 1 4.964 68.2 3 L.GRDNLRQEERAN.S * 122805-Holinger-04_itms_4.04322.04322.2 2.6715 0.2068 98.4 1544.7832 1545.6119 2859.9 46 4.428 54.2 1 L.GRDNLRQEERANS.L * 122805-Holinger-04_itms_6.05397.05397.2 2.7899 0.0414 92.8 1657.8674 1658.7714 3603.6 175 3.891 50.0 1 L.GRDNLRQEERANSL.Q * 122805-Holinger-05_itms_4.04293.04293.2 3.084 0.1796 98.7 1762.0117 1763.0012 4835.2 5 4.49 53.6 1 A.TKSNDKTLDNKKKIE.E * 122805-Holinger-05_itms_4.04311.04311.3 4.5177 0.2632 100.0 2019.1113 2020.2474 5177.0 1 5.769 51.6 5 A.TKSNDKTLDNKKKIEEQ.T * 122805-Holinger-05_itms_4.04475.04475.2 4.7214 0.3308 100.0 2019.1122 2020.2474 5472.3 1 6.494 53.1 5 A.TKSNDKTLDNKKKIEEQ.T * 122805-Holinger-05_itms_7.06428.06428.3 3.0396 0.1995 96.8 2332.3135 2333.6445 3475.6 13 4.219 34.2 2 A.TKSNDKTLDNKKKIEEQTVL.I * 122805-Holinger-03_itms_5.04578.04578.3 3.6326 0.1593 100.0 1789.9564 1790.9683 6210.6 1 4.933 48.2 1 K.SNDKTLDNKKKIEEQ.T * 122805-Holinger-03_itms_5.04552.04552.2 4.6158 0.2654 99.8 1789.9604 1790.9683 6279.1 1 5.238 60.7 2 K.SNDKTLDNKKKIEEQ.T * 122805-Holinger-03_itms_5.04533.04533.2 4.3169 0.3288 100.0 1702.9276 1703.89 4789.3 1 6.32 65.4 2 S.NDKTLDNKKKIEEQ.T * 122805-Holinger-03_itms_8.06088.06088.2 2.9154 0.2147 99.3 1162.6335 1163.3746 5787.4 2 4.788 83.3 1 L.SLNKEMLEKA.N * 122805-Holinger-02_itms_5.04619.04619.2 2.5808 0.073 96.5 848.47046 849.03314 2994.6 32 4.177 83.3 1 N.KEMLEKA.N * 122805-Holinger-03_itms_10.07122.07122.2 2.7396 0.1974 98.6 1103.6613 1104.292 5392.6 1 4.452 83.3 1 L.LSLTDSLRKA.E * 122805-Holinger-03_itms_8.06129.06129.2 2.7929 0.2252 99.3 990.5725 991.13257 5589.6 10 4.716 81.2 2 L.SLTDSLRKA.E * 122805-Holinger-02_itms_19.12521.12521.1 2.3563 0.2323 93.9 1143.6873 1144.3965 3452.4 1 4.915 66.7 4 A.ELFEIPIGIL.F * 122805-Holinger-02_itms_18.12278.12278.2 2.8951 0.1329 98.7 1143.6877 1144.3965 3901.3 3 4.512 72.2 2 A.ELFEIPIGIL.F * 122805-Holinger-02_itms_13.09223.09223.1 2.1932 0.1262 93.4 1035.4486 1036.0826 6681.1 1 4.88 78.6 1 L.FFDLYDSE.E * 122805-Holinger-02_itms_13.09020.09020.1 3.2704 0.2539 98.0 1278.539 1279.3019 6801.0 1 5.503 72.2 1 L.FFDLYDSEEN.S * 122805-Holinger-05_itms_11.08494.08494.2 5.6211 0.3911 100.0 1693.7915 1694.7919 9482.6 1 7.816 80.8 4 L.FFDLYDSEENSSKL.D * 122805-Holinger-04_itms_8.06306.06306.2 3.4547 0.4045 100.0 1497.8326 1498.722 6135.9 1 6.498 72.7 1 L.DHILQEKYPNIK.G * 122805-Holinger-02_itms_7.05587.05587.1 2.1299 0.1636 97.4 1176.6122 1177.2566 5204.6 1 5.721 61.1 1 A.SQQEELSRIS.Q * 122805-Holinger-02_itms_6.05394.05394.2 1.5565 0.2133 95.5 1089.5717 1090.1783 3162.0 27 4.089 68.8 1 S.QQEELSRIS.Q * 122805-Holinger-02_itms_6.05301.05301.2 1.7724 0.1639 92.7 961.5119 962.04767 2459.6 133 3.877 64.3 1 Q.QEELSRIS.Q * 122805-Holinger-04_itms_6.05483.05483.2 2.7422 0.1863 99.3 1491.7853 1492.6904 4552.3 1 4.891 70.8 2 Q.TMREKNNTLIGTN.K * 122805-Holinger-04_itms_6.05341.05341.1 2.1168 0.1192 98.3 1145.647 1146.289 3299.2 1 5.392 61.1 1 M.REKNNTLIGT.N * 122805-Holinger-04_itms_6.05204.05204.2 2.3766 0.0169 92.8 1259.6918 1260.3927 3416.8 8 3.894 65.0 1 M.REKNNTLIGTN.K * 122805-Holinger-02_itms_7.05810.05810.2 2.4432 0.0723 95.3 1088.638 1089.2743 4636.4 1 4.064 87.5 1 L.TIDEKEILK.G * 122805-Holinger-02_itms_8.06182.06182.1 2.5364 0.2887 98.3 1305.6953 1306.4651 5643.5 1 5.415 70.0 1 L.TIDEKEILKGC.N * 122805-Holinger-03_itms_9.06547.06547.2 3.7426 0.3101 100.0 1305.7043 1306.4651 8860.9 1 5.761 85.0 3 L.TIDEKEILKGC.N * 122805-Holinger-04_itms_10.07646.07646.2 2.6258 0.1033 91.1 1372.7594 1373.5546 5211.0 16 3.791 60.0 1 K.LERLNERLGSW.E * 122805-Holinger-04_itms_10.07684.07684.3 2.668 0.1291 92.2 1377.3442 1373.5546 4454.8 135 3.938 45.0 2 K.LERLNERLGSW.E * 122805-Holinger-02_itms_4.04050.04050.2 2.2143 0.2134 99.8 1228.6294 1229.3293 3131.1 130 5.201 61.1 1 W.EKSKEKYETS.L * 122805-Holinger-04_itms_7.05686.05686.2 2.2369 0.1241 96.9 1277.8102 1278.5066 7623.7 101 4.219 60.0 1 T.SLKDKEKMLAD.A * 122805-Holinger-04_itms_5.04962.04962.2 2.4944 0.0962 91.2 1075.6366 1076.3397 3732.8 2 3.799 81.2 1 S.LKDKEKMLA.D * 122805-Holinger-04_itms_5.04980.04980.2 2.9817 0.1837 97.6 1190.6666 1191.4283 6306.0 1 4.321 83.3 1 S.LKDKEKMLAD.A * 122805-Holinger-02_itms_5.04930.04930.2 2.982 0.1201 98.6 974.54285 975.0898 4000.2 8 4.46 92.9 1 L.SKELDNLR.S * 122805-Holinger-05_itms_10.07769.07769.3 2.7424 0.0978 94.7 2137.1025 2138.3018 6528.9 5 4.071 34.7 1 L.SKELDNLRSRFGNLEGNTS.E * 122805-Holinger-03_itms_6.05144.05144.2 2.7499 0.2416 99.5 1118.6346 1119.2633 5715.9 1 5.011 83.3 1 E.GNTSERITIK.N * 122805-Holinger-02_itms_11.08237.08237.2 2.4897 0.1882 97.2 1087.6781 1086.317 6366.9 265 4.278 72.2 1 Q.NTVKEIVLAV.G * 122805-Holinger-03_itms_5.04417.04417.2 1.8916 0.0795 95.3 1010.46497 1011.1003 2992.9 4 4.059 71.4 1 R.RMDSIDHH.L * 122805-Holinger-03_itms_6.05181.05181.2 2.3583 0.252 99.4 1280.2576 1282.3214 5151.9 5 4.846 66.7 1 M.DSIDHHLERC.L * 122805-Holinger-02_itms_6.05079.05079.2 1.5991 0.0147 90.5 912.4369 912.9774 3545.4 288 3.764 75.0 1 C.LDHLYDH.I * 122805-Holinger-03_itms_12.08194.08194.2 2.689 0.0524 94.4 1138.6078 1139.2963 4530.8 1 3.985 87.5 4 C.LDHLYDHIL.E * 122805-Holinger-03_itms_12.08195.08195.1 2.597 0.2402 97.2 1138.6091 1139.2963 3970.7 2 4.996 75.0 1 C.LDHLYDHIL.E * 122805-Holinger-03_itms_10.07443.07443.2 2.7577 0.2586 99.8 1395.7496 1396.5858 4341.8 1 5.339 80.0 1 C.LDHLYDHILEK.M * 122805-Holinger-04_itms_13.09336.09336.3 4.4338 0.3963 100.0 1526.7946 1527.7784 6568.3 14 6.756 50.0 6 C.LDHLYDHILEKM.V * 122805-Holinger-04_itms_14.09554.09554.2 3.5112 0.3017 99.8 1526.7986 1527.7784 6482.4 1 5.422 68.2 5 C.LDHLYDHILEKM.V * 122805-Holinger-03_itms_18.11953.11953.2 2.2125 0.1821 98.1 1413.7104 1414.619 4783.5 61 4.375 55.0 1 L.DHLYDHILEKM.V * 122805-Holinger-02_itms_6.05109.05109.2 2.02 0.0985 96.0 917.4924 918.0373 4291.3 1 4.136 100.0 1 L.YDHILEK.M YIL149C 188 401 49.8% 1679 195140 6.0 U MLP2 SGDID:S000001411, Chr IX from 68067-63028, reverse complement, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved in the Tel1p pathway that controls telomere length" * 122805-Holinger-03_itms_10.07041.07041.2 2.287 0.1669 92.6 1032.6023 1033.2156 2612.4 1 3.873 87.5 2 L.QGVTYPVLR.K * 122805-Holinger-03_itms_9.06382.06382.2 3.3836 0.1934 98.5 1494.8042 1495.6726 6741.5 2 4.441 72.7 2 A.KFERSEEEVTKL.N * 122805-Holinger-02_itms_6.05266.05266.2 3.4625 0.0536 98.5 1219.6377 1220.322 5166.7 2 4.44 83.3 2 F.ERSEEEVTKL.N * 122805-Holinger-02_itms_6.05284.05284.1 3.0414 0.2405 93.7 1219.6382 1220.322 3103.1 13 4.869 61.1 1 F.ERSEEEVTKL.N 122805-Holinger-02_itms_6.05502.05502.2 2.7309 0.0525 99.4 934.48627 935.01904 6023.4 42 4.96 78.6 1 R.SEEEVTKL.N * 122805-Holinger-02_itms_9.06922.06922.2 3.3954 0.1689 99.5 1144.6395 1145.2981 7178.7 1 5.06 83.3 1 L.NVLVDEIKSQ.Y * 122805-Holinger-02_itms_9.06951.06951.1 2.708 0.2087 91.7 1144.6417 1145.2981 5698.6 1 4.795 77.8 1 L.NVLVDEIKSQ.Y * 122805-Holinger-03_itms_9.06790.06790.2 4.0802 0.2589 99.5 2005.0077 2006.1309 7793.2 5 5.085 55.9 4 L.LDESSEQKNTAKEELNGL.K * 122805-Holinger-03_itms_8.05955.05955.1 2.3418 0.2476 91.2 1216.6755 1217.3647 4599.3 1 4.776 70.0 1 Q.KNTAKEELNGL.K * 122805-Holinger-02_itms_7.05710.05710.2 3.054 0.0942 97.4 873.48065 873.9817 3261.2 7 4.304 92.9 1 T.AKEELNGL.K * 122805-Holinger-02_itms_6.05317.05317.2 4.5238 0.2911 100.0 1732.8042 1733.7458 8551.5 1 5.814 82.1 2 S.RDQGNDSLNDDLNKE.N * 122805-Holinger-02_itms_5.05006.05006.2 3.2466 0.2805 99.4 1974.9525 1976.0238 5811.3 25 4.951 46.9 1 S.RDQGNDSLNDDLNKENK.L * 122805-Holinger-02_itms_9.07174.07174.3 5.1465 0.2451 100.0 2201.1147 2202.3428 6465.5 1 5.471 45.8 2 S.RDQGNDSLNDDLNKENKLL.R * 122805-Holinger-03_itms_10.07352.07352.3 5.9948 0.3961 100.0 2357.2246 2358.5303 6535.9 1 7.194 47.4 2 S.RDQGNDSLNDDLNKENKLLR.R * 122805-Holinger-03_itms_10.07367.07367.2 5.0175 0.3349 100.0 2357.2256 2358.5303 5918.6 1 6.379 57.9 1 S.RDQGNDSLNDDLNKENKLLR.R * 122805-Holinger-02_itms_7.05835.05835.2 4.3242 0.3819 100.0 1576.6904 1577.5585 5797.3 1 6.278 76.9 1 R.DQGNDSLNDDLNKE.N * 122805-Holinger-04_itms_6.05399.05399.2 3.4355 0.1267 99.5 1174.7251 1175.4111 5623.3 1 5.015 83.3 1 Q.SKKLIEEKLS.S * 122805-Holinger-04_itms_6.05412.05412.3 2.7999 0.1521 94.3 1261.7583 1262.4894 4608.4 3 4.04 47.5 2 Q.SKKLIEEKLSS.F * 122805-Holinger-04_itms_6.05435.05435.2 3.6113 0.2691 99.6 1261.7584 1262.4894 9198.2 1 5.135 75.0 4 Q.SKKLIEEKLSS.F * 122805-Holinger-05_itms_9.07706.07706.3 3.6833 0.2652 100.0 1408.83 1409.6659 6258.2 1 5.897 56.8 5 Q.SKKLIEEKLSSF.S * 122805-Holinger-05_itms_9.07617.07617.2 3.9614 0.2574 100.0 1408.8314 1409.6659 9510.5 5 5.699 68.2 9 Q.SKKLIEEKLSSF.S * 122805-Holinger-05_itms_9.07337.07337.2 3.4793 0.108 94.6 1321.794 1322.5876 7580.5 3 3.998 80.0 1 S.KKLIEEKLSSF.S * 122805-Holinger-03_itms_11.07503.07503.1 2.5057 0.1154 91.4 1193.6979 1194.4136 7426.6 1 4.82 72.2 1 K.KLIEEKLSSF.S * 122805-Holinger-04_itms_6.05092.05092.2 4.3263 0.3587 100.0 1350.7719 1351.54 6113.1 1 7.191 81.8 2 F.SKKTLTEEVTKS.S * 122805-Holinger-02_itms_8.06396.06396.2 3.1131 0.244 99.4 1191.6489 1192.4131 7223.6 2 4.871 83.3 1 Q.SVEEKVLEMK.N * 122805-Holinger-04_itms_10.07279.07279.2 2.7607 0.074 97.9 1560.8444 1561.7966 7608.9 56 4.359 54.2 1 M.TLQKNMNDLLRSQ.L * 122805-Holinger-04_itms_8.06150.06150.2 2.493 0.1828 99.4 1003.552 1004.1925 3395.4 15 4.936 78.6 1 Q.KNMNDLLR.S * 122805-Holinger-04_itms_10.07640.07640.2 3.2258 0.3467 100.0 2028.8953 2030.035 7636.9 1 6.204 50.0 4 N.DDNSCRNPEHTDVIDEL.I * 122805-Holinger-03_itms_13.09030.09030.2 3.3002 0.1067 95.5 2358.0598 2359.3882 5714.5 3 4.097 39.5 2 N.DDNSCRNPEHTDVIDELIDT.K * 122805-Holinger-02_itms_12.08866.08866.2 3.823 0.302 99.8 2486.1533 2487.5623 5391.2 2 5.289 47.5 2 N.DDNSCRNPEHTDVIDELIDTK.L * 122805-Holinger-02_itms_12.08962.08962.3 5.753 0.3468 100.0 2486.1536 2487.5623 8270.1 1 6.55 40.0 2 N.DDNSCRNPEHTDVIDELIDTK.L * 122805-Holinger-03_itms_18.11777.11777.3 3.9014 0.223 100.0 1894.9885 1896.0642 7126.9 1 5.015 53.3 1 C.RNPEHTDVIDELIDTK.L * 122805-Holinger-02_itms_13.09333.09333.2 2.1966 0.0813 90.4 1160.6212 1161.2946 5464.3 11 3.75 72.2 1 T.DVIDELIDTK.L * 122805-Holinger-04_itms_7.05706.05706.2 2.4849 0.16 98.8 1202.7323 1203.4246 5168.0 1 4.542 72.2 1 L.IDTKLRLEKS.K * 122805-Holinger-04_itms_4.04401.04401.2 3.6454 0.2177 98.9 1532.8141 1533.691 6878.6 1 4.609 77.3 2 R.LEKSKNECQRLQ.N * 122805-Holinger-03_itms_12.08141.08141.2 2.7974 0.3258 100.0 1207.694 1207.4124 7658.2 7 5.811 72.7 1 T.TSAVSPTVGKLF.S * 122805-Holinger-03_itms_12.08112.08112.1 2.3538 0.3441 100.0 1105.6453 1106.3073 5499.9 1 6.579 60.0 1 T.SAVSPTVGKLF.S * 122805-Holinger-03_itms_12.08085.08085.2 2.2903 0.0733 99.3 1018.61017 1019.2291 5914.0 9 4.689 72.2 2 S.AVSPTVGKLF.S * 122805-Holinger-03_itms_11.08006.08006.1 2.3491 0.2365 97.8 1018.612 1019.2291 4358.0 1 5.132 66.7 1 S.AVSPTVGKLF.S * 122805-Holinger-03_itms_18.11721.11721.2 2.8977 0.1938 98.3 1233.6584 1234.3916 4700.3 4 4.414 88.9 1 Q.NQLEDFILEL.E * 122805-Holinger-04_itms_17.11259.11259.2 2.8595 0.1156 90.5 1362.7036 1363.5071 7333.2 9 3.764 75.0 1 Q.NQLEDFILELE.H * 122805-Holinger-02_itms_11.08217.08217.2 3.4577 0.3282 100.0 1442.7776 1443.6396 4873.8 1 6.069 68.2 2 L.ELEHKTPELISF.K * 122805-Holinger-04_itms_11.07980.07980.2 2.1874 0.1876 98.5 1316.7686 1314.5242 6602.8 5 4.435 65.0 1 E.LEHKTPELISF.K * 122805-Holinger-03_itms_7.05605.05605.1 2.0494 0.231 97.8 1053.5784 1054.1882 3282.9 1 5.116 68.8 1 L.EHKTPELIS.F * 122805-Holinger-03_itms_12.08193.08193.2 2.3489 0.0845 95.5 1200.6461 1201.3647 5049.8 1 4.093 83.3 2 L.EHKTPELISF.K * 122805-Holinger-05_itms_9.07643.07643.2 2.4312 0.1356 92.4 1071.6031 1072.2493 7056.6 6 3.864 81.2 1 E.HKTPELISF.K * 122805-Holinger-04_itms_5.04979.04979.2 2.3882 0.1644 98.3 1011.57635 1012.1539 5958.0 2 4.408 85.7 1 K.SLEHELKR.S * 122805-Holinger-05_itms_5.05474.05474.2 2.5972 0.1232 99.4 942.5898 943.13434 4984.7 260 4.941 71.4 1 L.VKQRLDLA.R * 122805-Holinger-02_itms_9.06892.06892.2 3.4235 0.2194 99.3 1060.5803 1061.1802 5422.4 1 4.785 87.5 1 L.SQDELISLR.K * 122805-Holinger-03_itms_6.04896.04896.2 3.6309 0.1674 99.0 1644.8868 1645.81 4166.6 3 4.641 65.4 2 Y.EGKQDKTLQKVENQ.T * 122805-Holinger-04_itms_16.10685.10685.3 5.1901 0.2888 100.0 2013.1624 2014.3269 7873.1 1 5.925 41.2 11 Q.TIKEAKDAIIELENINAK.M * 122805-Holinger-04_itms_17.11534.11534.2 4.7194 0.2423 100.0 2014.1654 2014.3269 8545.8 1 5.997 61.8 4 Q.TIKEAKDAIIELENINAK.M * 122805-Holinger-03_itms_11.07675.07675.2 4.2327 0.1654 99.3 1469.7749 1471.694 5822.1 1 4.761 83.3 2 A.KDAIIELENINAK.M * 122805-Holinger-04_itms_17.11712.11712.2 3.3763 0.1719 99.0 1343.1122 1343.5199 8307.1 6 4.656 68.2 1 K.DAIIELENINAK.M * 122805-Holinger-05_itms_10.07994.07994.2 2.6819 0.1344 90.4 1161.7212 1162.4178 5748.0 33 3.751 75.0 1 Q.NLRKELLIY.K * 122805-Holinger-05_itms_10.08144.08144.2 3.9904 0.2305 99.8 1874.9315 1876.0393 7291.5 1 5.242 67.9 2 K.SQCKKKTTLEDFENF.K * 122805-Holinger-05_itms_10.08240.08240.2 2.738 0.2763 99.3 1787.8966 1788.961 3759.1 1 4.699 53.8 2 S.QCKKKTTLEDFENF.K * 122805-Holinger-03_itms_12.08373.08373.2 2.7151 0.2667 99.8 1371.7023 1372.5175 7475.3 1 5.348 85.0 1 K.KKTTLEDFENF.K * 122805-Holinger-03_itms_13.08997.08997.2 3.2711 0.1632 96.9 1541.814 1542.7289 7757.9 1 4.211 66.7 1 K.KTTLEDFENFKGL.A * 122805-Holinger-02_itms_11.08294.08294.2 1.7695 0.2432 99.9 1245.6783 1244.3434 3136.2 146 5.472 66.7 1 K.TTLEDFENFK.G * 122805-Holinger-02_itms_14.09591.09591.2 3.4863 0.264 99.9 1413.7139 1414.5548 7342.6 11 5.486 68.2 1 K.TTLEDFENFKGL.A * 122805-Holinger-03_itms_6.04922.04922.2 3.0595 0.0935 91.9 1262.6632 1263.4515 6724.9 9 3.834 72.2 1 L.AKEKERMLEE.A * 122805-Holinger-03_itms_7.05255.05255.2 3.0515 0.1719 95.6 1333.7 1334.5304 5743.3 21 4.103 65.0 1 L.AKEKERMLEEA.I * 122805-Holinger-04_itms_19.12810.12810.2 3.9194 0.2628 99.8 1811.578 1813.079 6274.2 1 5.432 64.3 3 L.AKEKERMLEEAIDHL.K * 122805-Holinger-04_itms_20.13036.13036.3 3.9606 0.2678 100.0 1813.1733 1813.079 6533.9 1 5.187 51.8 3 L.AKEKERMLEEAIDHL.K * 122805-Holinger-04_itms_9.06960.06960.2 2.8184 0.2992 99.4 1692.9275 1693.9402 3764.0 1 4.877 65.4 1 L.KAELEKQKSWVPSY.I * 122805-Holinger-04_itms_7.06059.06059.2 2.4665 0.1644 99.4 1201.6791 1202.3959 3382.4 143 4.941 61.1 1 E.LEKQKSWVPS.Y * 122805-Holinger-04_itms_11.07958.07958.2 3.2187 0.159 99.5 1344.7216 1345.5406 4987.3 1 4.989 80.0 1 Q.KSWVPSYIHVE.K * 122805-Holinger-04_itms_6.05461.05461.2 2.4606 0.0703 95.1 1411.7799 1412.5858 7083.7 10 4.04 59.1 1 Y.IHVEKERASTEL.S * 122805-Holinger-03_itms_10.07070.07070.2 3.0256 0.3681 100.0 1450.8147 1451.6628 3194.2 5 6.017 66.7 1 E.TASFIPTKESLTR.D * 122805-Holinger-03_itms_12.08550.08550.2 4.0232 0.3581 100.0 2130.0618 2131.313 5135.9 1 6.83 55.9 2 E.TASFIPTKESLTRDFEQC.C * 122805-Holinger-03_itms_12.08369.08369.2 4.0208 0.4691 100.0 1957.9666 1959.1292 7149.8 1 7.486 60.0 2 A.SFIPTKESLTRDFEQC.C * 122805-Holinger-03_itms_11.07818.07818.2 3.0157 0.1747 97.9 1870.934 1872.0509 6460.0 1 4.363 71.4 1 S.FIPTKESLTRDFEQC.C * 122805-Holinger-02_itms_7.05861.05861.2 3.6993 0.2832 100.0 1412.6799 1413.4932 8467.4 1 6.255 70.0 1 T.KESLTRDFEQC.C * 122805-Holinger-05_itms_4.04329.04329.3 2.3802 0.1475 99.2 1212.655 1213.3359 4882.0 25 4.37 50.0 1 M.RLKESEISHN.E * 122805-Holinger-04_itms_5.04504.04504.2 2.3482 0.0773 90.3 1212.6558 1213.3359 3304.5 1 3.743 77.8 1 M.RLKESEISHN.E * 122805-Holinger-02_itms_5.04510.04510.2 2.5941 0.1013 91.8 1056.5491 1057.1484 4580.7 106 3.823 81.2 1 R.LKESEISHN.E * 122805-Holinger-03_itms_6.04903.04903.2 2.9551 0.209 98.0 1387.7094 1388.5199 3931.2 195 4.371 54.5 1 M.DFSSKEGQYKAK.I * 122805-Holinger-03_itms_11.07474.07474.2 4.0681 0.1268 90.7 1370.7872 1371.5767 6136.4 5 3.775 85.0 4 K.IKELENNLERL.R * 122805-Holinger-02_itms_6.05067.05067.2 1.5415 0.1232 90.5 993.48694 994.0557 5653.7 81 3.752 57.1 1 Q.EIESIRSC.K * 122805-Holinger-02_itms_6.05253.05253.2 3.5996 0.1038 99.4 1162.6599 1163.3135 6736.7 3 4.855 88.9 1 L.SNKETTIEKL.S * 122805-Holinger-02_itms_10.07489.07489.2 3.505 0.1098 99.7 1661.8998 1662.8375 5623.1 1 5.183 57.7 2 L.SSEIENLDKELRKT.K * 122805-Holinger-05_itms_8.07131.07131.2 3.6736 0.0781 98.9 1330.7035 1331.5138 8809.4 3 4.601 83.3 2 T.KFQYKFLDQN.S * 122805-Holinger-03_itms_20.12558.12558.2 3.9019 0.1032 94.2 1925.1066 1926.2206 9829.2 251 3.961 40.0 11 S.TLEPTLRKELEQIQVQ.L * 122805-Holinger-04_itms_8.06356.06356.2 3.2786 0.221 98.3 1383.8193 1384.6188 6923.4 191 4.41 65.0 1 T.LRKELEQIQVQ.L * 122805-Holinger-02_itms_9.06789.06789.2 3.2573 0.1357 94.6 1043.5946 1044.1931 6840.8 3 4.0 87.5 1 S.NENALIELK.N * 122805-Holinger-04_itms_7.05822.05822.2 3.4454 0.0648 90.4 1286.7902 1287.5425 5349.4 189 3.747 65.0 1 L.IELKNELAKTK.E * 122805-Holinger-05_itms_6.05690.05690.2 3.4502 0.2868 100.0 1429.8422 1430.6903 7090.1 1 5.505 75.0 1 K.IELEKKEKWAR.E * 122805-Holinger-05_itms_6.05628.05628.3 2.4164 0.2051 99.6 1429.8429 1430.6903 3407.6 48 4.427 45.0 1 K.IELEKKEKWAR.E * 122805-Holinger-04_itms_7.05843.05843.3 2.903 0.1417 100.0 1500.8383 1501.6829 4087.6 1 5.805 47.7 1 Q.SEKLRNEVERIQ.K * 122805-Holinger-04_itms_7.05836.05836.2 2.601 0.1099 94.6 1500.84 1501.6829 5807.7 4 3.993 59.1 1 Q.SEKLRNEVERIQ.K * 122805-Holinger-05_itms_6.05737.05737.3 2.9503 0.1188 96.0 1626.8761 1629.8569 5431.1 158 4.119 41.7 1 Q.SEKLRNEVERIQK.M * 122805-Holinger-05_itms_11.08822.08822.3 2.9166 0.1818 90.3 1759.9783 1761.0496 5311.9 1 3.885 42.3 1 Q.SEKLRNEVERIQKM.I * 122805-Holinger-02_itms_5.04336.04336.2 2.82 0.0971 90.4 1189.5918 1190.2523 7047.8 14 3.759 70.0 1 L.IEKVDDTAANN.G * 122805-Holinger-02_itms_5.04460.04460.2 3.0182 0.2398 98.6 1741.8715 1741.8552 3889.7 1 4.48 56.7 1 E.KVDDTAANNGDKDHLK.L * 122805-Holinger-03_itms_8.06012.06012.2 5.184 0.3237 100.0 1953.0632 1954.1472 6604.5 1 6.945 58.8 1 E.KVDDTAANNGDKDHLKLV.S * 122805-Holinger-03_itms_8.05802.05802.2 2.521 0.2224 97.6 1024.5967 1025.193 4586.0 3 4.326 81.2 2 N.GDKDHLKLV.S * 122805-Holinger-03_itms_7.05490.05490.2 2.6114 0.1352 97.5 1111.6283 1112.2712 3314.5 321 4.312 55.6 1 N.GDKDHLKLVS.L * 122805-Holinger-03_itms_7.05502.05502.1 2.2964 0.2664 95.4 1111.6329 1112.2712 4817.8 11 4.987 55.6 1 N.GDKDHLKLVS.L * 122805-Holinger-04_itms_10.07383.07383.2 3.8844 0.2757 100.0 1744.9757 1745.9707 6291.6 1 6.246 75.0 1 F.VKQKNDSLEKTINDL.Q * 122805-Holinger-02_itms_10.07529.07529.2 2.8044 0.3188 100.0 1517.8064 1518.6641 3367.2 1 6.214 79.2 1 K.QKNDSLEKTINDL.Q * 122805-Holinger-03_itms_10.07363.07363.2 2.2936 0.1179 95.4 1645.8682 1646.7948 4396.2 5 4.08 53.8 1 K.QKNDSLEKTINDLQ.R * 122805-Holinger-02_itms_10.07528.07528.2 3.5452 0.1228 99.3 1389.746 1390.5333 6906.8 2 4.796 72.7 1 Q.KNDSLEKTINDL.Q * 122805-Holinger-02_itms_5.04932.04932.2 3.0453 0.3891 100.0 1244.5675 1245.2947 6333.3 2 6.714 77.8 1 Q.TLSEKEYQCS.A * 122805-Holinger-05_itms_14.10047.10047.2 3.4801 0.1644 99.3 1948.105 1949.2518 8991.0 3 4.714 46.9 2 S.AVIIDEFKDITKEVTQV.N * 122805-Holinger-02_itms_13.09548.09548.2 3.1208 0.2731 99.5 1649.927 1650.9097 10030.4 1 5.087 69.2 1 A.VIIDEFKDITKEVT.Q * 122805-Holinger-04_itms_14.09566.09566.2 3.0528 0.1221 92.6 1877.0631 1878.173 9762.7 4 3.873 46.7 1 A.VIIDEFKDITKEVTQV.N * 122805-Holinger-05_itms_12.09315.09315.3 3.1531 0.1927 99.5 1877.0652 1878.173 4776.7 247 4.618 35.0 1 A.VIIDEFKDITKEVTQV.N * 122805-Holinger-02_itms_12.08580.08580.2 3.5191 0.1747 95.7 1550.8562 1551.7771 7427.7 1 4.111 70.8 1 V.IIDEFKDITKEVT.Q * 122805-Holinger-02_itms_8.06260.06260.1 2.55 0.1357 98.2 1209.6757 1210.3696 3912.7 1 5.426 61.1 1 D.EFKDITKEVT.Q * 122805-Holinger-02_itms_10.07499.07499.2 3.4508 0.2855 99.8 1436.7877 1437.6329 3674.0 9 5.242 59.1 4 D.EFKDITKEVTQV.N * 122805-Holinger-02_itms_9.06895.06895.2 3.2433 0.1902 94.8 1550.8318 1551.7368 4351.4 20 4.019 58.3 1 D.EFKDITKEVTQVN.I * 122805-Holinger-05_itms_6.05672.05672.2 3.4385 0.2648 99.7 1593.8894 1594.8082 8185.6 1 5.199 75.0 1 K.SLKNVTEKNREIY.K * 122805-Holinger-04_itms_5.04788.04788.2 3.2839 0.1046 98.1 1521.8302 1522.7013 5037.3 1 4.39 72.7 1 K.NVTEKNREIYKQ.L * 122805-Holinger-02_itms_7.05629.05629.3 3.7297 0.2594 99.3 1500.7998 1501.6395 8057.5 47 4.917 47.7 1 Q.LNDRQEEISRLQ.R * 122805-Holinger-02_itms_7.05637.05637.2 2.9242 0.158 97.4 1500.8025 1501.6395 5210.8 2 4.294 63.6 2 Q.LNDRQEEISRLQ.R * 122805-Holinger-03_itms_7.05550.05550.2 2.768 0.0981 99.1 1387.7148 1388.4801 4638.7 23 4.662 65.0 1 L.NDRQEEISRLQ.R * 122805-Holinger-03_itms_6.05027.05027.2 2.735 0.1451 91.3 1001.5917 1002.15875 3002.2 36 3.801 85.7 1 L.QRDLIQTK.E * 122805-Holinger-04_itms_5.04972.04972.2 3.4642 0.1669 99.1 1293.6797 1294.4099 5695.9 1 4.666 83.3 1 C.KQRYQDLSQQ.Q * 122805-Holinger-04_itms_5.04985.04985.2 4.5757 0.1971 99.4 1786.9988 1788.011 7561.4 1 4.868 67.9 2 L.SQQQKDAQKKDIEKL.T * 122805-Holinger-05_itms_7.06465.06465.3 2.7723 0.2445 100.0 2032.0933 2033.2516 5745.0 152 5.238 31.2 1 A.ENANADLENKFNRLKKQ.A * 122805-Holinger-04_itms_8.06398.06398.2 3.8408 0.1768 97.9 1461.8063 1462.6487 4387.4 1 4.362 72.7 1 A.NADLENKFNRLK.K * 122805-Holinger-04_itms_4.03739.03739.2 3.4464 0.341 100.0 1254.7025 1255.4166 5309.7 2 6.476 75.0 1 Q.AHEKLDASKKQ.Q * 122805-Holinger-04_itms_5.04761.04761.2 3.3639 0.1056 91.6 1187.6847 1188.3666 5193.3 33 3.811 72.2 3 L.KAIKDKLEQD.L * 122805-Holinger-04_itms_8.06483.06483.2 3.3462 0.0801 95.0 1300.7704 1301.526 5375.2 7 4.031 75.0 2 L.KAIKDKLEQDL.H * 122805-Holinger-05_itms_6.05809.05809.2 3.4702 0.1772 99.5 1437.8312 1438.6671 6886.1 1 5.089 81.8 1 L.KAIKDKLEQDLH.F * 122805-Holinger-05_itms_18.12405.12405.3 4.6413 0.2992 100.0 1713.9503 1714.9591 6260.3 1 5.551 53.8 25 L.KAIKDKLEQDLHFE.N * 122805-Holinger-05_itms_13.09547.09547.2 4.4176 0.2246 100.0 1713.9514 1714.9591 7982.4 1 5.733 69.2 29 L.KAIKDKLEQDLHFE.N * 122805-Holinger-05_itms_12.09062.09062.2 4.5021 0.3268 100.0 1899.034 1900.1417 7439.9 1 6.111 60.0 20 L.KAIKDKLEQDLHFENA.K * 122805-Holinger-05_itms_13.09479.09479.3 3.702 0.2006 99.4 1899.0344 1900.1417 5364.6 1 4.819 38.3 15 L.KAIKDKLEQDLHFENA.K * 122805-Holinger-04_itms_11.08161.08161.3 2.6496 0.086 90.0 1456.8021 1457.6696 6129.9 7 3.874 47.7 1 K.AIKDKLEQDLHF.E * 122805-Holinger-03_itms_13.08697.08697.3 3.8371 0.2525 100.0 1585.8505 1586.785 6369.6 4 5.71 52.1 4 K.AIKDKLEQDLHFE.N * 122805-Holinger-03_itms_12.08427.08427.2 3.8953 0.2954 100.0 1585.8523 1586.785 8306.5 1 6.195 66.7 12 K.AIKDKLEQDLHFE.N * 122805-Holinger-03_itms_12.08420.08420.2 4.1514 0.3233 100.0 1770.9377 1771.9677 7062.7 1 6.617 64.3 4 K.AIKDKLEQDLHFENA.K * 122805-Holinger-04_itms_8.06430.06430.3 4.0705 0.2008 100.0 1357.828 1358.6212 6939.4 2 5.027 59.1 1 E.NAKVIDLDTKLK.A * 122805-Holinger-04_itms_8.06435.06435.2 4.0154 0.2656 100.0 1357.8291 1358.6212 5294.4 1 5.691 77.3 1 E.NAKVIDLDTKLK.A * 122805-Holinger-03_itms_7.05533.05533.2 2.385 0.1414 97.0 931.56165 932.1051 4587.6 2 4.222 85.7 1 A.KVIDLDTK.L * 122805-Holinger-04_itms_8.06249.06249.2 4.0887 0.1749 92.7 1172.7449 1173.4386 7707.3 1 3.876 88.9 4 A.KVIDLDTKLK.A * 122805-Holinger-02_itms_7.05714.05714.3 2.7756 0.1366 91.0 2321.1357 2322.4502 5790.4 5 3.904 36.1 1 H.ELQSEDVSRDHEKDTYRTL.M * 122805-Holinger-02_itms_5.04517.04517.2 3.3715 0.1965 100.0 1736.8127 1737.7802 8104.8 4 5.695 57.7 1 Q.SEDVSRDHEKDTYR.T * 122805-Holinger-02_itms_5.04624.04624.2 3.2503 0.3101 99.8 1837.8619 1838.8851 6974.9 4 5.247 50.0 1 Q.SEDVSRDHEKDTYRT.L * 122805-Holinger-02_itms_6.05165.05165.2 2.8623 0.3258 99.5 1950.9518 1952.0447 7721.6 2 5.031 46.7 1 Q.SEDVSRDHEKDTYRTL.M * 122805-Holinger-03_itms_5.04353.04353.2 3.0644 0.0836 98.8 1520.7366 1521.5864 5701.3 1 4.532 68.2 3 E.DVSRDHEKDTYR.T * 122805-Holinger-03_itms_5.04489.04489.2 3.0176 0.0806 97.0 1621.7848 1622.6915 6828.0 1 4.25 66.7 2 E.DVSRDHEKDTYRT.L * 122805-Holinger-03_itms_7.05379.05379.2 2.9202 0.257 99.1 1734.875 1735.851 6419.0 7 4.661 53.8 4 E.DVSRDHEKDTYRTL.M * 122805-Holinger-02_itms_8.06360.06360.2 1.9434 0.0938 95.4 809.41833 809.8944 4968.7 9 4.071 91.7 1 S.SDAFEKL.K * 122805-Holinger-05_itms_4.04415.04415.2 3.7023 0.2272 99.4 1357.8052 1358.5809 7577.0 1 4.961 85.0 2 R.IKEAEENLKKR.I * 122805-Holinger-04_itms_7.05639.05639.2 2.6054 0.1064 94.6 999.57605 1000.1429 3989.1 39 3.993 71.4 1 R.IRLPSEER.I * 122805-Holinger-02_itms_7.05712.05712.3 3.8175 0.3252 100.0 1364.7001 1365.4857 6674.9 10 6.193 52.8 2 K.RKEELEEEFR.K * 122805-Holinger-03_itms_8.06155.06155.2 3.3061 0.1625 99.8 1364.7046 1365.4857 6087.0 1 5.442 83.3 2 K.RKEELEEEFR.K * 122805-Holinger-04_itms_7.05826.05826.3 3.4842 0.1333 99.2 1492.8004 1493.6598 6687.1 6 4.378 55.0 1 K.RKEELEEEFRK.K * 122805-Holinger-04_itms_7.05834.05834.2 3.2289 0.247 99.4 1492.8025 1493.6598 4358.9 1 4.952 75.0 2 K.RKEELEEEFRK.K * 122805-Holinger-03_itms_12.08123.08123.2 4.6392 0.2398 100.0 2704.187 2705.7217 4123.7 6 6.662 34.8 1 L.TFLDNKGSGEDAEEELWNS*PSKGN.S * 122805-Holinger-03_itms_12.08101.08101.3 7.4347 0.4105 100.0 3351.6016 3352.509 5958.1 1 8.254 35.8 1 L.TFLDNKGSGEDAEEELWNSPSKGNSERPSAV.A * 122805-Holinger-03_itms_12.08036.08036.3 5.3696 0.3693 100.0 3421.6362 3423.588 8802.4 1 6.258 29.8 1 L.TFLDNKGSGEDAEEELWNSPSKGNSERPSAVA.G * 122805-Holinger-03_itms_12.08087.08087.3 5.7755 0.2613 100.0 3430.5698 3432.509 3541.8 1 5.491 29.2 2 L.TFLDNKGSGEDAEEELWNSPS*KGNSERPSAV.A * 122805-Holinger-03_itms_12.08029.08029.3 4.9624 0.3936 100.0 3502.6057 3503.588 4119.1 1 6.473 23.4 2 L.TFLDNKGSGEDAEEELWNS*PSKGNSERPSAVA.G * 122805-Holinger-03_itms_11.07984.07984.3 4.6215 0.3417 100.0 3558.625 3560.6396 5218.6 1 5.503 25.0 1 L.TFLDNKGSGEDAEEELWNS*PSKGNSERPSAVAG.F * 122805-Holinger-04_itms_10.07691.07691.3 5.0308 0.3648 100.0 3330.531 3331.4038 4177.9 38 6.071 25.0 1 T.FLDNKGSGEDAEEELWNS*PSKGNSERPSAV.A * 122805-Holinger-02_itms_9.06983.06983.2 5.4287 0.3785 100.0 1905.8439 1906.914 8715.1 1 8.143 58.8 1 K.GSGEDAEEELWNSPSKGN.S * 122805-Holinger-02_itms_9.07182.07182.2 4.8624 0.3483 100.0 1985.8098 1986.914 9040.5 1 7.192 52.9 2 K.GSGEDAEEELWNS*PSKGN.S * 122805-Holinger-03_itms_10.07387.07387.2 3.5666 0.3179 90.0 2783.23 2784.7803 3431.2 2 5.287 38.0 1 K.GSGEDAEEELWNS*PSKGNSERPSAVA.G * 122805-Holinger-05_itms_6.05916.05916.2 3.7376 0.207 99.4 1728.8988 1729.89 7735.7 22 4.846 53.3 1 E.LWNSPSKGNSERPSAV.A * 122805-Holinger-05_itms_6.05874.05874.2 4.187 0.1738 99.9 1799.9382 1800.9689 7310.6 1 5.475 62.5 1 E.LWNSPSKGNSERPSAVA.G * 122805-Holinger-05_itms_5.05262.05262.2 3.6185 0.2522 99.5 1667.9425 1668.8906 7028.8 1 5.034 69.2 1 K.NLKPQEQLKNVKND.V * 122805-Holinger-05_itms_8.06827.06827.2 3.8349 0.1912 100.0 2317.2244 2318.5486 6385.8 1 5.857 52.6 1 K.NLKPQEQLKNVKNDVSFNDS.Q * 122805-Holinger-05_itms_8.06781.06781.2 4.0761 0.293 100.0 2445.2817 2446.6792 6222.2 1 6.008 52.5 1 K.NLKPQEQLKNVKNDVSFNDSQ.S * 122805-Holinger-05_itms_8.06764.06764.3 3.9776 0.2403 99.3 2445.282 2446.6792 6842.6 1 4.907 35.0 1 K.NLKPQEQLKNVKNDVSFNDSQ.S * 122805-Holinger-02_itms_5.04840.04840.2 2.8978 0.238 99.8 1319.6866 1320.3989 6356.5 1 5.383 77.3 1 M.VTNKENNIVDSS.A * 122805-Holinger-03_itms_10.06961.06961.1 2.0404 0.2153 97.3 847.48285 847.9896 2922.8 1 5.238 71.4 1 A.GNKAIPTF.S * 122805-Holinger-05_itms_12.09155.09155.2 3.307 0.2548 100.0 1211.6688 1212.4338 2790.8 1 5.684 75.0 4 K.AIPTFSFGKPF.F * 122805-Holinger-04_itms_12.08552.08552.1 1.795 0.2769 97.1 829.43896 829.97375 4575.0 1 5.01 83.3 1 T.FSFGKPF.F * 122805-Holinger-05_itms_12.09329.09329.2 2.1919 0.1844 96.2 1150.5791 1151.3068 6699.8 14 4.159 61.1 1 T.FSFGKPFFSS.N * 122805-Holinger-03_itms_10.07172.07172.2 2.8896 0.257 100.0 1528.8364 1529.6934 5687.0 1 5.578 61.5 1 A.SQSNINTNAPLRTL.N * 122805-Holinger-03_itms_10.07209.07209.2 3.1584 0.1003 99.3 1441.8038 1442.6151 4517.3 2 4.888 66.7 2 S.QSNINTNAPLRTL.N * 122805-Holinger-04_itms_9.07261.07261.2 3.9141 0.1741 99.4 1226.7079 1227.4061 7208.3 1 4.925 80.0 2 S.NINTNAPLRTL.N * 122805-Holinger-04_itms_9.07265.07265.1 2.3827 0.2328 90.4 1226.7085 1227.4061 3255.0 2 4.734 60.0 1 S.NINTNAPLRTL.N * 122805-Holinger-03_itms_8.06277.06277.2 2.5825 0.2267 98.7 885.5305 886.03906 3925.4 14 4.522 85.7 2 N.TNAPLRTL.N * 122805-Holinger-02_itms_6.05421.05421.2 2.032 0.1751 94.1 1000.548 998.16736 4059.3 21 3.956 68.8 1 L.NIQPEVAVK.A * 122805-Holinger-02_itms_5.04311.04311.2 2.9263 0.0793 100.0 1121.5638 1122.1771 7788.8 2 5.581 80.0 1 L.TNNSTDGAKIT.E * 122805-Holinger-03_itms_5.03967.03967.2 2.8129 0.3966 100.0 1061.5837 1062.168 4033.8 1 6.551 77.8 3 T.SKRPIESGTS.S * 122805-Holinger-04_itms_4.03891.03891.2 2.7882 0.2738 99.8 1266.3875 1264.3348 5855.8 1 5.308 63.6 2 T.SKRPIESGTSSD.P * 122805-Holinger-04_itms_6.05243.05243.2 2.1406 0.1794 95.6 1360.7284 1361.4514 4021.0 335 4.102 45.8 1 T.SKRPIESGTSSDP.D * 122805-Holinger-04_itms_4.04234.04234.2 2.9022 0.184 99.6 1704.8722 1705.8192 3640.3 7 5.151 56.7 2 T.SKRPIESGTSSDPDTK.K * 122805-Holinger-05_itms_4.04778.04778.3 4.2011 0.3027 99.4 3202.6072 3204.3887 5063.9 9 4.907 25.9 1 T.SKRPIESGTSSDPDTKKVKESPANDQASNE.- * 122805-Holinger-02_itms_5.04366.04366.2 2.9571 0.3296 100.0 1946.9695 1948.0508 6048.6 1 5.524 52.9 1 G.TSSDPDTKKVKESPANDQ.A * 122805-Holinger-02_itms_5.04374.04374.2 3.0141 0.1954 98.5 1758.8821 1759.8676 4505.3 1 4.441 56.7 2 S.SDPDTKKVKESPANDQ.A * 122805-Holinger-02_itms_5.04450.04450.2 2.6254 0.1451 94.8 2160.0442 2161.244 3665.7 1 4.024 47.4 1 S.SDPDTKKVKESPANDQASNE.- YBR109C 13 17 40.8% 147 16135 4.3 U CMD1 SGDID:S000000313, Chr II from 458356-457913, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" * 122805-Holinger-03_itms_9.06539.06539.2 3.8584 0.2777 100.0 1358.7094 1359.4789 5346.1 1 5.834 75.0 1 M.RSLGLSPSEAEVN.D * 122805-Holinger-02_itms_12.08548.08548.2 2.8018 0.3254 100.0 1234.5471 1235.3081 5470.8 1 5.818 80.0 1 N.DLMNEIDVDGN.H * 122805-Holinger-02_itms_12.08540.08540.1 2.2585 0.1972 93.5 1234.5483 1235.3081 5840.0 1 4.877 65.0 1 N.DLMNEIDVDGN.H * 122805-Holinger-02_itms_11.07888.07888.2 4.9991 0.2444 100.0 1499.6716 1500.58 7622.5 1 5.691 87.5 1 N.DLMNEIDVDGNHQ.I * 122805-Holinger-03_itms_14.09203.09203.2 4.144 0.2311 99.3 1975.9065 1977.1096 8310.7 1 4.688 59.4 5 N.DLMNEIDVDGNHQIEFS.E * 122805-Holinger-02_itms_6.05539.05539.2 2.7645 0.1302 96.9 1271.5518 1272.3319 6647.0 3 4.215 80.0 1 L.MNEIDVDGNHQ.I * 122805-Holinger-03_itms_11.07919.07919.2 3.564 0.338 100.0 1747.7887 1748.8616 7566.6 1 6.929 60.7 1 L.MNEIDVDGNHQIEFS.E * 122805-Holinger-03_itms_7.05764.05764.2 2.4956 0.1612 100.0 1092.5865 1093.2249 4521.0 11 5.691 66.7 1 F.KVFDKNGDGL.I * 122805-Holinger-03_itms_9.06471.06471.2 3.7391 0.3025 100.0 1292.7095 1293.4624 6573.0 1 5.799 72.7 1 F.KVFDKNGDGLIS.A * 122805-Holinger-03_itms_21.13309.13309.2 2.5272 0.1618 94.6 2023.4122 2021.2471 5954.4 1 3.991 47.1 1 T.SIGEKLTDAEVDDMLREV.S * 122805-Holinger-02_itms_8.06724.06724.2 2.3037 0.1255 93.2 1164.54 1165.2604 6529.3 1 3.924 88.9 1 L.TDAEVDDMLR.E * 122805-Holinger-02_itms_12.08739.08739.2 3.8322 0.2626 100.0 1392.6545 1393.5084 6861.9 1 5.732 86.4 1 L.TDAEVDDMLREV.S * 122805-Holinger-02_itms_11.08313.08313.2 3.0517 0.361 100.0 1176.5753 1177.3148 6915.2 4 6.79 77.8 1 D.AEVDDMLREV.S YMR055C 23 51 38.6% 306 35028 8.6 U BUB2 SGDID:S000004659, Chr XIII from 387020-386100, reverse complement, Verified ORF, "Mitotic exit network regulator, forms GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and spindle pole bodies, blocks cell cycle progression before anaphase in response to spindle and kinetochore damage" * 122805-Holinger-02_itms_18.11847.11847.2 2.5911 0.1282 98.7 1524.8827 1525.7826 4233.1 56 4.523 46.2 1 M.TSIEDLISNPPLLL.H * 122805-Holinger-03_itms_16.10506.10506.2 4.7414 0.3357 100.0 1661.9427 1662.9237 4693.8 1 7.41 71.4 7 M.TSIEDLISNPPLLLH.S * 122805-Holinger-03_itms_15.10232.10232.2 3.4278 0.0874 99.4 1560.8921 1561.8186 5330.8 1 4.927 65.4 4 T.SIEDLISNPPLLLH.S * 122805-Holinger-05_itms_9.07323.07323.2 2.7798 0.1387 96.2 1003.6118 1004.21747 4195.4 4 4.153 87.5 1 L.ISNPPLLLH.S * 122805-Holinger-04_itms_8.06496.06496.2 2.7938 0.1643 95.5 2098.1628 2099.3518 6530.8 30 4.084 44.1 1 L.ILSEGLPISEDKQQQRTR.C * 122805-Holinger-02_itms_6.05257.05257.2 3.1653 0.3197 100.0 1614.8492 1615.7404 6536.8 1 6.192 69.2 1 L.SEGLPISEDKQQQR.T * 122805-Holinger-03_itms_7.05364.05364.2 3.2872 0.0859 95.1 1871.9895 1873.033 5298.7 35 4.038 56.7 1 L.SEGLPISEDKQQQRTR.C * 122805-Holinger-03_itms_7.05342.05342.3 2.2423 0.0671 96.8 1871.996 1873.033 2771.4 127 4.207 35.0 1 L.SEGLPISEDKQQQRTR.C * 122805-Holinger-03_itms_7.05297.05297.2 3.1592 0.2827 100.0 1398.7554 1399.5468 3949.4 2 6.816 63.6 1 E.GLPISEDKQQQR.T * 122805-Holinger-05_itms_7.06125.06125.1 1.7822 0.2363 93.5 913.5513 914.08984 4417.6 1 4.878 56.2 1 L.LKLGPPSTT.I * 122805-Holinger-05_itms_5.04936.04936.1 2.0501 0.2682 94.7 800.46576 800.93036 4358.4 2 4.928 57.1 1 L.KLGPPSTT.I * 122805-Holinger-05_itms_6.05748.05748.2 2.7457 0.2392 98.5 1615.7405 1614.8418 3109.0 9 4.437 54.2 1 T.IYQKIKNDTSRTF.Q * 122805-Holinger-02_itms_7.05888.05888.2 2.9213 0.0967 99.3 902.5099 903.0232 4068.5 4 4.818 92.9 1 R.VSEDALIR.C * 122805-Holinger-04_itms_10.07283.07283.2 2.1513 0.1038 92.2 1039.5752 1040.2072 4248.6 72 3.854 62.5 1 R.FGRIPVSTY.V * 122805-Holinger-05_itms_12.08962.08962.2 3.1981 0.1902 97.2 1600.8844 1601.8523 5779.2 5 4.269 58.3 1 S.SCNKPLDQVIKLW.D * 122805-Holinger-05_itms_12.08905.08905.2 2.5644 0.0454 92.8 1353.8002 1354.6353 8487.7 6 3.879 60.0 1 C.NKPLDQVIKLW.D * 122805-Holinger-04_itms_9.06729.06729.2 2.4949 0.1068 97.5 1128.6584 1129.3018 4158.7 1 4.31 83.3 1 F.KSDSPVNLLR.Q * 122805-Holinger-04_itms_10.07412.07412.2 2.3192 0.1611 96.4 1110.5062 1111.1558 5211.1 168 4.164 62.5 2 L.RQFPDFDAD.E * 122805-Holinger-03_itms_12.08539.08539.3 4.615 0.2236 100.0 1621.8237 1622.7777 6702.3 1 5.463 64.6 2 L.RQFPDFDADEIIR.L * 122805-Holinger-03_itms_13.08700.08700.2 4.5913 0.2747 100.0 1621.8271 1622.7777 7975.0 1 6.144 83.3 3 L.RQFPDFDADEIIR.L * 122805-Holinger-05_itms_24.15969.15969.2 2.9926 0.1685 94.6 1734.9147 1735.9371 6630.0 2 4.011 57.7 12 L.RQFPDFDADEIIRL.G * 122805-Holinger-03_itms_16.10455.10455.2 2.8032 0.1491 98.6 1578.8092 1579.7496 4991.9 1 4.478 66.7 5 R.QFPDFDADEIIRL.G * 122805-Holinger-04_itms_13.09484.09484.2 3.6328 0.0754 97.1 1173.7104 1174.4258 5772.1 1 4.261 88.9 1 A.KIPAQIYDLL.V YHR072W-A 2 2 36.2% 58 6636 10.2 U NOP10 SGDID:S000007455, Chr VIII from 241666-241842, Verified ORF, "Constituent of small nucleolar ribonucleoprotein particles containing H/ACA-type snoRNAs, which are required for pseudouridylation and processing of pre-18S rRNA" * 122805-Holinger-03_itms_9.06405.06405.2 1.7659 0.238 96.1 1285.6968 1283.4697 5193.6 1 4.15 65.0 1 M.YTLGPDGKRIY.T * 122805-Holinger-05_itms_5.04988.04988.2 3.8054 0.3317 100.0 1270.6394 1271.375 5198.6 1 6.503 88.9 1 A.RFSPDDKYSR.Q YJR053W 32 64 35.4% 574 66087 5.9 U BFA1 SGDID:S000003814, Chr X from 533941-535665, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis" * 122805-Holinger-02_itms_13.09544.09544.2 2.9881 0.1313 98.1 1694.7905 1694.7894 7963.2 1 4.389 71.4 1 L.TLNGLDEPETSFEEL.N * 122805-Holinger-02_itms_12.08964.08964.2 2.4908 0.1894 97.4 1365.6296 1366.421 4934.4 4 4.295 63.6 1 N.GLDEPETSFEEL.N * 122805-Holinger-02_itms_11.08405.08405.1 2.2053 0.2594 97.6 1195.5227 1196.2097 5015.4 69 5.154 55.6 1 L.DEPETSFEEL.N * 122805-Holinger-02_itms_7.06155.06155.1 2.0342 0.108 90.2 1205.629 1206.3379 1977.9 1 4.712 63.6 1 S.TYIPPPSSVGTS.D * 122805-Holinger-03_itms_14.09329.09329.2 6.2773 0.346 100.0 2532.048 2533.5496 8813.0 1 7.154 57.5 4 N.KQADDDQDMEVDQDDEFLNDF.Q * 122805-Holinger-02_itms_14.10050.10050.2 4.5582 0.414 100.0 2275.885 2277.2446 6477.6 1 7.424 58.3 1 Q.ADDDQDMEVDQDDEFLNDF.Q * 122805-Holinger-02_itms_13.09437.09437.2 2.7878 0.0634 96.4 1142.483 1143.1516 5996.5 18 4.168 81.2 1 D.QDDEFLNDF.Q * 122805-Holinger-02_itms_6.05280.05280.2 2.8952 0.2504 99.4 1651.8196 1652.7582 2883.0 190 4.982 50.0 2 F.QNKKDDFDDAIKTN.F * 122805-Holinger-03_itms_7.05652.05652.2 3.3695 0.0892 100.0 1523.7618 1524.6274 4733.7 90 5.548 54.2 2 Q.NKKDDFDDAIKTN.F * 122805-Holinger-02_itms_6.05574.05574.2 2.3293 0.161 99.1 1066.5316 1067.1406 4489.2 3 4.657 81.2 2 K.KDDFDDAIK.T * 122805-Holinger-02_itms_7.05722.05722.2 3.5208 0.2526 99.8 1281.6091 1282.3495 6425.5 1 5.271 80.0 3 K.KDDFDDAIKTN.F * 122805-Holinger-05_itms_10.07847.07847.2 2.8536 0.2525 92.0 1520.553 1521.4045 4796.5 3 5.602 63.6 1 A.KFS*S*DDEGDFLT.G * 122805-Holinger-03_itms_8.06201.06201.2 3.1007 0.2336 99.4 1515.7457 1516.6102 5978.1 1 4.963 66.7 1 S.SNDKESADHPRFL.K * 122805-Holinger-03_itms_8.06218.06218.2 2.9862 0.1035 93.6 1428.7097 1429.5321 5242.5 1 3.941 77.3 1 S.NDKESADHPRFL.K * 122805-Holinger-03_itms_8.06322.06322.2 3.3123 0.1987 99.3 1314.6675 1315.4282 5914.7 1 4.708 85.0 2 N.DKESADHPRFL.K * 122805-Holinger-03_itms_10.07430.07430.2 3.062 0.2275 98.8 1099.6539 1100.3005 4694.3 30 4.549 75.0 1 S.SSSLPLKISPA.Q * 122805-Holinger-04_itms_8.06230.06230.2 3.2972 0.3696 100.0 1259.6957 1260.4355 5869.0 1 6.317 85.0 1 V.KHDELLTPGLH.R * 122805-Holinger-04_itms_8.06218.06218.1 2.7592 0.299 97.3 1259.6965 1260.4355 5038.2 5 5.737 55.0 1 V.KHDELLTPGLH.R * 122805-Holinger-05_itms_5.05466.05466.2 3.3882 0.1067 90.3 1510.8656 1511.7214 7740.2 4 3.744 65.4 1 C.SNQNVQLNGPAKIK.T * 122805-Holinger-05_itms_4.04106.04106.2 2.2221 0.1804 98.4 1140.609 1141.3306 4147.1 24 4.425 66.7 1 Q.IDHNTPMKKG.S * 122805-Holinger-03_itms_7.05562.05562.2 1.9536 0.1216 94.4 866.4585 867.05084 4076.0 177 3.981 75.0 1 M.IYNPKTM.K * 122805-Holinger-03_itms_11.08023.08023.2 4.1406 0.2398 100.0 1450.7566 1451.622 7354.0 1 5.913 77.3 2 M.KWEGNENVLSKF.S * 122805-Holinger-05_itms_5.05036.05036.2 3.285 0.1958 99.8 1794.9677 1795.9902 6065.5 4 5.364 53.6 1 K.LQRDADSKKQKYSDL.Q * 122805-Holinger-02_itms_14.10077.10077.2 4.3435 0.2843 99.8 2308.2112 2309.5781 6046.0 1 5.2 57.1 4 S.VSEEEADPFAGIPEINLPPVGK.S * 122805-Holinger-02_itms_14.10057.10057.3 3.0027 0.1299 90.0 2308.2146 2309.5781 6038.3 9 3.846 29.8 1 S.VSEEEADPFAGIPEINLPPVGK.S * 122805-Holinger-02_itms_15.10427.10427.2 5.0188 0.407 100.0 2526.2922 2527.8489 5828.2 1 7.486 56.5 2 S.VSEEEADPFAGIPEINLPPVGKSM.K * 122805-Holinger-02_itms_14.10103.10103.2 2.9262 0.1844 99.3 2122.1365 2123.3672 6091.0 2 4.752 50.0 1 S.EEEADPFAGIPEINLPPVGK.S * 122805-Holinger-03_itms_12.08562.08562.2 3.3584 0.1723 99.8 1304.7805 1305.5602 3514.0 1 5.366 79.2 12 F.AGIPEINLPPVGK.S * 122805-Holinger-04_itms_11.08259.08259.1 2.7085 0.2259 98.5 1304.7817 1305.5602 7255.1 1 5.313 58.3 2 F.AGIPEINLPPVGK.S * 122805-Holinger-04_itms_11.08298.08298.2 2.9323 0.1298 99.8 1391.8124 1392.6384 4283.7 1 5.384 69.2 4 F.AGIPEINLPPVGKS.M * 122805-Holinger-04_itms_12.08789.08789.2 3.2662 0.4212 100.0 1521.8916 1523.8309 5715.7 1 7.24 75.0 3 F.AGIPEINLPPVGKSM.K * 122805-Holinger-03_itms_14.09216.09216.2 3.1284 0.1182 97.0 1463.7795 1464.661 4627.9 9 4.231 68.2 2 A.SWFIPRDETIIS.V YOR373W 95 261 34.3% 851 94104 7.0 U NUD1 SGDID:S000005900, Chr XV from 1036830-1039385, Verified ORF, "Component of the spindle pole body outer plaque, required for exit from mitosis" * 122805-Holinger-04_itms_5.04889.04889.2 2.9467 0.291 99.5 946.49005 947.03845 3837.6 6 5.081 75.0 1 N.AHSNSGKVF.K * 122805-Holinger-04_itms_5.04854.04854.1 2.4096 0.2912 98.2 946.4926 947.03845 4214.5 3 5.433 75.0 1 N.AHSNSGKVF.K * 122805-Holinger-04_itms_6.05432.05432.1 2.5547 0.3418 98.6 1303.7151 1304.5444 5767.7 1 5.276 63.6 1 A.ISDSVKKPPTMT.V * 122805-Holinger-04_itms_6.05416.05416.2 3.7799 0.3442 100.0 1303.7151 1304.5444 6210.3 1 5.842 81.8 3 A.ISDSVKKPPTMT.V * 122805-Holinger-04_itms_8.06270.06270.2 3.338 0.2793 100.0 1402.7858 1403.677 6287.0 4 5.71 54.2 2 A.ISDSVKKPPTMTV.L * 122805-Holinger-05_itms_6.06009.06009.2 2.499 0.1755 99.3 1822.9058 1823.9597 7046.1 1 4.735 56.2 1 L.NNYSTVHQKVPSGFSGT.T * 122805-Holinger-05_itms_6.05513.05513.2 2.485 0.3303 99.8 1431.7496 1432.576 7513.9 3 5.429 57.7 1 Y.STVHQKVPSGFSGT.T * 122805-Holinger-05_itms_6.05549.05549.2 3.297 0.3034 100.0 1532.7999 1533.6812 6738.4 2 6.147 53.6 1 Y.STVHQKVPSGFSGTT.A * 122805-Holinger-04_itms_7.05736.05736.2 1.7229 0.2414 97.5 1099.609 1100.2627 4277.8 56 4.292 55.6 1 S.TVHQKVPSGF.S * 122805-Holinger-05_itms_6.05511.05511.1 2.4452 0.3195 97.7 999.56464 999.1576 4394.0 2 5.581 68.8 1 T.VHQKVPSGF.S * 122805-Holinger-05_itms_5.05367.05367.2 2.9181 0.2687 99.5 1243.6667 1244.3928 6331.7 2 5.008 68.2 1 T.VHQKVPSGFSGT.T * 122805-Holinger-05_itms_5.05402.05402.2 2.3715 0.1612 98.7 899.4903 900.025 5503.9 2 4.489 85.7 1 V.HQKVPSGF.S * 122805-Holinger-03_itms_13.08805.08805.2 3.4455 0.4309 100.0 1782.8788 1783.9377 6589.3 1 6.749 50.0 1 Q.EAQWKQYFPGIGSGGGT.N * 122805-Holinger-05_itms_10.08165.08165.2 2.5259 0.3094 100.0 1095.5831 1096.2737 4873.7 5 5.591 87.5 2 Q.WKQYFPGIG.S * 122805-Holinger-04_itms_12.08413.08413.1 2.4093 0.345 100.0 1095.5834 1096.2737 4560.7 1 6.095 75.0 2 Q.WKQYFPGIG.S * 122805-Holinger-04_itms_11.08279.08279.2 2.9789 0.2377 99.5 1182.6158 1183.3519 4746.1 1 5.014 88.9 2 Q.WKQYFPGIGS.G * 122805-Holinger-04_itms_11.08221.08221.2 2.6636 0.2198 99.5 1239.6376 1240.4038 5209.2 1 5.092 80.0 1 Q.WKQYFPGIGSG.G * 122805-Holinger-05_itms_10.07886.07886.2 4.4886 0.392 100.0 1296.6627 1297.4557 4704.9 1 6.708 81.8 4 Q.WKQYFPGIGSGG.G * 122805-Holinger-05_itms_10.07799.07799.1 3.2908 0.3386 100.0 1454.7335 1455.6128 6282.7 1 6.386 65.4 2 Q.WKQYFPGIGSGGGT.N * 122805-Holinger-04_itms_11.08069.08069.2 3.6812 0.3565 100.0 1454.7336 1455.6128 4719.3 1 7.053 73.1 3 Q.WKQYFPGIGSGGGT.N * 122805-Holinger-03_itms_13.08611.08611.2 2.7405 0.3009 95.5 1534.702 1535.6128 5878.7 1 5.638 57.7 2 Q.WKQYFPGIGS*GGGT.N * 122805-Holinger-05_itms_9.07728.07728.2 2.9703 0.2549 99.3 1568.7784 1569.7166 6270.1 1 4.712 60.7 1 Q.WKQYFPGIGSGGGTN.F * 122805-Holinger-05_itms_11.08572.08572.2 3.2114 0.3022 99.8 1715.8523 1716.8932 5420.6 1 5.425 63.3 1 Q.WKQYFPGIGSGGGTNF.G * 122805-Holinger-04_itms_9.07239.07239.2 2.3433 0.2853 100.0 1110.5778 1111.2426 3836.8 3 5.667 60.0 1 W.KQYFPGIGSGG.G * 122805-Holinger-04_itms_9.07175.07175.2 2.1761 0.0963 96.1 1270.6564 1269.3995 7197.3 3 4.147 54.2 1 W.KQYFPGIGSGGGT.N * 122805-Holinger-02_itms_10.07511.07511.1 1.6342 0.2349 97.9 854.4187 854.93774 2216.7 5 5.536 50.0 1 Q.YFPGIGSGG.G * 122805-Holinger-02_itms_10.07412.07412.1 1.6489 0.0895 91.7 1012.48804 1013.0947 2774.0 1 4.795 60.0 1 Q.YFPGIGSGGGT.N * 122805-Holinger-02_itms_8.06517.06517.2 2.3304 0.131 96.1 1271.7047 1272.441 6280.7 34 4.139 63.6 1 T.ANKVPESDLIVS.D * 122805-Holinger-02_itms_8.06420.06420.2 2.2809 0.1874 95.3 1200.6635 1201.3623 6247.1 36 4.067 65.0 1 A.NKVPESDLIVS.D * 122805-Holinger-02_itms_8.06441.06441.2 2.6687 0.0433 90.2 1086.6323 1087.2584 3239.6 118 3.738 66.7 1 N.KVPESDLIVS.D * 122805-Holinger-02_itms_8.06598.06598.2 2.5689 0.2125 96.6 1201.6498 1202.347 4028.8 1 4.185 75.0 1 N.KVPESDLIVSD.L * 122805-Holinger-02_itms_6.05137.05137.2 2.6049 0.2049 95.3 1253.5995 1254.2987 3315.2 2 4.045 75.0 1 Q.THENHDTISIS.H * 122805-Holinger-04_itms_8.06401.06401.2 2.6035 0.0489 95.3 1094.5079 1095.1564 3639.3 2 4.065 75.0 1 S.HSKDFFNAE.K * 122805-Holinger-04_itms_8.06399.06399.1 2.1545 0.2835 91.8 1094.5098 1095.1564 4072.4 1 4.838 62.5 1 S.HSKDFFNAE.K * 122805-Holinger-02_itms_12.08634.08634.1 2.1544 0.1316 97.1 1114.5729 1115.231 3323.1 17 5.759 55.6 1 E.AHDVFDGILQ.K * 122805-Holinger-04_itms_9.07011.07011.2 2.5376 0.112 96.9 1852.9597 1854.0881 7389.0 2 4.216 55.9 1 A.TMVPTGDNHTNGKAPSIL.D * 122805-Holinger-05_itms_7.06519.06519.2 2.9623 0.1874 99.4 1751.9081 1752.983 4539.9 3 4.852 53.1 3 T.MVPTGDNHTNGKAPSIL.D * 122805-Holinger-03_itms_6.04797.04797.2 2.7837 0.2629 99.4 1180.6152 1181.2908 3954.6 1 4.919 80.0 2 L.TSTKPGDVGYR.Q * 122805-Holinger-03_itms_6.04764.04764.3 2.434 0.1517 92.9 1308.6753 1309.4215 3914.4 56 3.987 45.5 1 L.TSTKPGDVGYRQ.K * 122805-Holinger-03_itms_6.04762.04762.2 2.3258 0.3792 100.0 1308.6757 1309.4215 3608.8 3 6.777 63.6 1 L.TSTKPGDVGYRQ.K * 122805-Holinger-05_itms_4.04458.04458.2 2.759 0.3047 99.8 1436.7776 1437.5956 4708.9 1 5.427 70.8 1 L.TSTKPGDVGYRQK.K * 122805-Holinger-03_itms_6.04694.04694.1 2.3383 0.268 93.3 1079.5677 1080.1857 4310.8 1 4.897 66.7 1 T.STKPGDVGYR.Q * 122805-Holinger-03_itms_6.04703.04703.2 2.8477 0.3079 99.5 1079.5709 1080.1857 3077.1 1 5.087 83.3 2 T.STKPGDVGYR.Q * 122805-Holinger-03_itms_6.04676.04676.2 2.6642 0.3269 100.0 1207.6288 1208.3164 2905.8 4 5.826 65.0 1 T.STKPGDVGYRQ.K * 122805-Holinger-03_itms_6.04686.04686.1 1.9927 0.1995 94.6 1207.6288 1208.3164 4281.0 14 4.931 50.0 1 T.STKPGDVGYRQ.K * 122805-Holinger-03_itms_6.05121.05121.2 2.7559 0.1723 94.5 1517.7717 1518.6207 5795.5 3 3.989 66.7 1 Q.KKIQEEENLANSD.D * 122805-Holinger-02_itms_12.08542.08542.3 5.0869 0.3239 100.0 2746.3562 2747.9292 6851.3 1 6.342 38.0 3 K.KIQEEENLANSDDTPLDTPKFNDL.F * 122805-Holinger-02_itms_12.08741.08741.2 5.3834 0.4427 100.0 2377.109 2378.465 8013.8 1 8.391 52.5 1 Q.EEENLANSDDTPLDTPKFNDL.F * 122805-Holinger-03_itms_13.08924.08924.2 4.8507 0.4574 100.0 2457.0813 2458.465 8670.3 1 7.787 50.0 3 Q.EEENLANS*DDTPLDTPKFNDL.F * 122805-Holinger-02_itms_11.08286.08286.2 3.0283 0.1544 99.6 1691.8066 1692.7765 5577.6 9 5.147 50.0 1 A.NSDDTPLDTPKFNDL.F * 122805-Holinger-02_itms_6.05225.05225.2 3.1755 0.3387 100.0 1088.5254 1089.1443 4846.5 3 5.932 77.8 1 N.SDDTPLDTPK.F * 122805-Holinger-02_itms_11.08310.08310.2 4.418 0.2882 100.0 1577.7579 1578.6727 6388.7 1 6.352 76.9 3 N.SDDTPLDTPKFNDL.F * 122805-Holinger-03_itms_12.08502.08502.2 3.6404 0.3594 100.0 1657.7286 1658.6727 6861.7 1 6.131 61.5 2 N.SDDTPLDT*PKFNDL.F * 122805-Holinger-02_itms_14.09841.09841.2 3.0153 0.3039 100.0 1724.8312 1725.8492 7583.3 28 6.213 46.4 1 N.SDDTPLDTPKFNDLF.T * 122805-Holinger-01_itms_15.10853.10853.2 2.5192 0.3106 90.9 1737.6996 1738.6727 7136.1 13 5.232 46.2 1 N.S*DDTPLDT*PKFNDL.F * 122805-Holinger-03_itms_12.08412.08412.2 3.6655 0.2944 94.7 1737.6997 1738.6727 7312.5 1 5.673 57.7 1 N.SDDT*PLDT*PKFNDL.F * 122805-Holinger-02_itms_11.08399.08399.2 3.3762 0.1175 99.7 1375.699 1376.5059 4487.4 1 5.174 77.3 1 D.DTPLDTPKFNDL.F * 122805-Holinger-02_itms_11.08395.08395.1 3.3169 0.2666 100.0 1375.6993 1376.5059 5014.2 1 6.173 59.1 1 D.DTPLDTPKFNDL.F * 122805-Holinger-03_itms_10.07311.07311.2 3.5661 0.2823 100.0 1518.8397 1519.738 6918.0 1 5.727 70.8 4 K.LKTFPAERVEDIT.S * 122805-Holinger-03_itms_12.08106.08106.2 3.6748 0.4278 100.0 1805.9961 1807.0538 5092.8 1 6.708 46.7 3 K.LKTFPAERVEDITSIS.E * 122805-Holinger-03_itms_11.07604.07604.2 2.9785 0.3178 100.0 1692.9758 1693.8944 5980.6 7 5.881 42.9 1 L.KTFPAERVEDITSIS.E * 122805-Holinger-02_itms_14.09986.09986.2 3.262 0.1601 97.5 1434.8087 1435.6604 5374.9 3 4.316 77.3 3 S.FNETEKQLISIL.T * 122805-Holinger-03_itms_13.09042.09042.2 3.6821 0.3531 100.0 1911.9685 1913.0912 5939.9 1 6.345 53.1 1 T.SKLSGSPSYDSDWEKIL.K * 122805-Holinger-03_itms_13.09059.09059.2 3.6282 0.2477 99.8 1824.9352 1826.013 5929.2 1 5.314 63.3 2 S.KLSGSPSYDSDWEKIL.K * 122805-Holinger-02_itms_13.09396.09396.2 3.6746 0.1938 99.9 1583.748 1584.6794 7124.5 16 5.495 57.7 1 L.SGSPSYDSDWEKIL.K * 122805-Holinger-03_itms_14.09696.09696.2 3.4227 0.3439 95.8 1663.7196 1664.6794 6840.5 1 5.62 61.5 1 L.SGS*PSYDSDWEKIL.K * 122805-Holinger-03_itms_14.09375.09375.2 3.1297 0.1349 94.3 1723.8853 1724.9078 6171.7 5 3.972 53.6 1 S.GSPSYDSDWEKILKV.D * 122805-Holinger-02_itms_13.09271.09271.2 3.215 0.2011 99.5 1168.5728 1169.2762 5089.2 9 5.065 87.5 3 S.YDSDWEKIL.K * 122805-Holinger-05_itms_10.07976.07976.2 2.0402 0.0113 90.2 824.5505 825.0421 2773.8 27 3.739 83.3 1 Q.RLLPNVL.V * 122805-Holinger-02_itms_16.10751.10751.2 3.0437 0.1273 98.8 1832.9401 1833.9928 5678.3 1 4.585 53.3 1 L.NLSNNEINGIIDFEQL.I * 122805-Holinger-02_itms_15.10533.10533.2 2.869 0.2151 98.8 1290.6798 1291.4436 6203.1 7 4.596 75.0 1 N.EINGIIDFEQL.I * 122805-Holinger-03_itms_14.09312.09312.2 3.0873 0.303 100.0 1550.7455 1551.6953 3632.7 1 5.773 77.3 2 Q.NYKLDDQFTFPY.Q * 122805-Holinger-02_itms_13.09438.09438.2 2.3574 0.1814 99.3 1056.5537 1057.1913 4351.0 1 4.762 81.2 1 R.DFTHLPVDL.S * 122805-Holinger-02_itms_13.09430.09430.1 2.3305 0.2318 98.5 1056.555 1057.1913 3571.5 5 5.343 68.8 1 R.DFTHLPVDL.S * 122805-Holinger-03_itms_12.08068.08068.3 3.6489 0.3167 100.0 1271.6841 1272.4435 4015.8 1 6.666 67.5 1 R.DFTHLPVDLSK.E * 122805-Holinger-03_itms_12.08058.08058.2 3.2151 0.2257 98.8 1271.6865 1272.4435 6147.6 1 4.531 75.0 1 R.DFTHLPVDLSK.E * 122805-Holinger-05_itms_13.09925.09925.2 3.3831 0.2796 100.0 1757.9454 1759.0117 4987.4 1 5.673 64.3 3 R.DFTHLPVDLSKELPF.L * 122805-Holinger-05_itms_24.15943.15943.3 2.867 0.24 99.5 1999.0924 2000.3019 3476.1 1 4.67 39.1 1 R.DFTHLPVDLSKELPFLQ.E * 122805-Holinger-05_itms_15.10760.10760.2 3.7975 0.2389 100.0 1999.0939 2000.3019 6825.0 1 5.917 62.5 35 R.DFTHLPVDLSKELPFLQ.E * 122805-Holinger-05_itms_14.10228.10228.2 3.5826 0.2436 99.5 2128.139 2129.4172 5855.5 1 5.099 61.8 1 R.DFTHLPVDLSKELPFLQE.L * 122805-Holinger-03_itms_9.06366.06366.2 2.2506 0.0359 94.1 1009.57825 1010.1784 5178.2 1 3.958 81.2 1 F.THLPVDLSK.E * 122805-Holinger-03_itms_9.06348.06348.1 2.4578 0.2434 97.0 1009.5925 1010.1784 5096.0 2 5.77 68.8 1 F.THLPVDLSK.E * 122805-Holinger-03_itms_21.13238.13238.2 3.6732 0.2681 100.0 1495.8362 1496.7466 4434.8 1 6.486 79.2 6 F.THLPVDLSKELPF.L * 122805-Holinger-05_itms_24.16014.16014.2 4.2571 0.3714 100.0 1608.9316 1609.906 5651.1 1 6.611 80.8 19 F.THLPVDLSKELPFL.Q * 122805-Holinger-05_itms_12.09345.09345.2 4.4051 0.375 100.0 1736.9924 1738.0367 6322.1 1 6.226 67.9 68 F.THLPVDLSKELPFLQ.E * 122805-Holinger-04_itms_26.16666.16666.3 1.948 0.1741 98.8 1736.9935 1738.0367 3285.5 77 4.327 44.6 1 F.THLPVDLSKELPFLQ.E * 122805-Holinger-05_itms_13.09498.09498.2 3.2499 0.2496 100.0 1867.04 1867.1522 6867.8 1 5.517 63.3 5 F.THLPVDLSKELPFLQE.L * 122805-Holinger-03_itms_15.10287.10287.2 2.4717 0.207 99.3 1257.7349 1258.5004 6742.0 1 4.8 75.0 1 L.PVDLSKELPFL.Q * 122805-Holinger-03_itms_15.09834.09834.2 2.8634 0.1356 98.3 1385.7954 1386.6311 6162.0 7 4.41 68.2 2 L.PVDLSKELPFLQ.E * 122805-Holinger-04_itms_8.06703.06703.2 2.7598 0.191 98.6 1456.7555 1457.5889 4723.4 58 4.489 58.3 1 Q.ELHLPGNNLQNAH.K * 122805-Holinger-04_itms_7.06134.06134.2 2.7371 0.1497 90.4 1296.7235 1297.4569 3578.2 50 3.759 70.0 1 L.DLRNNPITTPR.H * 122805-Holinger-03_itms_6.05108.05108.2 2.2065 0.0447 91.2 912.50684 913.02136 3427.0 26 3.794 78.6 1 R.NNPITTPR.H * 122805-Holinger-02_itms_12.08788.08788.2 2.5496 0.1876 99.3 1230.6268 1230.3599 7908.3 2 4.736 70.0 1 A.TLWLDDTPAPT.A * 122805-Holinger-02_itms_12.08587.08587.2 2.2314 0.1687 97.2 1128.5748 1129.2548 6694.8 3 4.263 83.3 1 T.LWLDDTPAPT.A * 122805-Holinger-02_itms_9.07161.07161.1 2.0465 0.2275 95.5 1015.4949 1016.0954 4881.9 31 4.976 62.5 1 L.WLDDTPAPT.A YGR192C 35 54 34.0% 332 35747 7.0 U TDH3 SGDID:S000003424, Chr VII from 883815-882817, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 3, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " * 122805-Holinger-03_itms_6.05072.05072.2 4.1719 0.3895 100.0 1648.8596 1649.8009 7145.9 1 7.304 67.9 2 A.GEVSHDDKHIIVDGK.K * 122805-Holinger-04_itms_5.04891.04891.3 3.2612 0.2389 99.5 1776.9554 1777.975 7017.4 1 4.586 45.0 1 A.GEVSHDDKHIIVDGKK.I * 122805-Holinger-04_itms_5.04874.04874.2 3.2909 0.0763 99.5 1776.956 1777.975 6000.0 1 5.068 56.7 1 A.GEVSHDDKHIIVDGKK.I * 122805-Holinger-04_itms_8.06455.06455.3 5.2186 0.3404 100.0 1961.0809 1962.2131 6398.8 1 7.586 50.0 2 A.GEVSHDDKHIIVDGKKIA.T * 122805-Holinger-04_itms_8.06450.06450.2 3.7694 0.2644 100.0 1961.0824 1962.2131 7376.5 1 6.464 55.9 1 A.GEVSHDDKHIIVDGKKIA.T * 122805-Holinger-03_itms_6.04943.04943.2 4.0122 0.3526 100.0 1462.7913 1463.6334 5591.1 1 6.368 75.0 3 E.VSHDDKHIIVDGK.K 122805-Holinger-03_itms_6.05141.05141.2 2.4728 0.1572 98.6 1178.599 1179.2749 4251.8 39 4.463 66.7 1 V.SHDDKHIIVD.G * 122805-Holinger-03_itms_6.04853.04853.2 4.6657 0.3024 100.0 1363.7184 1364.5009 7605.2 1 6.995 81.8 2 V.SHDDKHIIVDGK.K * 122805-Holinger-04_itms_5.04670.04670.2 2.8409 0.21 99.6 1491.8201 1492.6749 4642.6 1 5.161 70.8 1 V.SHDDKHIIVDGKK.I 122805-Holinger-03_itms_6.05178.05178.2 2.4363 0.2144 99.7 1091.5657 1092.1967 3870.4 30 5.182 75.0 2 S.HDDKHIIVD.G * 122805-Holinger-03_itms_6.04839.04839.2 3.9075 0.3294 100.0 1276.6841 1277.4227 5311.5 1 6.99 80.0 2 S.HDDKHIIVDGK.K * 122805-Holinger-03_itms_6.04852.04852.3 3.0283 0.2018 100.0 1276.6854 1277.4227 4659.0 7 5.408 50.0 1 S.HDDKHIIVDGK.K * 122805-Holinger-02_itms_9.06999.06999.2 2.7533 0.1603 98.4 1573.8448 1571.6462 6270.1 1 4.426 61.5 2 Y.QERDPANLPWGSSN.V 122805-Holinger-03_itms_5.04008.04008.2 2.1706 0.161 90.4 1254.6663 1255.3732 7148.5 92 3.765 54.5 1 L.DTAQKHIDAGAK.K 122805-Holinger-02_itms_8.06247.06247.2 2.2276 0.1112 98.8 877.4913 878.0159 6178.0 2 4.541 85.7 1 L.AKVINDAF.G 122805-Holinger-05_itms_5.04937.04937.2 2.1355 0.1075 94.4 1297.6512 1298.4008 4323.6 19 3.986 65.0 1 K.TVDGPSHKDWR.G 122805-Holinger-03_itms_10.07286.07286.2 2.6015 0.1473 90.9 1053.6562 1054.2749 3902.7 6 3.783 72.2 1 K.AVGKVLPELQ.G 122805-Holinger-05_itms_7.06438.06438.2 3.6462 0.0533 98.7 1238.7687 1239.5009 6368.1 2 4.577 77.3 2 K.AVGKVLPELQGK.L 122805-Holinger-05_itms_7.06455.06455.3 2.4786 0.0033 92.8 1238.7688 1239.5009 2457.9 2 3.996 47.7 1 K.AVGKVLPELQGK.L 122805-Holinger-05_itms_9.07303.07303.2 3.9147 0.1842 100.0 1452.9053 1453.7654 7269.4 2 5.874 61.5 2 K.AVGKVLPELQGKLT.G 122805-Holinger-03_itms_11.07707.07707.2 2.7425 0.229 99.3 1090.6068 1091.2523 3282.4 152 4.778 66.7 3 M.AFRVPTVDVS.V 122805-Holinger-03_itms_11.07718.07718.1 2.1446 0.2352 93.6 1090.6083 1091.2523 2713.4 244 4.873 44.4 1 M.AFRVPTVDVS.V 122805-Holinger-03_itms_8.06275.06275.2 3.7933 0.1843 99.8 1580.8794 1581.8064 6014.3 5 5.33 70.8 1 K.LNKETTYDEIKKV.V 122805-Holinger-04_itms_9.07049.07049.3 3.9093 0.1861 99.5 1808.0519 1809.113 6264.9 60 4.625 41.1 1 K.LNKETTYDEIKKVVK.A 122805-Holinger-04_itms_10.07626.07626.3 4.2137 0.2634 100.0 1879.09 1880.1919 7420.6 34 5.619 40.0 3 K.LNKETTYDEIKKVVKA.A 122805-Holinger-04_itms_10.07710.07710.2 4.5455 0.1972 100.0 1879.0916 1880.1919 7068.4 1 6.561 60.0 2 K.LNKETTYDEIKKVVKA.A 122805-Holinger-04_itms_9.06737.06737.2 3.329 0.2088 97.9 1694.9614 1695.9536 6401.7 1 4.355 69.2 1 L.NKETTYDEIKKVVK.A 122805-Holinger-04_itms_9.07242.07242.2 4.2927 0.4506 100.0 1766.0024 1767.0325 7521.5 1 7.742 64.3 1 L.NKETTYDEIKKVVKA.A 122805-Holinger-03_itms_10.07350.07350.2 3.2691 0.2289 99.8 1580.9203 1581.8497 4574.9 1 5.451 75.0 3 N.KETTYDEIKKVVK.A 122805-Holinger-04_itms_9.07257.07257.3 2.975 0.1685 94.7 1651.9557 1652.9286 5828.3 6 4.068 38.5 2 N.KETTYDEIKKVVKA.A 122805-Holinger-04_itms_9.07267.07267.2 3.8953 0.3213 100.0 1651.9579 1652.9286 7308.9 1 6.491 73.1 2 N.KETTYDEIKKVVKA.A 122805-Holinger-03_itms_9.06601.06601.2 3.0739 0.2538 99.8 1323.7751 1324.5602 5506.1 1 5.448 75.0 1 E.TTYDEIKKVVK.A 122805-Holinger-03_itms_10.07042.07042.2 2.6506 0.1688 100.0 1394.8138 1395.639 6319.0 13 5.751 59.1 1 E.TTYDEIKKVVKA.A 122805-Holinger-03_itms_10.07195.07195.2 2.8969 0.1907 99.5 1065.6232 1066.2455 4065.3 1 5.01 93.8 1 T.RVVDLVEHV.A 122805-Holinger-03_itms_10.07338.07338.2 2.1552 0.1037 94.4 1136.6609 1137.3243 3907.0 2 3.979 77.8 1 T.RVVDLVEHVA.K YJR009C 26 40 32.8% 332 35847 7.0 U TDH2 SGDID:S000003769, Chr X from 454595-453597, reverse complement, Verified ORF, "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2, involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell-wall " * 122805-Holinger-04_itms_5.05001.05001.2 3.8429 0.2816 100.0 1471.7576 1472.6005 6087.8 2 6.058 70.8 2 E.VSHDDKHIIVDGH.K 122805-Holinger-03_itms_6.05141.05141.2 2.4728 0.1572 98.6 1178.599 1179.2749 4251.8 39 4.463 66.7 1 V.SHDDKHIIVD.G 122805-Holinger-03_itms_6.05178.05178.2 2.4363 0.2144 99.7 1091.5657 1092.1967 3870.4 30 5.182 75.0 2 S.HDDKHIIVD.G * 122805-Holinger-03_itms_14.09566.09566.2 3.1573 0.233 100.0 1744.8981 1745.9323 4685.2 5 5.943 57.1 2 A.TFQERDPANLPWASL.N 122805-Holinger-03_itms_5.04008.04008.2 2.1706 0.161 90.4 1254.6663 1255.3732 7148.5 92 3.765 54.5 1 L.DTAQKHIDAGAK.K 122805-Holinger-02_itms_8.06247.06247.2 2.2276 0.1112 98.8 877.4913 878.0159 6178.0 2 4.541 85.7 1 L.AKVINDAF.G 122805-Holinger-05_itms_5.04937.04937.2 2.1355 0.1075 94.4 1297.6512 1298.4008 4323.6 19 3.986 65.0 1 K.TVDGPSHKDWR.G 122805-Holinger-03_itms_10.07286.07286.2 2.6015 0.1473 90.9 1053.6562 1054.2749 3902.7 6 3.783 72.2 1 K.AVGKVLPELQ.G 122805-Holinger-05_itms_7.06438.06438.2 3.6462 0.0533 98.7 1238.7687 1239.5009 6368.1 2 4.577 77.3 2 K.AVGKVLPELQGK.L 122805-Holinger-05_itms_7.06455.06455.3 2.4786 0.0033 92.8 1238.7688 1239.5009 2457.9 2 3.996 47.7 1 K.AVGKVLPELQGK.L 122805-Holinger-05_itms_9.07303.07303.2 3.9147 0.1842 100.0 1452.9053 1453.7654 7269.4 2 5.874 61.5 2 K.AVGKVLPELQGKLT.G 122805-Holinger-03_itms_11.07707.07707.2 2.7425 0.229 99.3 1090.6068 1091.2523 3282.4 152 4.778 66.7 3 M.AFRVPTVDVS.V 122805-Holinger-03_itms_11.07718.07718.1 2.1446 0.2352 93.6 1090.6083 1091.2523 2713.4 244 4.873 44.4 1 M.AFRVPTVDVS.V 122805-Holinger-03_itms_8.06275.06275.2 3.7933 0.1843 99.8 1580.8794 1581.8064 6014.3 5 5.33 70.8 1 K.LNKETTYDEIKKV.V 122805-Holinger-04_itms_9.07049.07049.3 3.9093 0.1861 99.5 1808.0519 1809.113 6264.9 60 4.625 41.1 1 K.LNKETTYDEIKKVVK.A 122805-Holinger-04_itms_10.07626.07626.3 4.2137 0.2634 100.0 1879.09 1880.1919 7420.6 34 5.619 40.0 3 K.LNKETTYDEIKKVVKA.A 122805-Holinger-04_itms_10.07710.07710.2 4.5455 0.1972 100.0 1879.0916 1880.1919 7068.4 1 6.561 60.0 2 K.LNKETTYDEIKKVVKA.A 122805-Holinger-04_itms_9.06737.06737.2 3.329 0.2088 97.9 1694.9614 1695.9536 6401.7 1 4.355 69.2 1 L.NKETTYDEIKKVVK.A 122805-Holinger-04_itms_9.07242.07242.2 4.2927 0.4506 100.0 1766.0024 1767.0325 7521.5 1 7.742 64.3 1 L.NKETTYDEIKKVVKA.A 122805-Holinger-03_itms_10.07350.07350.2 3.2691 0.2289 99.8 1580.9203 1581.8497 4574.9 1 5.451 75.0 3 N.KETTYDEIKKVVK.A 122805-Holinger-04_itms_9.07257.07257.3 2.975 0.1685 94.7 1651.9557 1652.9286 5828.3 6 4.068 38.5 2 N.KETTYDEIKKVVKA.A 122805-Holinger-04_itms_9.07267.07267.2 3.8953 0.3213 100.0 1651.9579 1652.9286 7308.9 1 6.491 73.1 2 N.KETTYDEIKKVVKA.A 122805-Holinger-03_itms_9.06601.06601.2 3.0739 0.2538 99.8 1323.7751 1324.5602 5506.1 1 5.448 75.0 1 E.TTYDEIKKVVK.A 122805-Holinger-03_itms_10.07042.07042.2 2.6506 0.1688 100.0 1394.8138 1395.639 6319.0 13 5.751 59.1 1 E.TTYDEIKKVVKA.A 122805-Holinger-03_itms_10.07195.07195.2 2.8969 0.1907 99.5 1065.6232 1066.2455 4065.3 1 5.01 93.8 1 T.RVVDLVEHV.A 122805-Holinger-03_itms_10.07338.07338.2 2.1552 0.1037 94.4 1136.6609 1137.3243 3907.0 2 3.979 77.8 1 T.RVVDLVEHVA.K YFR028C 31 62 32.1% 551 61907 8.0 U CDC14 SGDID:S000001924, Chr VI from 210056-208401, reverse complement, Verified ORF, "Protein phosphatase required for mitotic exit; located in the nucleolus until liberated by the FEAR and Mitotic Exit Network in anaphase, enabling it to act on key substrates to effect a decrease in CDK/B-cyclin activity and mitotic exit" * 122805-Holinger-02_itms_15.10633.10633.2 3.0145 0.1285 91.9 1226.6516 1227.3997 6635.5 11 3.832 77.8 2 S.VYLDNTIEFL.R * 122805-Holinger-03_itms_14.09253.09253.2 3.0608 0.2327 99.4 1382.7577 1383.5872 7612.4 1 4.928 80.0 1 S.VYLDNTIEFLR.G * 122805-Holinger-02_itms_16.11070.11070.2 2.8219 0.1464 97.6 1753.7834 1754.8439 4817.4 2 4.328 61.5 1 A.YDYTPEDTDELVFF.T * 122805-Holinger-01_itms_25.16594.16594.2 2.5017 0.2146 99.4 1296.8461 1297.3148 5360.0 5 4.85 65.0 1 Y.DYTPEDTDELV.F * 122805-Holinger-02_itms_16.10956.10956.2 2.1036 0.1339 94.6 1590.715 1591.6678 5614.2 22 3.999 50.0 1 Y.DYTPEDTDELVFF.T * 122805-Holinger-03_itms_14.09357.09357.2 2.7682 0.1264 97.9 1164.5374 1165.3087 7137.3 1 4.366 88.9 1 Y.NSFHLDFGPM.N * 122805-Holinger-03_itms_14.09455.09455.2 2.7411 0.1144 98.6 1050.4906 1051.2048 4468.0 1 4.474 87.5 2 N.SFHLDFGPM.N * 122805-Holinger-03_itms_14.09454.09454.1 2.5307 0.2422 98.6 1050.4917 1051.2048 3523.0 1 5.301 68.8 1 N.SFHLDFGPM.N * 122805-Holinger-03_itms_14.09366.09366.2 2.3176 0.1527 98.5 963.45654 964.12665 4906.0 1 4.432 100.0 1 S.FHLDFGPM.N * 122805-Holinger-03_itms_14.09379.09379.1 2.7476 0.1804 97.5 963.4577 964.12665 3536.4 1 5.22 78.6 2 S.FHLDFGPM.N * 122805-Holinger-03_itms_11.07923.07923.1 2.0902 0.2477 98.4 816.3851 816.9501 3797.0 2 5.35 83.3 1 F.HLDFGPM.N * 122805-Holinger-02_itms_15.10377.10377.2 1.7528 0.1281 94.3 949.4645 950.1401 3129.3 64 3.974 78.6 1 Q.VDPPFMPF.R * 122805-Holinger-03_itms_12.08124.08124.2 2.5653 0.2206 99.0 1399.6392 1400.4869 7519.5 1 4.648 75.0 1 Y.EKYEHVEFGDF.N * 122805-Holinger-02_itms_9.07185.07185.1 2.0665 0.2148 97.4 1093.4768 1094.1252 3606.7 4 5.234 68.8 1 Y.EHVEFGDFN.V * 122805-Holinger-02_itms_16.11030.11030.2 2.3404 0.2191 98.6 1136.6185 1137.3208 3996.6 11 4.475 72.2 1 F.NVLTPDFIAF.A * 122805-Holinger-02_itms_5.04525.04525.2 2.5996 0.4018 100.0 1228.5782 1229.2914 3487.9 4 5.99 65.0 2 F.ASPQEDHPKGY.L * 122805-Holinger-02_itms_5.04538.04538.1 2.4807 0.2798 100.0 1228.5829 1229.2914 5899.6 1 5.995 60.0 1 F.ASPQEDHPKGY.L * 122805-Holinger-04_itms_10.07436.07436.2 3.3276 0.2458 100.0 1356.7507 1357.5522 4585.2 3 5.85 72.7 2 K.SSHLNQPFKSVL.N * 122805-Holinger-04_itms_10.07418.07418.2 3.3269 0.1206 99.6 1269.7175 1270.474 4965.8 16 5.13 65.0 1 S.SHLNQPFKSVL.N * 122805-Holinger-02_itms_8.06610.06610.1 2.1486 0.1827 98.6 958.4807 959.04645 3311.1 5 5.258 71.4 1 K.HFEDIGIQ.H * 122805-Holinger-03_itms_14.09205.09205.2 2.6695 0.2642 99.3 1731.8215 1732.8506 6006.3 3 4.732 50.0 1 Q.HLDLIFEDGTCPDLS.I * 122805-Holinger-04_itms_16.10838.10838.2 3.937 0.4204 100.0 1943.9797 1945.1426 7470.0 1 7.629 62.5 7 Q.HLDLIFEDGTCPDLSIV.K * 122805-Holinger-05_itms_12.08977.08977.3 3.672 0.2676 100.0 2072.076 2073.3167 5590.6 1 5.742 36.8 1 Q.HLDLIFEDGTCPDLSIVK.N * 122805-Holinger-05_itms_12.08976.08976.2 5.6306 0.4517 100.0 2072.0767 2073.3167 7935.8 1 8.751 70.6 19 Q.HLDLIFEDGTCPDLSIVK.N * 122805-Holinger-02_itms_11.08034.08034.2 4.5209 0.4071 100.0 1593.8092 1594.7681 6994.9 1 7.85 84.6 1 L.IFEDGTCPDLSIVK.N * 122805-Holinger-04_itms_13.09319.09319.2 3.695 0.2901 99.7 1557.9186 1558.8584 3906.5 1 5.181 67.9 2 R.ISLKPSEAIGGLYPL.I * 122805-Holinger-03_itms_13.09032.09032.2 3.5186 0.1635 98.7 1357.7972 1358.6207 4199.0 1 4.563 83.3 2 S.LKPSEAIGGLYPL.I * 122805-Holinger-04_itms_7.05915.05915.2 1.9686 0.0303 92.2 1182.5784 1183.3245 4791.7 396 3.853 50.0 1 L.TMTPPSNGHGAL.S * 122805-Holinger-05_itms_5.05324.05324.2 3.4047 0.2048 93.0 2341.161 2342.444 3440.7 9 3.911 38.1 1 Q.TSPGQPRKGQNGSNTIEDINNN.R * 122805-Holinger-03_itms_7.05308.05308.2 2.991 0.2703 99.8 1624.7955 1625.6952 5750.3 1 5.298 65.4 1 N.TIEDINNNRNPTSH.A * 122805-Holinger-05_itms_4.04461.04461.2 1.2966 0.1614 92.4 874.3485 875.0158 3798.6 140 3.862 68.8 1 A.GGIRKISGS.I YOL039W 4 4 32.1% 106 10746 4.0 U RPP2A SGDID:S000005399, Chr XV from 254295-254615, Verified ORF, "Ribosomal protein P2 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the cytoplasm" * 122805-Holinger-03_itms_6.04859.04859.2 3.1749 0.2827 100.0 1300.7062 1301.4423 5795.4 3 5.865 66.7 1 L.NAAGNTPDATKIK.A * 122805-Holinger-03_itms_6.04744.04744.2 2.3918 0.1336 97.0 1186.6625 1187.3384 3538.0 295 4.221 54.5 1 N.AAGNTPDATKIK.A 122805-Holinger-03_itms_12.08519.08519.2 5.338 0.4357 100.0 2409.9238 2411.334 7061.1 1 8.224 57.5 1 A.AEEEKEEEAAEES*DDDMGFGL.F 122805-Holinger-03_itms_12.08566.08566.2 4.1025 0.4826 100.0 2209.84 2211.1396 7521.1 1 8.406 52.8 1 E.EEKEEEAAEES*DDDMGFGL.F YAL038W 21 44 30.0% 500 54545 7.7 U CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration" * 122805-Holinger-04_itms_11.07914.07914.2 2.8948 0.2954 100.0 1654.9298 1655.8889 7242.9 1 6.307 53.3 1 T.SIIGTIGPKTNNPETL.V * 122805-Holinger-05_itms_7.06564.06564.2 3.5391 0.2418 99.4 1957.0867 1958.2247 5048.0 5 4.837 46.9 2 S.VIDNARKSEELYPGRPL.A * 122805-Holinger-03_itms_9.06628.06628.2 3.0261 0.2349 100.0 1288.7109 1289.474 7832.8 1 6.394 70.0 1 R.KSEELYPGRPL.A * 122805-Holinger-03_itms_12.08149.08149.3 2.4133 0.0459 96.9 1513.8508 1514.7618 3435.8 264 4.17 39.6 1 M.YVDYKNITKVISA.G * 122805-Holinger-03_itms_12.08139.08139.2 3.1336 0.4041 100.0 1513.8524 1514.7618 8106.7 1 7.521 66.7 1 M.YVDYKNITKVISA.G * 122805-Holinger-05_itms_7.06075.06075.2 2.9305 0.1697 98.7 1136.689 1137.3647 5717.1 3 4.5 77.8 1 D.YKNITKVISA.G * 122805-Holinger-05_itms_7.06086.06086.2 2.4236 0.1738 91.9 1193.7104 1194.4166 3866.2 21 3.84 65.0 1 D.YKNITKVISAG.R * 122805-Holinger-04_itms_13.09414.09414.2 2.5873 0.1876 95.5 1453.7977 1454.6659 8151.1 1 4.089 62.5 2 A.GRIIYVDDGVLSF.Q * 122805-Holinger-04_itms_11.07847.07847.2 3.343 0.3019 99.8 1619.868 1620.8027 5821.2 1 5.377 60.0 1 C.SHKGVNLPGTDVDLPA.L * 122805-Holinger-04_itms_19.12578.12578.2 4.2915 0.2925 100.0 1735.7902 1733.9622 6060.8 3 5.692 59.4 22 C.SHKGVNLPGTDVDLPAL.S * 122805-Holinger-03_itms_14.09588.09588.2 2.6486 0.2116 97.5 1508.8618 1509.7429 3271.3 47 4.315 60.7 1 H.KGVNLPGTDVDLPAL.S * 122805-Holinger-02_itms_6.05486.05486.2 2.4076 0.2059 99.5 1266.659 1267.3812 5722.9 5 4.987 66.7 1 L.SEKDKEDLRF.G * 122805-Holinger-03_itms_9.06785.06785.2 3.6299 0.1413 92.5 1655.0011 1655.9756 5839.0 225 3.866 53.6 1 R.EVLGEQGKDVKIIVK.I * 122805-Holinger-05_itms_5.05019.05019.2 2.9323 0.0836 99.2 999.67395 1000.26996 5753.4 1 4.671 87.5 1 Q.GKDVKIIVK.I * 122805-Holinger-02_itms_12.08539.08539.2 2.3058 0.0949 99.6 1078.5966 1079.2383 7233.9 1 5.124 87.5 1 N.NFDEILKVT.D * 122805-Holinger-03_itms_8.05929.05929.2 2.3121 0.2649 99.8 1058.583 1059.217 6732.0 4 5.217 72.2 1 K.SNLAGKPVIC.A 122805-Holinger-04_itms_7.05952.05952.1 2.2773 0.2711 97.0 971.55133 972.1388 5811.4 1 5.049 75.0 1 S.NLAGKPVIC.A 122805-Holinger-04_itms_6.05538.05538.2 2.0641 0.163 94.7 857.50806 858.0349 4005.1 19 4.014 64.3 1 N.LAGKPVIC.A * 122805-Holinger-02_itms_12.08608.08608.2 2.7789 0.2109 99.3 1318.6167 1319.3771 5577.1 1 4.772 66.7 1 S.DVGNAILDGADCV.M * 122805-Holinger-02_itms_10.07314.07314.2 2.7654 0.182 99.3 1235.6139 1236.3666 4722.7 4 4.777 77.8 1 F.VFEKEPVSDW.T * 122805-Holinger-03_itms_11.07781.07781.2 4.5589 0.3713 100.0 2022.0172 2023.1632 5186.9 1 7.087 84.4 1 F.VFEKEPVSDWTDDVEAR.I YGR027C 3 5 29.6% 108 12039 10.3 U RPS25A SGDID:S000003259, Chr VII from 534462-534136, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Bp and has similarity to rat S25 ribosomal protein" YLR333C 3 5 29.6% 108 12009 10.3 U RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein" 122805-Holinger-03_itms_10.07379.07379.2 3.2065 0.1546 93.3 1632.9591 1633.9286 7665.8 6 3.928 62.5 1 A.VILDQEKYDRILK.E 122805-Holinger-04_itms_13.09457.09457.3 4.9117 0.2517 100.0 2315.2502 2316.619 4975.8 8 4.922 41.2 3 L.DQEKYDRILKEVPTYRYV.S 122805-Holinger-04_itms_6.05346.05346.2 3.1233 0.118 94.9 1241.766 1242.5016 3519.2 17 4.021 75.0 1 L.EKEGIIKPISK.H YDL130W 4 4 28.3% 106 10668 4.0 U RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" * 122805-Holinger-03_itms_16.10301.10301.2 2.3303 0.0776 94.6 1021.5745 1022.1864 3673.2 1 3.994 81.2 1 K.DLKEILSGF.H * 122805-Holinger-02_itms_15.10614.10614.1 2.197 0.0725 91.5 1021.57574 1022.1864 5318.4 47 4.818 56.2 1 K.DLKEILSGF.H 122805-Holinger-03_itms_12.08519.08519.2 5.338 0.4357 100.0 2409.9238 2411.334 7061.1 1 8.224 57.5 1 A.AEEEKEEEAAEES*DDDMGFGL.F 122805-Holinger-03_itms_12.08566.08566.2 4.1025 0.4826 100.0 2209.84 2211.1396 7521.1 1 8.406 52.8 1 E.EEKEEEAAEES*DDDMGFGL.F YDR524W-C 1 1 27.6% 29 3534 10.1 U YDR524W-C SGDID:S000028740, Chr IV from 1489393-1489482, Uncharacterized ORF, "Identified by SAGE" * 122805-Holinger-03_itms_14.09388.09388.2 2.2115 0.1461 91.0 995.44836 996.15283 5899.6 337 3.789 64.3 1 Y.FFSFFGPF.K YKL152C 9 11 27.5% 247 27609 8.8 U GPM1 SGDID:S000001635, Chr XI from 164390-163647, reverse complement, Verified ORF, "Tetrameric phosphoglycerate mutase, mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis" * 122805-Holinger-03_itms_15.09773.09773.2 3.671 0.1305 100.0 1695.8098 1696.8162 5562.4 1 5.725 73.1 1 H.GQSEWNEKNLFTGW.V * 122805-Holinger-03_itms_15.09959.09959.2 3.1549 0.3439 100.0 1423.6896 1424.5553 5556.7 1 6.743 70.0 2 S.EWNEKNLFTGW.V * 122805-Holinger-04_itms_9.06833.06833.2 3.2936 0.2472 100.0 1482.8492 1483.7478 5780.4 1 5.5 72.7 1 L.KEKKVYPDVLYT.S * 122805-Holinger-04_itms_9.06786.06786.2 3.1138 0.2497 99.3 1569.881 1570.8259 6934.9 6 4.688 54.2 1 L.KEKKVYPDVLYTS.K * 122805-Holinger-05_itms_6.05870.05870.2 3.3426 0.2779 98.7 1390.7266 1391.5663 5760.4 1 4.579 70.0 1 L.KKFGEEKFNTY.R * 122805-Holinger-03_itms_7.05311.05311.2 3.0826 0.3007 99.8 1698.838 1699.8174 4039.6 3 5.275 57.7 1 F.SQKGDERYKYVDPN.V * 122805-Holinger-03_itms_10.07317.07317.2 3.7921 0.3681 100.0 1602.8624 1603.8125 7738.0 1 5.928 76.9 2 L.VFELDENLKPSKPS.Y * 122805-Holinger-03_itms_12.08098.08098.2 3.3306 0.1891 99.5 1928.9967 1930.1644 7383.4 3 5.049 53.3 1 L.VFELDENLKPSKPSYY.L * 122805-Holinger-02_itms_6.05194.05194.2 2.3017 0.1501 93.6 1356.7245 1357.5034 5708.2 339 3.941 54.5 1 F.ELDENLKPSKPS.Y YLR340W 15 35 26.9% 312 33717 4.8 U RPP0 SGDID:S000004332, Chr XII from 805887-806825, Verified ORF, "Conserved ribosomal protein P0 similar to rat P0, human P0, and E. coli L10e; shown to be phosphorylated on serine 302" * 122805-Holinger-05_itms_6.05807.05807.2 2.3724 0.1723 95.1 1297.7114 1298.4844 5123.3 26 4.039 60.0 1 M.GGIREKKAEYF.A * 122805-Holinger-04_itms_18.11892.11892.2 3.4249 0.4003 100.0 1533.8503 1534.7925 2466.0 4 6.578 75.0 11 F.LSDLPDFEKLLPF.V * 122805-Holinger-04_itms_11.08384.08384.2 2.1088 0.1766 97.6 966.5575 967.15576 5321.2 20 4.319 68.8 1 F.VKGNVGFVF.T * 122805-Holinger-02_itms_7.05880.05880.2 2.3973 0.1875 99.3 1044.5732 1045.1779 5625.9 5 4.737 81.2 1 F.TNEPLTEIK.N * 122805-Holinger-04_itms_10.07558.07558.3 3.9022 0.2134 100.0 1439.8002 1440.645 4063.0 1 5.216 58.3 1 A.RAGAVAPEDIWVR.A * 122805-Holinger-04_itms_10.07551.07551.2 4.033 0.4123 100.0 1439.8009 1440.645 4695.2 1 7.371 79.2 2 A.RAGAVAPEDIWVR.A * 122805-Holinger-02_itms_10.07776.07776.2 2.4442 0.2408 99.8 1155.6317 1156.3268 4435.6 1 5.256 83.3 1 G.AVAPEDIWVR.A * 122805-Holinger-02_itms_13.09182.09182.2 4.1737 0.3867 100.0 1470.7563 1471.6042 6283.7 1 7.018 83.3 1 S.SILDITDEELVSH.F * 122805-Holinger-03_itms_16.10590.10590.2 4.9932 0.3749 100.0 1617.8303 1618.7808 7984.6 1 7.758 80.8 8 S.SILDITDEELVSHF.V * 122805-Holinger-05_itms_10.08150.08150.1 1.8836 0.2793 100.0 1324.751 1325.5504 9050.0 1 6.46 50.0 1 S.LAIGYPTLPSVGH.T * 122805-Holinger-05_itms_10.08147.08147.2 3.1975 0.1672 99.5 1324.751 1325.5504 3679.4 1 5.062 70.8 2 S.LAIGYPTLPSVGH.T * 122805-Holinger-05_itms_11.08796.08796.2 2.7203 0.3288 100.0 1538.8889 1539.815 4226.4 1 6.319 53.6 1 S.LAIGYPTLPSVGHTL.I * 122805-Holinger-02_itms_12.08516.08516.1 2.6119 0.3344 100.0 1074.6014 1075.2499 4423.5 17 6.632 60.0 1 L.AIGYPTLPSVG.H * 122805-Holinger-04_itms_10.07780.07780.2 1.9997 0.1912 99.0 1312.7134 1313.4961 3774.0 26 4.655 54.2 1 L.AIGYPTLPSVGHT.L * 122805-Holinger-05_itms_10.08311.08311.2 3.2062 0.2638 100.0 1425.8018 1426.6555 3634.3 2 5.731 69.2 2 L.AIGYPTLPSVGHTL.I YLR457C 7 8 26.3% 319 37354 10.2 U NBP1 SGDID:S000004449, Chr XII from 1056768-1055809, reverse complement, Verified ORF, "Component of the mitotic apparatus containing a coiled-coil domain, essential for the G2/M transition" * 122805-Holinger-05_itms_11.08410.08410.2 2.6531 0.2316 99.3 1067.744 1069.2511 3631.4 2 4.75 92.9 1 L.WKDFFGIR.D * 122805-Holinger-04_itms_4.04170.04170.2 2.5093 0.1477 95.3 1389.7739 1390.5393 3240.0 1 4.066 65.0 1 T.DRKTEEKIRTN.R * 122805-Holinger-04_itms_5.04910.04910.2 2.5092 0.1564 95.4 1900.9087 1901.9443 5869.5 3 4.077 44.1 1 L.RSGSSDGSSGKDRNQSLY.L * 122805-Holinger-04_itms_13.08999.08999.3 3.5033 0.2566 99.4 2881.5015 2883.1045 7880.5 5 4.715 28.0 1 L.RSGSSDGSSGKDRNQSLYLDREILLQ.R * 122805-Holinger-03_itms_8.06278.06278.2 2.4142 0.0964 98.8 1022.57916 1023.1771 5785.4 5 4.597 78.6 1 Y.SNEKYRIL.E * 122805-Holinger-03_itms_8.06300.06300.2 2.6407 0.2985 99.8 1629.7981 1630.7638 6249.7 1 5.323 69.2 1 L.QENISPACPTPPYR.S * 122805-Holinger-04_itms_11.08342.08342.2 4.3523 0.2542 100.0 2085.8572 2087.026 5744.0 1 5.895 59.4 2 R.ETEKEDETLS*PIS*VDFS.S YBL002W 7 12 26.0% 131 14237 10.1 U HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation" YDR224C 7 12 26.0% 131 14252 10.1 U HTB1 SGDID:S000002632, Chr IV from 914706-914311, reverse complement, Verified ORF, "One of two nearly identical (see HTB2) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation " 122805-Holinger-04_itms_4.04265.04265.2 2.8427 0.2828 99.3 1081.5504 1084.1741 5206.3 1 4.827 77.8 1 L.KQTHPDTGIS.Q 122805-Holinger-04_itms_4.04323.04323.2 3.0471 0.0977 99.1 1211.625 1212.3048 5631.9 1 4.663 75.0 1 L.KQTHPDTGISQ.K 122805-Holinger-04_itms_4.04341.04341.1 2.2903 0.3348 98.4 1211.6272 1212.3048 4635.1 1 5.391 55.0 1 L.KQTHPDTGISQ.K 122805-Holinger-03_itms_16.10475.10475.2 2.6614 0.3486 100.0 1424.7445 1425.584 6851.2 1 5.594 63.6 1 L.NSFVNDIFERIA.T 122805-Holinger-03_itms_16.10454.10454.2 2.3877 0.2901 99.8 1527.7982 1526.6891 6014.6 46 5.342 50.0 2 L.NSFVNDIFERIAT.E 122805-Holinger-04_itms_12.08930.08930.2 2.5472 0.2459 99.5 1009.65857 1010.2651 3288.6 33 5.038 81.2 3 A.VRLILPGEL.A 122805-Holinger-05_itms_11.08471.08471.2 2.845 0.2492 99.8 1080.6987 1081.3439 4026.0 19 5.239 77.8 3 A.VRLILPGELA.K YLR044C 26 40 25.9% 563 61495 6.2 U PDC1 SGDID:S000004034, Chr XII from 234082-232391, reverse complement, Verified ORF, "Major of three pyruvate decarboxylase isozymes, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde; subject to glucose-, ethanol-, and autoregulation; involved in amino acid catabolism" 122805-Holinger-05_itms_9.07632.07632.2 2.4432 0.1793 95.4 1025.5969 1026.2236 5405.8 8 4.08 78.6 1 L.GKYLFERL.K 122805-Holinger-02_itms_15.10532.10532.2 2.3247 0.2482 99.3 1266.6578 1267.4241 4510.8 95 4.813 54.5 1 N.TVFGLPGDFNLS.L 122805-Holinger-02_itms_17.11574.11574.2 2.6447 0.1397 98.6 1379.7479 1380.5835 4692.9 12 4.456 58.3 1 N.TVFGLPGDFNLSL.L 122805-Holinger-04_itms_8.06639.06639.1 2.3322 0.245 97.5 894.5201 895.04645 3225.4 62 5.701 56.2 3 L.HVVGVPSIS.A 122805-Holinger-04_itms_14.09915.09915.2 3.2624 0.2552 100.0 1647.0194 1647.9988 6114.6 4 5.594 56.7 3 L.GLPANLVDLNVPAKLL.Q 122805-Holinger-03_itms_14.09528.09528.2 3.841 0.1675 99.8 1308.8127 1309.5919 7207.7 2 5.46 81.8 2 A.NLVDLNVPAKLL.Q 122805-Holinger-03_itms_14.09232.09232.2 4.4286 0.1771 100.0 1194.7659 1195.4882 5988.3 1 5.756 90.0 1 N.LVDLNVPAKLL.Q 122805-Holinger-02_itms_7.05593.05593.2 2.1703 0.0515 98.1 855.5123 856.00977 4692.6 4 4.389 78.6 1 L.VDLNVPAK.L 122805-Holinger-02_itms_12.08647.08647.2 2.3873 0.2353 99.4 1081.6812 1082.3286 6084.9 35 4.858 77.8 1 L.VDLNVPAKLL.Q * 122805-Holinger-02_itms_14.09809.09809.2 4.1195 0.2136 99.3 2004.051 2002.2262 6043.3 75 4.834 41.2 1 M.SLKPNDAESEKEVIDTIL.A * 122805-Holinger-02_itms_14.09921.09921.2 2.6906 0.0875 92.3 1914.0385 1915.148 5760.3 381 3.857 40.6 1 S.LKPNDAESEKEVIDTIL.A * 122805-Holinger-04_itms_8.06244.06244.2 2.9062 0.0752 90.4 1096.691 1097.3433 4475.3 10 3.757 77.8 2 L.VKDAKNPVIL.A * 122805-Holinger-04_itms_7.06095.06095.2 3.079 0.1801 99.0 1167.7288 1168.4221 5469.3 1 4.653 80.0 1 L.VKDAKNPVILA.D 122805-Holinger-04_itms_6.05407.05407.2 3.3513 0.1632 100.0 1599.8145 1600.7312 4856.2 1 5.684 57.1 1 M.GKGSIDEQHPRYGGV.Y 122805-Holinger-04_itms_7.05847.05847.3 3.0374 0.0832 90.1 1762.8813 1763.9071 3401.9 10 3.839 36.7 1 M.GKGSIDEQHPRYGGVY.V 122805-Holinger-05_itms_6.05746.05746.2 4.0341 0.1108 99.7 1762.8857 1763.9071 6092.5 1 5.178 66.7 4 M.GKGSIDEQHPRYGGVY.V * 122805-Holinger-04_itms_10.07406.07406.2 3.2657 0.2385 99.3 1628.9674 1629.9402 4542.4 2 4.889 57.7 1 A.FAAEEIDPKKRVIL.F * 122805-Holinger-02_itms_10.07781.07781.1 2.217 0.0115 92.4 895.5027 896.0312 2479.5 4 4.849 71.4 1 W.DHLSLLPT.F * 122805-Holinger-02_itms_14.09960.09960.1 2.4113 0.2324 98.1 1042.575 1043.2078 3051.1 6 5.462 68.8 1 W.DHLSLLPTF.G * 122805-Holinger-03_itms_15.09780.09780.2 2.6248 0.1203 94.6 1042.5765 1043.2078 3028.0 1 4.011 87.5 2 W.DHLSLLPTF.G * 122805-Holinger-04_itms_12.08508.08508.1 3.6087 0.3821 100.0 1298.7325 1299.5126 6496.1 1 7.059 63.6 3 W.DHLSLLPTFGAK.D * 122805-Holinger-03_itms_13.08643.08643.2 3.1235 0.1052 98.2 1298.7358 1299.5126 6374.5 4 4.397 68.2 3 W.DHLSLLPTFGAK.D * 122805-Holinger-02_itms_8.06621.06621.2 2.3831 0.3064 100.0 1178.5939 1179.2719 6106.2 1 6.134 77.8 1 A.TTGEWDKLTQ.D * 122805-Holinger-02_itms_18.12012.12012.2 3.073 0.1819 93.8 1730.9219 1732.1061 5404.9 1 3.95 67.9 1 R.MIEIMLPVFDAPQNL.V * 122805-Holinger-02_itms_18.11956.11956.2 2.5267 0.1969 95.5 2158.131 2159.5635 6507.8 1 4.091 44.4 1 R.MIEIMLPVFDAPQNLVEQA.K * 122805-Holinger-02_itms_13.09442.09442.2 2.7716 0.2729 100.0 1540.8279 1541.7441 6508.5 1 5.593 61.5 1 M.LPVFDAPQNLVEQA.K YLR212C 15 25 25.2% 473 52628 4.7 U TUB4 SGDID:S000004202, Chr XII from 566283-564862, reverse complement, Verified ORF, "Gamma-tubulin, involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body" * 122805-Holinger-03_itms_11.07880.07880.3 4.2665 0.2982 100.0 2565.242 2566.6946 7358.5 1 5.451 32.6 1 H.AIGTDGLSQLPDSSTERDDDTKPF.F * 122805-Holinger-02_itms_9.06845.06845.2 3.6098 0.3884 100.0 2108.0173 2109.211 7316.6 1 6.22 50.0 2 D.GLSQLPDSSTERDDDTKPF.F * 122805-Holinger-02_itms_14.09739.09739.2 4.2518 0.0992 99.8 1863.8604 1862.0007 7197.7 19 5.205 53.3 3 R.NQDDILNKIDKEIDST.D * 122805-Holinger-05_itms_13.09967.09967.2 3.4374 0.1792 99.8 2570.2441 2571.7136 7932.3 3 5.451 33.3 2 R.NQDDILNKIDKEIDSTDNFEGF.Q * 122805-Holinger-04_itms_12.08545.08545.2 2.8864 0.2042 99.8 1277.6222 1278.4681 8257.6 1 5.324 72.2 1 T.NSIRFPSYMY.S * 122805-Holinger-04_itms_10.07593.07593.2 2.1852 0.0753 90.2 869.4665 869.9957 4268.3 6 3.739 91.7 2 N.SIRFPSY.M * 122805-Holinger-04_itms_12.08602.08602.2 2.8395 0.2115 99.3 1163.5776 1164.3643 5673.6 1 4.719 87.5 3 N.SIRFPSYMY.S * 122805-Holinger-03_itms_15.09894.09894.2 2.9134 0.2855 99.5 1353.767 1354.589 2411.7 6 5.011 72.7 3 Y.STLIPSPELHFL.S * 122805-Holinger-03_itms_14.09503.09503.2 2.4383 0.1071 90.6 1624.8918 1625.862 5056.5 6 3.775 53.6 1 Y.STLIPSPELHFLSPS.F * 122805-Holinger-04_itms_10.07490.07490.2 3.0297 0.2235 99.5 1742.905 1743.914 5827.7 2 5.027 53.6 2 R.RSPYLPLQPNENEVS.G * 122805-Holinger-04_itms_11.08106.08106.2 3.28 0.2417 99.5 1930.9672 1932.1583 5583.4 4 5.041 50.0 1 R.RSPYLPLQPNENEVSGM.M * 122805-Holinger-02_itms_7.05885.05885.2 2.9168 0.3098 100.0 1194.558 1195.231 6542.9 1 5.739 77.8 1 Q.NVQDEFAESR.E * 122805-Holinger-02_itms_17.11304.11304.2 2.7217 0.1875 99.4 2298.0403 2299.4219 7238.6 12 4.943 42.1 1 A.EQDSYLDDVLVDDENMVGEL.E * 122805-Holinger-02_itms_16.11204.11204.2 2.6071 0.2785 99.8 2427.0876 2428.5374 5980.6 1 5.294 40.0 1 A.EQDSYLDDVLVDDENMVGELE.E * 122805-Holinger-02_itms_14.09935.09935.2 3.8424 0.3396 100.0 1804.8475 1805.9484 6168.3 1 6.608 63.3 1 Y.LDDVLVDDENMVGELE.E YDL014W 19 38 24.8% 327 34465 10.2 U NOP1 SGDID:S000002172, Chr IV from 427361-428344, Verified ORF, "Nucleolar protein, component of the small subunit processome complex, which is required for processing of pre-18S rRNA; has similarity to mammalian fibrillarin" * 122805-Holinger-04_itms_6.05151.05151.2 2.8689 0.216 99.3 1009.56995 1007.17773 4283.6 2 4.786 77.8 1 R.GGAKVVIEPH.R * 122805-Holinger-02_itms_6.05271.05271.2 2.183 0.1848 99.3 1002.5996 1003.1839 5785.3 391 4.701 68.8 1 R.GKEDLLVTK.N * 122805-Holinger-04_itms_7.06114.06114.3 4.4101 0.2115 100.0 1967.0786 1968.2145 4906.8 1 5.092 52.9 4 K.RISVEEPSKEDGVPPTKV.E * 122805-Holinger-04_itms_7.06110.06110.2 3.7313 0.2981 100.0 1967.0789 1968.2145 5379.1 1 6.116 52.9 3 K.RISVEEPSKEDGVPPTKV.E * 122805-Holinger-04_itms_8.06626.06626.3 5.0395 0.3272 100.0 2415.2952 2416.6934 5630.8 1 5.574 42.5 4 K.RISVEEPSKEDGVPPTKVEYR.V * 122805-Holinger-04_itms_7.06143.06143.2 3.8992 0.2631 99.3 2415.2961 2416.6934 5543.4 1 4.809 50.0 1 K.RISVEEPSKEDGVPPTKVEYR.V * 122805-Holinger-02_itms_7.06023.06023.2 3.247 0.1856 99.8 1811.9729 1812.027 4648.4 66 5.302 46.9 1 R.ISVEEPSKEDGVPPTKV.E * 122805-Holinger-02_itms_6.05392.05392.3 3.7778 0.3347 100.0 2063.1829 2060.2683 6940.9 1 5.817 39.7 1 S.VEEPSKEDGVPPTKVEYR.V * 122805-Holinger-03_itms_12.08473.08473.3 3.2112 0.2132 99.5 1344.7751 1345.5815 4219.2 42 4.551 41.7 1 M.GGLDELFIAPGKK.V * 122805-Holinger-03_itms_12.08472.08472.2 3.5013 0.1556 99.3 1344.7758 1345.5815 6152.3 12 4.799 62.5 2 M.GGLDELFIAPGKK.V * 122805-Holinger-03_itms_13.08736.08736.3 3.6658 0.173 99.5 1443.8463 1444.7141 3942.3 3 4.616 46.2 1 M.GGLDELFIAPGKKV.L * 122805-Holinger-04_itms_12.08594.08594.2 4.2803 0.3071 100.0 1443.847 1444.7141 7837.0 1 6.041 76.9 3 M.GGLDELFIAPGKKV.L * 122805-Holinger-04_itms_13.09092.09092.3 3.3036 0.1594 99.4 1556.933 1557.8735 3348.5 1 4.81 50.0 2 M.GGLDELFIAPGKKVL.Y * 122805-Holinger-05_itms_11.08849.08849.2 4.1896 0.2461 100.0 1556.9354 1557.8735 5022.5 2 5.559 71.4 5 M.GGLDELFIAPGKKVL.Y * 122805-Holinger-03_itms_12.08080.08080.2 3.0323 0.1908 98.7 1329.8011 1330.6104 8050.8 1 4.503 77.3 1 L.DELFIAPGKKVL.Y * 122805-Holinger-05_itms_11.08490.08490.2 3.1101 0.069 91.8 1250.7338 1251.4685 5028.0 4 3.822 75.0 3 K.RPNIIPIIEDA.R * 122805-Holinger-04_itms_8.06467.06467.3 3.4433 0.2415 99.5 1843.9454 1845.0312 5084.5 2 4.568 42.9 1 L.TLEPYERDHCIVVGR.Y * 122805-Holinger-03_itms_7.05356.05356.1 2.1689 0.1454 97.0 1084.5385 1085.1711 2875.1 3 5.049 62.5 1 Y.ERDHCIVVG.R * 122805-Holinger-05_itms_5.04944.04944.2 3.2598 0.2759 100.0 1240.6412 1241.3586 3986.7 34 5.73 72.2 2 Y.ERDHCIVVGR.Y YML028W 5 5 24.0% 196 21590 5.1 U TSA1 SGDID:S000004490, Chr XIII from 220138-220728, Verified ORF, "Ubiquitous housekeeping thioredoxin peroxidase, reduces reactive oxygen, nitrogen and sulfur species using thioredoxin as hydrogen donor; mediates redox regulation of the nuclear localization of Yap1p; deletion results in mutator phenotype" * 122805-Holinger-02_itms_12.08877.08877.1 1.9487 0.3447 97.7 1049.5342 1050.1534 4636.1 112 5.634 44.4 1 T.AVVDGVFDEV.S * 122805-Holinger-05_itms_13.09563.09563.2 2.656 0.1998 99.3 1391.8523 1392.6818 6047.6 16 4.777 61.5 1 R.KEGGLGPINIPLLA.D 122805-Holinger-03_itms_12.08551.08551.2 2.1958 0.0877 99.8 902.55225 903.1094 6752.4 143 5.286 71.4 1 R.GLFIIDPK.G * 122805-Holinger-05_itms_9.07537.07537.2 2.4291 0.0711 92.9 1157.727 1158.4294 4863.7 24 3.906 77.8 1 L.FIIDPKGVIR.H * 122805-Holinger-02_itms_8.06334.06334.2 2.4566 0.1583 97.3 1287.596 1288.3533 5393.5 3 4.285 75.0 1 T.VEDSKEYFEAA.N YGR271C-A 1 1 23.8% 63 7099 4.3 U YGR271C-A SGDID:S000007608, Chr VII from 1037997-1037806, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus" * 122805-Holinger-02_itms_4.04187.04187.2 2.6723 0.1564 99.3 1598.724 1599.6079 6258.9 79 4.748 39.3 1 L.SPDKDHEDGSQVSPT.Q YGL008C 35 58 23.5% 918 99619 5.1 U PMA1 SGDID:S000002976, Chr VII from 482671-479915, reverse complement, Verified ORF, "Plasma membrane H+-ATPase, pumps protons out of the cell; major regulator of cytoplasmic pH and plasma membrane potential; part of the P2 subgroup of cation-transporting ATPases" * 122805-Holinger-02_itms_11.08148.08148.2 3.9278 0.3333 100.0 2222.102 2223.401 5330.3 1 7.044 57.9 1 A.GEARPVPEEYLQTDPSYGLT.S * 122805-Holinger-02_itms_11.08166.08166.2 4.3998 0.3272 100.0 2165.0813 2166.3489 6333.0 1 6.587 63.9 1 G.EARPVPEEYLQTDPSYGLT.S * 122805-Holinger-02_itms_6.05279.05279.2 2.9559 0.2123 100.0 1251.6267 1249.4651 5195.7 1 5.97 75.0 1 Q.MADEKESLVVK.F 122805-Holinger-02_itms_14.09589.09589.1 1.6432 0.1412 92.0 807.454 807.96765 4547.6 7 4.824 66.7 1 F.FVGPIQF.V 122805-Holinger-02_itms_8.06530.06530.2 2.6155 0.1174 99.6 1032.6107 1033.2102 6011.9 2 5.147 81.2 1 G.SIVDELKKT.L 122805-Holinger-03_itms_13.09103.09103.2 3.3286 0.1543 96.5 1145.6982 1146.3696 6083.1 2 4.181 83.3 4 G.SIVDELKKTL.A 122805-Holinger-03_itms_14.09237.09237.2 2.7558 0.2095 99.3 1216.7358 1217.4484 7812.7 15 4.777 65.0 1 G.SIVDELKKTLA.N * 122805-Holinger-03_itms_15.09763.09763.2 4.6778 0.2979 100.0 2416.39 2417.808 4528.4 1 5.972 52.3 5 T.AVVIRDGQLVEIPANEVVPGDIL.Q * 122805-Holinger-03_itms_15.09898.09898.2 4.2276 0.2116 99.3 2345.3538 2346.7295 4744.9 1 4.703 54.8 14 A.VVIRDGQLVEIPANEVVPGDIL.Q * 122805-Holinger-02_itms_14.09910.09910.2 3.2457 0.1898 98.7 2246.276 2247.597 5660.0 23 4.498 40.0 1 V.VIRDGQLVEIPANEVVPGDIL.Q * 122805-Holinger-02_itms_15.10280.10280.2 2.6409 0.1272 99.8 1705.9653 1706.9768 4543.1 8 5.444 50.0 1 G.QLVEIPANEVVPGDIL.Q * 122805-Holinger-02_itms_6.05359.05359.2 2.8593 0.3301 100.0 1280.6091 1281.3672 6814.6 1 5.838 75.0 1 L.AVDKHYGDQTF.S 122805-Holinger-02_itms_16.10820.10820.2 2.326 0.1469 98.8 1206.769 1207.4991 6461.9 2 4.539 62.5 1 L.GITIIGVPVGLPA.V 122805-Holinger-05_itms_7.06219.06219.2 2.3272 0.1064 90.3 986.54803 987.14355 4418.0 5 3.746 85.7 1 N.KLSLHEPY.T 122805-Holinger-03_itms_6.05058.05058.2 2.6373 0.1134 92.8 907.5035 910.05804 4220.9 30 3.901 78.6 1 K.AKDALTKY.K 122805-Holinger-04_itms_11.08294.08294.2 2.7989 0.2257 99.3 1414.7603 1415.6317 6506.4 1 4.782 63.6 1 K.VLEFHPFDPVSK.K 122805-Holinger-03_itms_10.07223.07223.2 2.3704 0.2291 99.0 1202.6031 1203.3397 3057.2 10 4.652 72.2 1 L.EFHPFDPVSK.K 122805-Holinger-03_itms_10.07232.07232.1 2.8603 0.3645 100.0 1202.6055 1203.3397 3411.5 1 6.328 66.7 1 L.EFHPFDPVSK.K 122805-Holinger-05_itms_7.06456.06456.2 2.776 0.1681 98.8 1330.7039 1331.5138 3420.2 39 4.541 60.0 1 L.EFHPFDPVSKK.V 122805-Holinger-04_itms_9.06916.06916.2 2.6945 0.15 95.7 1530.8237 1531.7515 5518.5 2 4.111 62.5 1 L.EFHPFDPVSKKVT.A 122805-Holinger-02_itms_8.06211.06211.2 3.578 0.4421 100.0 1444.7332 1445.5786 6805.7 1 7.94 75.0 1 T.AVVESPEGERIVC.V 122805-Holinger-02_itms_7.06159.06159.2 3.5544 0.3122 100.0 1671.904 1672.8853 8826.0 1 5.995 64.3 1 T.AVVESPEGERIVCVK.G 122805-Holinger-02_itms_7.06122.06122.2 3.1878 0.2704 100.0 1213.6635 1214.3611 6156.6 3 6.325 80.0 1 A.VVESPEGERIV.C 122805-Holinger-02_itms_7.05998.05998.2 3.2365 0.4383 100.0 1373.6956 1374.4999 6729.4 1 7.317 77.3 1 A.VVESPEGERIVC.V 122805-Holinger-04_itms_11.08131.08131.2 1.669 0.27 99.4 844.5429 845.0727 1914.4 29 4.95 85.7 1 K.GAPLFVLK.T 122805-Holinger-02_itms_6.05265.05265.2 3.9129 0.3183 100.0 1887.9062 1888.9855 7478.6 1 5.678 66.7 1 L.KTVEEDHPIPEDVHEN.Y 122805-Holinger-02_itms_7.05897.05897.3 3.1126 0.2872 100.0 2050.9683 2052.1614 6882.6 400 5.145 29.7 1 L.KTVEEDHPIPEDVHENY.E 122805-Holinger-02_itms_6.05565.05565.2 3.6606 0.3444 100.0 1759.8074 1760.8113 7852.8 3 6.438 57.1 1 K.TVEEDHPIPEDVHEN.Y 122805-Holinger-03_itms_9.06544.06544.3 2.7592 0.1335 97.7 1922.8668 1923.9873 3680.5 22 4.28 41.7 1 K.TVEEDHPIPEDVHENY.E 122805-Holinger-02_itms_7.06177.06177.2 4.6009 0.4062 100.0 1922.873 1923.9873 7615.5 1 7.747 63.3 1 K.TVEEDHPIPEDVHENY.E 122805-Holinger-03_itms_14.09269.09269.2 3.689 0.2242 100.0 1748.8622 1749.936 6032.2 1 5.588 64.7 1 E.RLGLGGGGDMPGSELADF.V 122805-Holinger-03_itms_14.09585.09585.2 4.4056 0.423 100.0 2091.0215 2092.2878 5800.8 1 7.74 55.0 4 E.RLGLGGGGDMPGSELADFVEN.A 122805-Holinger-02_itms_17.11425.11425.2 3.2202 0.3617 100.0 2211.9976 2213.337 6919.0 1 6.467 40.9 1 L.GLGGGGDMPGSELADFVENADGF.A 122805-Holinger-02_itms_6.05285.05285.1 2.3406 0.3967 96.9 1173.5958 1174.2529 4860.3 1 5.772 59.1 1 M.TGDGVNDAPSLK.K * 122805-Holinger-04_itms_9.07149.07149.2 3.3368 0.3478 100.0 1564.808 1565.7686 5666.1 1 6.319 62.5 1 A.YDNAPYSPKPVKW.N YLR075W 6 9 23.1% 221 25361 10.0 U RPL10 SGDID:S000004065, Chr XII from 282928-283593, Verified ORF, "Protein component of the large (60S) ribosomal subunit, responsible for joining the 40S and 60S subunits; regulates translation initiation; has similarity to rat L10 ribosomal protein and to members of the QM gene family" * 122805-Holinger-04_itms_9.07225.07225.2 3.0075 0.2475 100.0 1720.9299 1721.9574 7961.7 18 5.502 46.4 1 Y.DLGKKKATVDEFPLC.V * 122805-Holinger-03_itms_10.06948.06948.2 2.3082 0.1779 99.3 1001.53326 1002.11786 4010.2 71 4.746 62.5 2 T.VSGRDAFHL.R * 122805-Holinger-02_itms_5.04467.04467.2 3.0984 0.2331 99.3 1233.6549 1234.3489 5492.7 3 4.767 70.0 1 R.TKDSNKDVVVE.G * 122805-Holinger-03_itms_14.09534.09534.2 3.1303 0.3721 100.0 1714.8389 1715.8596 3949.1 1 5.797 61.5 3 K.GSLENNIREFPEYF.A * 122805-Holinger-03_itms_14.09483.09483.2 2.789 0.268 100.0 1856.9182 1858.0172 5355.2 1 5.517 50.0 1 K.GSLENNIREFPEYFAA.Q * 122805-Holinger-03_itms_14.09465.09465.2 2.9291 0.1481 98.4 1801.9896 1800.9652 6916.5 5 4.426 53.6 1 G.SLENNIREFPEYFAA.Q YDR471W 4 7 22.8% 136 15505 10.4 U RPL27B SGDID:S000002879, Chr IV from 1401760-1401790,1402175-1402554, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Ap and has similarity to rat L27 ribosomal protein" YHR010W 4 7 22.8% 136 15531 10.4 U RPL27A SGDID:S000001052, Chr VIII from 126515-126545,127107-127486, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl27Bp and has similarity to rat L27 ribosomal protein" 122805-Holinger-05_itms_5.05276.05276.3 3.5522 0.2273 99.4 2262.253 2263.556 7552.9 2 4.787 36.1 1 S.TETFEQPSQREEAKKVVKK.A 122805-Holinger-05_itms_5.05286.05286.3 2.9328 0.1387 96.3 2161.203 2162.451 4528.3 4 4.157 36.8 2 T.ETFEQPSQREEAKKVVKK.A 122805-Holinger-03_itms_5.04606.04606.2 2.8874 0.1605 96.2 1577.8202 1578.722 8250.4 1 4.154 70.8 1 E.TFEQPSQREEAKK.V 122805-Holinger-03_itms_5.04169.04169.2 3.2494 0.2113 95.6 1414.7083 1415.5082 5950.6 7 4.105 72.7 3 K.AFEERHQAGKNQ.W YGR214W 6 6 22.6% 252 28024 4.7 U RPS0A SGDID:S000003446, Chr VII from 920580-920669,921125-921793, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Bp; required for maturation of 18S rRNA along with Rps0Bp; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal" YLR048W 6 6 22.6% 252 27962 4.7 U RPS0B SGDID:S000004038, Chr XII from 242233-242322,242682-243350, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps0Ap; required for maturation of 18S rRNA along with Rps0Ap; deletion of either RPS0 gene reduces growth rate, deletion of both genes is lethal" 122805-Holinger-02_itms_14.09926.09926.2 2.8481 0.1035 99.3 1362.7009 1363.5071 5056.2 1 4.783 68.2 1 A.TFDLTPEDAQLL.L 122805-Holinger-05_itms_10.07790.07790.2 2.0888 0.1971 97.3 1321.7152 1322.5065 4496.5 147 4.286 54.2 1 G.ATPIAGRFTPGSF.T 122805-Holinger-05_itms_9.07752.07752.2 2.4603 0.1478 94.9 1187.7332 1188.4557 5487.2 48 4.026 61.1 1 R.SFKEPRLVIV.T 122805-Holinger-05_itms_8.06900.06900.2 2.0388 0.1644 93.9 953.63153 954.2009 4438.0 127 3.954 71.4 1 F.KEPRLVIV.T 122805-Holinger-02_itms_15.10640.10640.2 2.2242 0.1904 99.3 1088.6544 1089.3202 3349.9 90 4.708 61.1 1 A.SYVNIPVIAL.T 122805-Holinger-02_itms_12.08904.08904.2 2.6808 0.115 98.8 1323.616 1324.3838 5584.1 27 4.546 63.6 1 L.TDLDSPSEFVDV.A YDL081C 2 2 22.6% 106 10908 3.9 U RPP1A SGDID:S000002239, Chr IV from 310122-309802, reverse complement, Verified ORF, "Ribosomal protein P1 alpha, a component of the ribosomal stalk, which is involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component" * 122805-Holinger-02_itms_12.08725.08725.2 2.9878 0.2448 99.4 1156.5817 1157.2682 8359.2 19 4.92 72.2 1 A.NVPVENIWAD.I * 122805-Holinger-04_itms_8.06529.06529.2 1.9211 0.0571 90.4 1027.5975 1026.1375 3185.2 43 3.757 46.2 1 A.GAAAPAGVAGGVAG.G YBR118W 17 23 22.3% 458 50033 9.0 U TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" YPR080W 17 23 22.3% 458 50033 9.0 U TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" 122805-Holinger-03_itms_5.04547.04547.2 2.5117 0.1294 98.6 865.4881 864.9798 3127.4 12 4.471 78.6 1 T.VIDAPGHR.D 122805-Holinger-05_itms_12.09354.09354.2 3.3136 0.3448 100.0 1661.9031 1662.9286 4556.1 1 5.817 64.3 1 V.GYNPKTVPFVPISGW.N 122805-Holinger-02_itms_16.10742.10742.1 2.268 0.2347 97.4 1102.6161 1103.3062 2689.6 1 5.228 66.7 1 K.TVPFVPISGW.N 122805-Holinger-04_itms_12.08426.08426.2 3.2703 0.2603 100.0 1122.5573 1123.256 4232.9 1 5.788 87.5 3 T.TNAPWYKGW.E 122805-Holinger-04_itms_12.08418.08418.1 1.9117 0.2123 90.2 1122.5576 1123.256 7381.3 1 4.746 62.5 1 T.TNAPWYKGW.E 122805-Holinger-03_itms_4.03506.03506.2 1.6463 0.2421 98.9 1086.6338 1089.2773 3000.9 87 4.609 66.7 1 W.EKETKAGVVK.G 122805-Holinger-04_itms_9.07056.07056.3 3.4042 0.1206 99.2 2149.2021 2150.44 5155.4 4 4.392 38.9 1 L.LEAIDAIEQPSRPTDKPLR.L 122805-Holinger-05_itms_11.08463.08463.3 4.2718 0.3315 100.0 2864.5725 2866.244 9399.1 269 5.438 22.9 2 L.EAIDAIEQPSRPTDKPLRLPLQDVY.K 122805-Holinger-05_itms_10.07809.07809.2 2.0066 0.1046 90.4 1293.7198 1294.537 5798.5 82 3.754 55.0 1 T.DKPLRLPLQDV.Y 122805-Holinger-03_itms_9.06615.06615.2 2.7604 0.1526 99.3 1241.7062 1242.4178 3604.8 11 4.728 62.5 1 G.GIGTVPVGRVETG.V 122805-Holinger-03_itms_9.06612.06612.1 2.1934 0.3164 100.0 1241.7073 1242.4178 4483.2 30 6.093 41.7 1 G.GIGTVPVGRVETG.V 122805-Holinger-05_itms_7.06491.06491.2 2.3545 0.1673 98.9 1126.6464 1127.3286 4980.9 1 4.614 87.5 1 K.KLEDHPKFL.K 122805-Holinger-03_itms_13.08764.08764.2 2.7838 0.2821 99.8 1283.6675 1284.457 4078.9 72 5.426 60.0 2 E.AFSEYPPLGRF.A 122805-Holinger-03_itms_13.08848.08848.2 3.7281 0.3981 100.0 1354.7052 1355.5358 3795.9 1 6.723 81.8 1 E.AFSEYPPLGRFA.V 122805-Holinger-02_itms_7.05673.05673.2 1.5808 0.1838 99.0 918.48267 919.0251 4969.0 33 4.621 71.4 1 F.SEYPPLGR.F 122805-Holinger-03_itms_11.08018.08018.2 2.3841 0.3146 99.3 1065.5538 1066.2017 3606.6 1 4.735 81.2 3 F.SEYPPLGRF.A 122805-Holinger-03_itms_11.08004.08004.2 2.4669 0.3334 100.0 1136.5939 1137.2804 3750.2 1 5.545 83.3 1 F.SEYPPLGRFA.V YPL255W 10 11 22.1% 385 45384 6.5 U BBP1 SGDID:S000006176, Chr XVI from 67725-68882, Verified ORF, "Protein required for the spindle pole body (SPB) duplication, localized at the central plaque periphery; forms a complex with a nuclear envelope protein Mps2p and SPB components Spc29p and Kar1p; required for mitotic functions of Cdc5p" * 122805-Holinger-02_itms_13.09179.09179.2 3.7103 0.2626 99.5 2125.1172 2126.3708 3607.7 1 5.074 52.8 1 L.SNSQIPFIPPQEDDPLLSK.L * 122805-Holinger-02_itms_14.09681.09681.2 2.2433 0.027 90.7 1837.0063 1838.1107 4282.2 101 3.78 46.7 1 S.QIPFIPPQEDDPLLSK.L * 122805-Holinger-02_itms_16.10958.10958.2 3.2848 0.3687 100.0 2030.0634 2031.2701 4318.8 6 5.987 53.1 1 S.QIPFIPPQEDDPLLS*KL.F * 122805-Holinger-02_itms_5.04961.04961.2 2.3679 0.1227 91.4 1153.5847 1154.2218 4999.4 50 3.807 68.8 1 L.TKRDEIDNY.Y * 122805-Holinger-02_itms_4.03879.03879.2 2.7813 0.2041 99.5 1292.5925 1293.3446 5308.6 1 5.007 72.2 1 Y.YVRDEDACHK.N * 122805-Holinger-02_itms_10.07727.07727.2 3.6599 0.3461 100.0 1520.6796 1521.544 6821.2 1 6.119 81.8 1 R.DLEDLCEDVREQ.R * 122805-Holinger-04_itms_8.06485.06485.2 2.1199 0.1964 95.5 1187.671 1187.3812 4326.3 1 4.098 83.3 1 Y.YSLGQKYKSL.K * 122805-Holinger-03_itms_11.07574.07574.2 3.1546 0.2453 98.6 1927.9839 1929.0966 5959.6 5 4.477 50.0 2 A.TSRERLYQEEDLKNF.E * 122805-Holinger-02_itms_6.05041.05041.1 1.9348 0.2102 91.8 891.41003 891.9127 2811.3 98 4.785 66.7 1 D.NYESEIH.D * 122805-Holinger-02_itms_9.07122.07122.1 2.3676 0.2309 93.4 1119.515 1120.1608 3583.0 1 4.884 75.0 1 D.NYESEIHDL.L YGR034W 3 3 21.7% 129 14609 10.3 U RPL26B SGDID:S000003266, Chr VII from 555933-555957,556312-556676, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl26Ap and has similarity to E. coli L24 and rat L26 ribosomal proteins; binds to 5.8S rRNA" YLR344W 3 3 22.0% 127 14234 10.6 U RPL26A SGDID:S000004336, Chr XII from 819312-819330,819778-820142, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl26Bp and has similarity to E. coli L24 and rat L26 ribosomal proteins; binds to 5.8S rRNA" 122805-Holinger-05_itms_8.06923.06923.3 3.2018 0.1726 99.4 1650.9954 1651.9498 4655.7 8 4.905 40.4 1 K.ALPIRRDDEVLVVR.G 122805-Holinger-05_itms_8.06880.06880.2 2.5747 0.2888 99.3 1650.9956 1651.9498 4435.2 3 4.685 57.7 1 K.ALPIRRDDEVLVVR.G 122805-Holinger-04_itms_6.05082.05082.2 3.6672 0.2662 100.0 1514.8806 1515.7501 5384.6 1 5.801 57.7 1 A.VQVDKVTKEKVNGA.S YBR048W 4 4 20.5% 156 17749 10.8 U RPS11B SGDID:S000000252, Chr II from 332829-332873,333385-333810, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Ap and has similarity to E. coli S17 and rat S11 ribosomal proteins" YDR025W 4 4 20.5% 156 17749 10.8 U RPS11A SGDID:S000002432, Chr IV from 491511-491555,491895-492320, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins" 122805-Holinger-03_itms_11.07954.07954.2 2.8342 0.0515 91.7 1727.8969 1728.9489 6183.0 13 3.821 46.4 1 A.IEGSYIDKKCPFTGL.V 122805-Holinger-04_itms_10.07581.07581.2 3.3064 0.1067 99.7 1428.7463 1429.6221 8555.5 3 5.17 63.6 1 G.SYIDKKCPFTGL.V 122805-Holinger-05_itms_4.04439.04439.2 2.8951 0.2727 99.5 1145.6315 1146.2982 5401.6 1 5.065 77.8 1 V.TVGQCRPISK.T 122805-Holinger-05_itms_6.05648.05648.2 2.5185 0.0642 91.6 882.49884 883.03784 4076.4 20 3.815 83.3 1 A.NKQFAKF.- YDR450W 4 4 20.5% 146 17038 10.3 U RPS18A SGDID:S000002858, Chr IV from 1359913-1359959,1360395-1360788, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Bp and has similarity to E. coli S13 and rat S18 ribosomal proteins" YML026C 4 4 20.5% 146 17038 10.3 U RPS18B SGDID:S000004488, Chr XIII from 223828-223782,223380-222987, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins" 122805-Holinger-03_itms_16.10554.10554.2 2.8548 0.1631 94.6 1858.9954 1860.1327 4973.6 16 4.011 53.3 1 R.AGELTQEELERIVQIM.Q 122805-Holinger-03_itms_8.06066.06066.2 2.812 0.2555 99.9 1675.8329 1676.7831 5422.0 1 5.472 61.5 1 N.RQNDITDGKDYHTL.A 122805-Holinger-02_itms_6.05419.05419.1 2.4117 0.1705 97.6 1040.4712 1041.0593 3541.7 1 5.698 75.0 1 Q.NDITDGKDY.H 122805-Holinger-02_itms_7.06098.06098.2 2.9167 0.2149 99.8 1391.6753 1392.465 5764.1 1 5.215 77.3 1 Q.NDITDGKDYHTL.A YDL229W 12 14 20.2% 613 66602 5.4 U SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified ORF, "Cytoplasmic ATPase that is a ribosome-associated molecular chaperone; may be involved in the folding of newly-synthesized polypeptide chains; member of the heat shock protein 70 (HSP70) family; interacts with the phosphatase subunit Reg1p" * 122805-Holinger-02_itms_10.07317.07317.2 2.3391 0.1663 99.3 1247.6464 1248.3782 3653.3 24 4.687 60.0 1 A.FTPEERLIGDA.A * 122805-Holinger-02_itms_10.07322.07322.2 1.9221 0.0039 95.4 1318.6854 1319.457 6030.0 314 4.074 54.5 1 A.FTPEERLIGDAA.K 122805-Holinger-05_itms_4.04229.04229.2 2.2538 0.186 98.6 1011.589 1012.1569 5232.7 46 4.449 62.5 1 A.KNQAALNPR.N 122805-Holinger-03_itms_11.07689.07689.2 3.6796 0.2919 100.0 1524.8529 1525.7423 8049.8 1 5.918 69.2 3 F.KVIDVDGNPVIEVQ.Y 122805-Holinger-02_itms_8.06248.06248.2 2.5453 0.1191 94.6 1030.5247 1031.1504 5343.0 1 3.991 100.0 1 Q.YLEETKTF.S 122805-Holinger-03_itms_7.05585.05585.2 2.3462 0.2329 98.7 984.56335 985.12823 3506.0 71 4.583 62.5 1 L.RIINEPTAA.A 122805-Holinger-04_itms_9.06962.06962.2 2.879 0.245 99.1 1502.8447 1503.6958 7636.7 1 4.667 69.2 1 K.KKTGLDISDDARAL.R 122805-Holinger-02_itms_12.08683.08683.1 2.2973 0.3132 98.6 1232.517 1233.2305 6030.6 2 5.292 50.0 1 D.SLFDGEDFESS.L 122805-Holinger-02_itms_9.06746.06746.2 2.3561 0.2005 92.8 1576.811 1577.7313 7305.7 272 3.878 42.3 1 K.QLEKSINPDEAVAY.G * 122805-Holinger-05_itms_10.08239.08239.2 2.4551 0.2561 99.1 918.5388 919.173 4798.0 1 4.667 85.7 1 D.MFGIVVPR.N 122805-Holinger-04_itms_11.08072.08072.2 2.697 0.1519 99.8 1579.8195 1580.7472 8347.9 3 5.22 54.2 1 E.RVNCKENTLLGEF.D 122805-Holinger-04_itms_15.10656.10656.2 2.1883 0.0615 95.7 1318.6868 1318.4662 6773.3 12 4.109 59.1 1 A.GEPVLEAIFEVD.A YPL131W 8 10 19.2% 297 33715 6.8 U RPL5 SGDID:S000006052, Chr XVI from 303120-304013, Verified ORF, "Protein component of the large (60S) ribosomal subunit with similarity to E. coli L18 and rat L5 ribosomal proteins; binds 5S rRNA and is required for 60S subunit assembly" * 122805-Holinger-04_itms_6.05012.05012.2 1.9036 0.127 96.9 901.4699 901.99756 4190.8 28 4.212 83.3 1 A.YSHELPR.Y * 122805-Holinger-05_itms_6.06019.06019.2 2.6926 0.1362 91.6 1472.7551 1473.631 6225.1 5 3.81 63.6 1 A.YSHELPRYGITH.G * 122805-Holinger-04_itms_7.06104.06104.2 2.1817 0.1875 96.0 1085.5914 1086.2358 3358.5 9 4.132 75.0 1 H.ELPRYGITH.G * 122805-Holinger-02_itms_7.06034.06034.1 2.0739 0.1338 93.2 981.5066 982.07825 4887.1 3 4.9 68.8 1 L.GLDETYKGV.E * 122805-Holinger-02_itms_7.06105.06105.2 3.138 0.3371 100.0 944.4667 945.0196 5376.5 2 6.634 87.5 1 A.SDGGLYVPH.S * 122805-Holinger-03_itms_13.08890.08890.2 3.6868 0.2998 100.0 1613.7174 1614.6677 7919.4 1 6.29 66.7 3 H.SENRFPGWDFETE.E * 122805-Holinger-04_itms_7.05728.05728.2 2.2004 0.0856 90.4 1523.8226 1524.7196 4466.1 1 3.75 57.7 1 S.AHEAIRADPAFKPT.E * 122805-Holinger-05_itms_6.05613.05613.2 2.857 0.2615 99.4 1452.7866 1453.6407 4651.3 1 4.868 66.7 1 A.HEAIRADPAFKPT.E YHR174W 12 16 19.0% 437 46914 6.0 U ENO2 SGDID:S000001217, Chr VIII from 451327-452640, Verified ORF, "Enolase II, a phosphopyruvate hydratase that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate during glycolysis and the reverse reaction during gluconeogenesis; expression is induced in response to glucose" 122805-Holinger-05_itms_12.08921.08921.2 3.3727 0.1774 96.2 1849.0469 1850.165 6575.2 9 4.158 46.9 1 L.ADLSKSKTSPYVLPVPF.L 122805-Holinger-05_itms_12.09193.09193.2 2.7611 0.2107 99.3 1247.7277 1248.5077 3278.3 14 4.705 75.0 2 S.KTSPYVLPVPF.L 122805-Holinger-02_itms_16.10718.10718.1 1.7429 0.1369 90.1 1119.6289 1120.3336 4188.1 42 4.649 55.6 1 K.TSPYVLPVPF.L 122805-Holinger-03_itms_17.11001.11001.2 4.5559 0.3064 100.0 1500.8455 1501.7173 9172.8 1 7.266 80.8 3 Q.TAEEALDLIVDAIK.A 122805-Holinger-02_itms_16.10723.10723.2 2.4648 0.1374 98.5 1328.7528 1329.5333 4976.9 14 4.436 63.6 1 A.EEALDLIVDAIK.A * 122805-Holinger-04_itms_7.05649.05649.2 3.1252 0.2644 100.0 1138.6425 1139.2969 4399.7 1 5.92 85.0 1 A.GHDGKVKIGLD.C * 122805-Holinger-04_itms_7.06019.06019.2 3.6857 0.4842 100.0 1369.7133 1370.5144 4596.4 1 8.073 79.2 1 A.GHDGKVKIGLDCA.S * 122805-Holinger-03_itms_9.06454.06454.2 4.0562 0.344 100.0 1813.9281 1814.9897 5657.4 1 6.583 64.3 1 G.KYDLDFKNPESDKSK.W 122805-Holinger-02_itms_17.11256.11256.2 4.215 0.3535 100.0 1709.7283 1710.7504 7522.1 1 6.073 80.8 2 V.SIEDPFAEDDWEAW.S 122805-Holinger-02_itms_16.11137.11137.2 2.4487 0.1584 93.5 1622.6932 1623.6721 4543.9 1 3.935 58.3 1 S.IEDPFAEDDWEAW.S 122805-Holinger-04_itms_5.04982.04982.2 3.3532 0.2526 100.0 1153.5593 1154.2272 3306.8 1 5.797 83.3 1 A.GENFHHGDKL.- 122805-Holinger-04_itms_5.04994.04994.1 2.008 0.3328 97.1 1153.561 1154.2272 7286.2 159 5.769 44.4 1 A.GENFHHGDKL.- YDR418W 7 7 18.8% 165 17823 9.4 U RPL12B SGDID:S000002826, Chr IV from 1301606-1302103, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" YEL054C 7 7 18.8% 165 17823 9.4 U RPL12A SGDID:S000000780, Chr V from 53218-52721, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Bp; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins" 122805-Holinger-05_itms_8.07112.07112.3 2.6632 0.1595 99.2 1513.8839 1514.7623 6055.9 4 4.353 41.1 1 L.GLSPKKVGEDIAKAT.K 122805-Holinger-05_itms_8.07113.07113.2 2.6843 0.232 100.0 1513.8856 1514.7623 6885.2 78 5.555 46.4 1 L.GLSPKKVGEDIAKAT.K 122805-Holinger-03_itms_12.08159.08159.2 3.3726 0.286 99.9 1610.8467 1611.7948 6610.7 7 5.48 53.8 1 R.VDFKNPHDIIEGIN.A 122805-Holinger-03_itms_12.08392.08392.2 3.6378 0.2995 100.0 1681.8817 1682.8735 6939.9 1 5.594 64.3 1 R.VDFKNPHDIIEGINA.G 122805-Holinger-03_itms_12.08169.08169.2 3.6046 0.1895 99.8 1582.812 1583.741 8176.7 2 5.453 57.7 1 V.DFKNPHDIIEGINA.G 122805-Holinger-03_itms_12.08132.08132.2 4.1205 0.2048 100.0 1639.8381 1640.793 10045.9 1 5.517 75.0 1 V.DFKNPHDIIEGINAG.E 122805-Holinger-05_itms_9.07726.07726.2 2.9163 0.1201 99.5 1282.7035 1283.4697 6748.8 1 5.062 70.0 1 D.FKNPHDIIEGI.N YPL037C 2 2 18.5% 157 17020 6.5 U EGD1 SGDID:S000005958, Chr XVI from 481898-481425, reverse complement, Verified ORF, "Subunit beta1 of the nascent polypeptide-associated complex (NAC) involved in protein targeting, associated with cytoplasmic ribosomes; enhances DNA binding of the Gal4p activator; homolog of human BTF3b" * 122805-Holinger-03_itms_8.06233.06233.2 2.8241 0.1933 99.2 1285.758 1283.5107 6390.8 1 4.68 80.0 1 M.PIDQEKLAKLQ.K * 122805-Holinger-03_itms_15.09945.09945.2 2.5625 0.1145 94.2 2000.0634 1998.2865 5808.3 8 3.963 41.2 1 Y.GLPQEKNLQDLFPGIISQ.L YDR033W 10 12 18.1% 320 36191 9.2 U MRH1 SGDID:S000002440, Chr IV from 508143-509105, Verified ORF, "Protein that localizes primarily to the plasma membrane, also found at the nuclear envelope; has similarity to Hsp30p and Yro2p, which are induced during heat shock" 122805-Holinger-02_itms_10.07755.07755.2 4.0035 0.3121 100.0 1600.8236 1601.7563 5817.7 6 5.587 60.0 1 R.GGNEAIKINPPTGADF.H 122805-Holinger-03_itms_12.08109.08109.2 4.6186 0.3042 100.0 1952.0199 1953.1619 6619.7 1 6.122 58.3 3 R.GGNEAIKINPPTGADFHIT.S 122805-Holinger-04_itms_10.07806.07806.2 2.4457 0.0699 91.7 1243.6897 1244.4331 5670.9 31 3.821 63.6 1 E.AIKINPPTGADF.H 122805-Holinger-04_itms_8.06191.06191.1 2.2119 0.0963 96.3 910.5523 911.0892 2957.9 1 4.992 62.5 1 A.IKINPPTGA.D * 122805-Holinger-03_itms_12.08160.08160.2 2.8083 0.1959 99.8 1014.6003 1014.2126 6112.2 1 5.309 87.5 1 A.SNLGWIPVK.A * 122805-Holinger-05_itms_8.07114.07114.2 3.166 0.2239 99.7 1212.7305 1213.4655 6566.0 2 5.198 80.0 1 A.SNLGWIPVKAK.Y 122805-Holinger-05_itms_3.03805.03805.2 1.8976 0.2866 99.5 1115.5826 1116.2217 6379.7 12 5.019 62.5 1 S.TQKEHPGYR.Q * 122805-Holinger-02_itms_18.12167.12167.1 2.1858 0.3046 98.4 1197.7267 1198.4937 6118.7 1 5.349 61.1 1 W.FLALPWPIIQ.I * 122805-Holinger-02_itms_18.12312.12312.2 2.4616 0.118 94.3 1197.728 1198.4937 3396.7 2 3.971 77.8 1 W.FLALPWPIIQ.I * 122805-Holinger-04_itms_5.04689.04689.2 2.4512 0.31 100.0 865.5049 866.0079 4895.6 2 6.352 75.0 1 K.APVASPRPA.A YBR189W 3 3 17.9% 195 22299 10.1 U RPS9B SGDID:S000000393, Chr II from 604503-604509,604923-605503, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Bp and has similarity to E. coli S4 and rat S9 ribosomal proteins" YPL081W 3 3 17.8% 197 22443 10.0 U RPS9A SGDID:S000006002, Chr XVI from 404947-404953,405455-406041, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps9Ap and has similarity to E. coli S4 and rat S9 ribosomal proteins" 122805-Holinger-04_itms_6.05154.05154.2 1.9298 0.1685 93.1 1415.702 1416.5303 5899.9 9 3.912 54.5 1 K.TYSTPKRPYESS.R 122805-Holinger-03_itms_9.06618.06618.2 2.2063 0.1705 96.9 1191.669 1192.3604 5862.0 28 4.213 75.0 1 L.KVEDFLERR.L 122805-Holinger-04_itms_9.06847.06847.2 2.9578 0.2753 100.0 1627.8712 1628.8253 5512.7 2 5.533 50.0 1 M.VRLDSEKHIDFAPT.S YGL075C 12 22 17.8% 387 44585 8.3 U MPS2 SGDID:S000003043, Chr VII from 368091-366928, reverse complement, Verified ORF, "Essential membrane protein localized at the nuclear envelope and spindle pole body (SPB), required for insertion of the newly duplicated SPB into the nuclear envelope; potentially phosphorylated by Cdc28p" * 122805-Holinger-04_itms_22.14108.14108.2 2.5003 0.078 91.8 1481.0342 1482.7606 6433.9 175 3.825 50.0 1 Y.GKDLPKLIEIIEN.I * 122805-Holinger-03_itms_15.10276.10276.2 2.3925 0.187 99.3 1194.6743 1195.4038 6447.1 65 4.726 61.1 1 S.GSYELRLPLF.S * 122805-Holinger-03_itms_15.10087.10087.2 2.6827 0.2498 99.8 1281.7097 1282.482 3977.0 15 5.403 70.0 2 S.GSYELRLPLFS.E * 122805-Holinger-03_itms_15.10168.10168.2 2.0056 0.0458 94.6 1224.6846 1225.43 6933.0 1 4.003 72.2 1 G.SYELRLPLFS.E * 122805-Holinger-03_itms_15.10094.10094.2 3.6346 0.1967 99.8 1330.7605 1331.5547 5859.8 1 5.458 85.0 2 Y.ELRLPLFSEIN.K * 122805-Holinger-04_itms_13.09295.09295.2 2.6729 0.0855 92.8 1573.8895 1574.8174 6888.1 16 3.882 54.2 1 Y.ELRLPLFSEINKD.L * 122805-Holinger-03_itms_14.09189.09189.2 3.028 0.1891 97.2 1516.8082 1517.7245 7563.1 1 4.275 68.2 2 L.FSEINKDLFRTF.S * 122805-Holinger-03_itms_14.09369.09369.2 3.0215 0.0995 95.5 1303.6084 1304.3984 5425.0 4 4.089 77.8 3 H.KEEFDDIFFN.L * 122805-Holinger-03_itms_17.10994.10994.2 3.5262 0.1353 95.4 1416.6965 1417.5579 9072.8 2 4.075 85.0 5 H.KEEFDDIFFNL.V * 122805-Holinger-05_itms_8.06961.06961.2 3.1742 0.167 95.1 1333.7473 1334.518 5336.1 42 4.038 70.0 2 L.VNHPLREILEN.A * 122805-Holinger-02_itms_7.05834.05834.2 4.2541 0.4155 100.0 1599.6958 1600.5927 7944.6 1 7.979 75.0 1 F.EDQTDLETEYRSN.A * 122805-Holinger-02_itms_7.05598.05598.2 2.2407 0.1188 97.5 1024.4557 1027.0758 5555.5 22 4.313 78.6 1 Q.TDLETEYR.S YGL076C 4 8 17.6% 244 27638 10.1 U RPL7A SGDID:S000003044, Chr VII from 365999-365989,365529-365436,364967-364338, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl7Bp and has similarity to E. coli L30 and rat L7 ribosomal proteins; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2)" * 122805-Holinger-04_itms_7.05820.05820.3 4.4732 0.3422 100.0 1642.9658 1643.9213 9369.6 1 6.947 48.2 1 M.AAEKILTPESQLKKS.K 122805-Holinger-05_itms_7.06577.06577.2 3.4339 0.2124 99.3 1482.8555 1483.708 5247.6 11 4.897 62.5 1 N.KQRVPLSDNAIIE.A 122805-Holinger-04_itms_15.10649.10649.2 2.9651 0.2953 99.4 1268.6979 1269.4375 3826.1 25 4.934 70.0 1 L.SIDDLIHEIIT.V 122805-Holinger-05_itms_14.10481.10481.2 3.1731 0.3291 100.0 1658.9106 1659.8798 9030.7 2 6.009 57.1 5 L.SIDDLIHEIITVGPH.F YDL055C 6 7 17.5% 361 39566 6.3 U PSA1 SGDID:S000002213, Chr IV from 356759-355674, reverse complement, Verified ORF, "GDP-mannose pyrophosphorylase (mannose-1-phosphate guanyltransferase), synthesizes GDP-mannose from GTP and mannose-1-phosphate in cell wall biosynthesis; required for normal cell wall structure" * 122805-Holinger-03_itms_13.08639.08639.2 2.8418 0.1593 99.4 1175.6469 1176.4192 6169.8 16 4.949 77.8 1 L.VEFGNRPMIL.H * 122805-Holinger-03_itms_7.05345.05345.2 2.8886 0.2894 99.4 1146.6393 1147.3164 4688.6 5 4.92 72.2 1 F.VEKPKEFVGN.R * 122805-Holinger-03_itms_17.11070.11070.2 5.6498 0.3343 100.0 2003.1409 2002.4169 6537.8 1 6.726 75.0 2 G.LYILNPEVIDLIEMKPT.S * 122805-Holinger-03_itms_15.10099.10099.2 4.0579 0.2973 100.0 1724.984 1726.0814 5407.7 1 5.7 71.4 1 Y.ILNPEVIDLIEMKPT.S * 122805-Holinger-03_itms_10.07339.07339.2 3.0601 0.2247 100.0 1179.6925 1180.3898 7618.1 1 5.784 77.3 1 T.AKIGPDVVIGPN.V * 122805-Holinger-03_itms_11.07647.07647.2 3.4224 0.3867 100.0 1544.8619 1545.8346 6394.3 1 6.291 65.4 1 H.KSISDNVPKEAIIM.- YDR064W 3 4 17.2% 151 17029 10.4 U RPS13 SGDID:S000002471, Chr IV from 579455-579475,580015-580449, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S15 and rat S13 ribosomal proteins" * 122805-Holinger-03_itms_15.09861.09861.2 2.66 0.0433 94.3 1821.9639 1823.0526 7129.5 33 3.975 46.7 2 L.KSNGLAPEIPEDLYYL.I * 122805-Holinger-02_itms_16.10903.10903.1 2.1932 0.1659 97.6 1492.7855 1493.6965 7133.3 27 5.161 45.8 1 N.GLAPEIPEDLYYL.I * 122805-Holinger-04_itms_10.07559.07559.2 2.0411 0.1848 96.8 1216.6575 1217.4099 5749.0 1 4.201 66.7 1 V.AVLPPNWKYE.S YDR502C 6 7 16.9% 384 42256 5.4 U SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" * 122805-Holinger-03_itms_19.12461.12461.3 2.6658 0.1946 99.6 2993.2444 2993.3093 7889.7 1 4.411 28.0 1 D.YKTCNVLVAIEQQSPDIAQGLHYEKS.L 122805-Holinger-05_itms_6.05503.05503.2 1.9484 0.0601 94.8 1144.6273 1145.3036 6271.9 1 4.017 87.5 1 P.WLRPDTKTQ.V 122805-Holinger-05_itms_9.07284.07284.2 2.7357 0.1885 99.3 1444.781 1445.6182 8276.6 9 4.739 53.6 1 S.GRFVIGGPQGDAGLT.G 122805-Holinger-04_itms_9.07212.07212.2 2.9942 0.1616 94.9 1153.7139 1154.3953 3584.6 4 4.03 77.8 1 L.VKELDLARPI.Y 122805-Holinger-04_itms_12.08526.08526.2 3.3937 0.3227 100.0 1627.9728 1628.9524 5013.9 1 5.982 69.2 2 L.VKELDLARPIYLPT.A 122805-Holinger-05_itms_10.08314.08314.2 3.3422 0.2253 96.8 1699.0135 1700.0311 5755.4 1 4.202 60.7 1 L.VKELDLARPIYLPTA.S YBL027W 3 3 16.9% 189 21704 11.4 U RPL19B SGDID:S000000123, Chr II from 168426-168427,168812-169379, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" YBR084C-A 3 3 16.9% 189 21704 11.4 U RPL19A SGDID:S000002156, Chr II from 415255-415254,414747-414180, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl19Bp and has similarity to rat L19 ribosomal protein; rpl19a and rpl19b single null mutations result in slow growth, while the double null mutation is lethal" 122805-Holinger-05_itms_10.07871.07871.2 2.974 0.2455 100.0 1097.6663 1098.3335 6885.9 1 5.62 93.8 1 R.LPSQVVWIR.R 122805-Holinger-03_itms_5.04586.04586.2 3.4435 0.2412 100.0 1415.7488 1416.5338 6264.1 1 6.005 77.3 1 Q.REKALNEEAEAR.R 122805-Holinger-03_itms_7.05257.05257.2 2.2489 0.106 95.7 1287.7115 1288.4435 4460.7 13 4.106 60.0 1 A.EKRDALLKEDA.- YBR133C 15 19 16.8% 827 95153 6.4 U HSL7 SGDID:S000000337, Chr II from 504281-501798, reverse complement, Verified ORF, "Protein arginine N-methyltransferase that exhibits septin and Hsl1p-dependent bud neck localization and periodic Hsl1p-dependent phosphorylation; required along with Hsl1p for bud neck recruitment, phosphorylation, and degradation of Swe1p" * 122805-Holinger-02_itms_12.08969.08969.1 3.1015 0.2077 96.9 1287.7539 1288.5297 3443.5 1 5.068 70.0 1 Y.DYVLLPITTPR.Y * 122805-Holinger-03_itms_13.08949.08949.2 2.9544 0.1704 98.7 1202.6449 1203.3899 3656.4 268 4.582 66.7 1 Q.DICIPPFNVK.K * 122805-Holinger-03_itms_14.09246.09246.2 3.2406 0.2149 99.3 1563.8214 1564.7325 5969.0 15 4.794 57.7 2 K.KLDNDDTPSYIGLL.S * 122805-Holinger-02_itms_14.09937.09937.2 2.8806 0.0119 97.9 1322.6333 1323.399 5642.6 81 4.362 59.1 1 L.DNDDTPSYIGLL.S * 122805-Holinger-05_itms_9.07569.07569.3 3.1053 0.2035 92.9 1207.6816 1208.4056 3967.6 1 3.989 66.7 1 N.RSLEAPWIVH.R * 122805-Holinger-02_itms_8.06502.06502.2 3.3895 0.3049 100.0 1540.6923 1541.5652 6247.9 1 5.646 79.2 1 Q.KDTVQDEDDFTVE.F * 122805-Holinger-03_itms_15.09825.09825.2 3.2037 0.3636 100.0 1690.9208 1691.9188 8151.5 1 6.577 57.1 2 L.KQPISFIDDSELSVL.M * 122805-Holinger-03_itms_11.07956.07956.2 3.142 0.2117 99.5 1777.9663 1779.0588 7820.8 11 5.079 46.7 1 A.SMTIPRSIVTDDTKTL.A * 122805-Holinger-03_itms_11.07963.07963.3 3.5065 0.2797 100.0 1777.9677 1779.0588 5292.3 1 5.982 45.0 1 A.SMTIPRSIVTDDTKTL.A * 122805-Holinger-02_itms_14.09646.09646.2 3.4917 0.4294 100.0 2121.985 2123.1914 8240.1 1 7.123 55.9 1 N.QIDLDQDIENEEEQGFLS.N * 122805-Holinger-02_itms_14.09647.09647.2 4.8752 0.355 100.0 1993.9233 1995.0607 8216.2 1 7.044 68.8 2 Q.IDLDQDIENEEEQGFLS.N * 122805-Holinger-04_itms_7.05582.05582.2 2.3924 0.1772 99.4 1054.5541 1055.2372 5767.5 22 4.93 62.5 1 D.HLDSINKPM.F * 122805-Holinger-03_itms_11.07540.07540.3 3.8143 0.2418 99.5 2682.356 2683.8914 6619.9 1 4.679 35.2 1 T.KALEPSNELPRHEDLEEDVPEVH.V * 122805-Holinger-03_itms_10.06989.06989.3 4.3928 0.3389 100.0 2056.9932 2058.1687 7109.2 1 6.32 43.8 1 S.NELPRHEDLEEDVPEVH.V * 122805-Holinger-03_itms_10.07000.07000.2 3.8701 0.3177 100.0 2056.996 2058.1687 6432.4 1 6.343 62.5 2 S.NELPRHEDLEEDVPEVH.V YDR381W 5 8 16.8% 226 24956 11.3 U YRA1 SGDID:S000002789, Chr IV from 1236548-1236832,1237599-1237994, Verified ORF, "Nuclear protein that binds to RNA and to Mex67p, required for export of poly(A)+ mRNA from the nucleus; member of the REF (RNA and export factor binding proteins) family; another family member, Yra2p, can substitute for Yra1p function" * 122805-Holinger-05_itms_6.05820.05820.2 3.1343 0.0932 94.5 1415.8552 1416.6609 6116.5 146 3.986 63.6 1 A.KLLDTTREVKVN.V * 122805-Holinger-05_itms_6.05834.05834.2 2.7867 0.1315 94.3 1278.7771 1279.5253 4356.3 32 3.97 70.0 2 N.LIVDPNQRPVK.S * 122805-Holinger-05_itms_6.05790.05790.2 2.6976 0.2546 99.5 1365.8121 1366.6035 7043.7 1 5.06 68.2 1 N.LIVDPNQRPVKS.L * 122805-Holinger-05_itms_8.06755.06755.2 2.5271 0.1863 98.6 1478.8964 1479.763 5439.6 10 4.468 62.5 2 N.LIVDPNQRPVKSL.A * 122805-Holinger-03_itms_16.10293.10293.2 3.8493 0.1748 99.3 1575.7191 1576.715 6167.1 1 4.756 79.2 2 K.SLEDLDKEMADYF.E YMR116C 6 6 16.6% 319 34805 6.2 U ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "WD repeat protein (G-beta like protein) involved in translation regulation; required for repression of Gcn4p activity in the absence of amino-acid starvation; core component of the ribosome; ortholog of mammalian RACK1" * 122805-Holinger-03_itms_11.07770.07770.2 2.5287 0.2006 99.3 1263.6898 1264.424 5932.3 1 4.893 75.0 1 L.SASRDKTLISW.K * 122805-Holinger-05_itms_6.06050.06050.2 4.0514 0.3164 100.0 1646.915 1647.8717 7770.8 1 5.979 67.9 1 W.KLTGDDQKFGVPVRS.F * 122805-Holinger-03_itms_11.07546.07546.2 2.6497 0.2785 99.5 1998.0857 1999.2285 7909.1 78 5.061 38.2 1 S.QVRVVPNEKADDDSVTII.S * 122805-Holinger-03_itms_10.07153.07153.2 2.3515 0.044 92.9 1770.9542 1771.9652 9604.5 2 3.907 50.0 1 V.RVVPNEKADDDSVTII.S * 122805-Holinger-02_itms_6.05131.05131.2 2.0822 0.189 99.4 880.4771 880.9762 3502.3 8 4.882 75.0 1 G.YTDNVIR.V * 122805-Holinger-02_itms_11.08358.08358.2 2.7721 0.1893 99.3 1165.62 1166.3219 5178.0 1 4.814 87.5 1 G.YTDNVIRVW.Q YLR197W 9 14 16.3% 504 56864 8.9 U SIK1 SGDID:S000004187, Chr XII from 546099-547613, Verified ORF, "Essential evolutionarily-conserved nucleolar protein component of the box C/D snoRNP complexes that direct 2'-O-methylation of pre-rRNA during its maturation; overexpression causes spindle orientation defects" * 122805-Holinger-02_itms_10.07532.07532.1 2.0267 0.263 93.7 955.4584 956.0398 4484.4 3 4.864 71.4 1 L.LFEEPTGY.A * 122805-Holinger-05_itms_9.07594.07594.2 3.1418 0.125 95.5 1124.7246 1125.3971 6143.5 6 4.093 83.3 2 L.KAILDLNLPK.A * 122805-Holinger-05_itms_9.07553.07553.2 3.446 0.3162 100.0 1282.7958 1283.5541 5915.1 1 6.335 81.8 2 L.KAILDLNLPKAS.S * 122805-Holinger-04_itms_7.05709.05709.2 2.3489 0.1703 96.5 1169.7588 1172.3672 5409.1 3 4.175 75.0 1 A.ISDKNLGPSIK.E * 122805-Holinger-04_itms_17.11662.11662.2 2.7542 0.0366 95.4 1481.8527 1482.7172 8620.8 5 4.071 57.1 1 T.VAPNLSELIGEVIGA.R * 122805-Holinger-03_itms_13.08987.08987.2 3.8037 0.2928 100.0 1256.7435 1257.4728 6189.0 1 6.33 81.8 1 N.LSELIGEVIGAR.L * 122805-Holinger-05_itms_8.06784.06784.2 3.0058 0.1221 91.2 1467.8218 1468.6958 8588.6 1 3.793 80.0 1 L.KKQVEQRLEFY.N * 122805-Holinger-05_itms_7.06374.06374.2 3.6335 0.212 99.3 1311.7861 1312.5522 5167.2 2 4.767 77.3 2 T.GKPTLKNELAIQ.E * 122805-Holinger-02_itms_5.04304.04304.2 3.0945 0.1378 100.0 1330.6747 1331.4221 6637.3 19 5.512 59.1 3 Y.NKDKPAAEVEET.K YDL083C 2 2 16.1% 143 15847 10.3 U RPS16B SGDID:S000002241, Chr IV from 307789-307766,307333-306926, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Ap and has similarity to E. coli S9 and rat S16 ribosomal proteins" YMR143W 2 2 16.1% 143 15847 10.3 U RPS16A SGDID:S000004751, Chr XIII from 551927-551950,552495-552902, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Bp and has similarity to E. coli S9 and rat S16 ribosomal proteins" 122805-Holinger-03_itms_13.08899.08899.2 2.2049 0.1239 95.3 904.5665 905.12524 4873.6 21 4.061 78.6 1 L.LLVGLDKF.S 122805-Holinger-04_itms_8.06417.06417.2 3.4151 0.2024 99.5 1826.9972 1828.0752 6513.4 2 5.121 53.6 1 Q.KYVDEQSKNELKKAF.T YLL024C 11 12 15.5% 639 69470 5.1 U SSA2 SGDID:S000003947, Chr XII from 97484-95565, reverse complement, Verified ORF, "ATP binding protein involved in protein folding and vacuolar import of proteins; member of heat shock protein 70 (HSP70) family; associated with the chaperonin-containing T-complex; present in the cytoplasm, vacuolar membrane and cell wall" * 122805-Holinger-03_itms_9.06792.06792.2 2.7721 0.2407 99.3 1471.7543 1472.6005 5061.5 20 4.778 58.3 1 V.AHFSNDRVDIIAN.D * 122805-Holinger-03_itms_9.06678.06678.2 2.1192 0.2139 99.3 1400.7158 1401.5216 7367.0 1 4.825 68.2 1 A.HFSNDRVDIIAN.D * 122805-Holinger-02_itms_11.08390.08390.2 3.0491 0.4499 100.0 1425.7004 1426.5284 6354.6 1 7.57 79.2 1 N.DQGNRTTPSFVGF.T 122805-Holinger-03_itms_9.06469.06469.2 4.3545 0.259 99.8 1353.7996 1354.5895 9531.8 1 5.254 86.4 2 F.KLIDVDGKPQIQ.V 122805-Holinger-03_itms_7.05585.05585.2 2.3462 0.2329 98.7 984.56335 985.12823 3506.0 71 4.583 62.5 1 L.RIINEPTAA.A * 122805-Holinger-02_itms_11.08149.08149.1 2.079 0.2393 97.6 1136.6047 1137.275 5966.2 1 5.174 61.1 1 L.SIEDGIFEVK.A 122805-Holinger-04_itms_13.09499.09499.3 3.1611 0.2086 99.5 1598.9154 1599.8278 4285.2 4 4.584 46.2 1 F.RSTLDPVEKVLRDA.K 122805-Holinger-02_itms_9.07106.07106.2 2.0984 0.1862 92.8 912.5545 913.10205 2982.5 67 3.889 78.6 1 T.LDPVEKVL.R 122805-Holinger-05_itms_8.06981.06981.2 2.4824 0.1006 91.7 1418.8109 1418.6359 4766.9 4 3.821 57.7 1 F.ELSGIPPAPRGVPQ.I 122805-Holinger-03_itms_6.05074.05074.3 3.2844 0.1113 94.5 1736.9119 1737.9072 5637.7 97 4.06 38.5 1 E.KFKEEDEKESQRIA.S 122805-Holinger-03_itms_6.05034.05034.2 4.9347 0.2806 100.0 1736.9148 1737.9072 4794.1 1 5.632 76.9 1 E.KFKEEDEKESQRIA.S YDR447C 2 2 15.4% 136 15803 10.5 U RPS17B SGDID:S000002855, Chr IV from 1355543-1355541,1355226-1354819, reverse complement, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Ap and has similarity to rat S17 ribosomal protein" YML024W 2 2 15.4% 136 15788 10.5 U RPS17A SGDID:S000004486, Chr XIII from 225889-225891,226290-226697, Verified ORF, "Ribosomal protein 51 (rp51) of the small (40s) subunit; nearly identical to Rps17Bp and has similarity to rat S17 ribosomal protein" 122805-Holinger-04_itms_9.06840.06840.2 2.557 0.0759 92.6 1346.7354 1347.5206 5588.4 207 3.875 55.0 1 N.KRLCDEIATIQ.S 122805-Holinger-05_itms_11.08526.08526.2 2.7216 0.3114 99.6 1053.6869 1054.3182 6412.9 5 5.134 77.8 1 L.GLKLPLSVIN.V YOR369C 2 2 15.4% 143 15472 4.7 U RPS12 SGDID:S000005896, Chr XV from 1028621-1028190, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to rat ribosomal protein S12" * 122805-Holinger-04_itms_10.07754.07754.2 3.3347 0.2546 99.4 1155.7313 1156.4111 6012.5 1 4.962 94.4 1 T.IEDALKVVLR.T * 122805-Holinger-03_itms_8.06215.06215.2 2.8545 0.1138 98.1 1337.7644 1338.5468 6377.2 13 4.374 63.6 1 L.ANDPENKVPLIK.V YMR022W 1 1 15.2% 165 18520 5.2 U QRI8 SGDID:S000004624, Chr XIII from 318679-319176, Verified ORF, "Ubiquitin conjugating enzyme, involved in the ER-associated protein degradation pathway; requires Cue1p for recruitment to the ER membrane; proposed to be involved in chromatin assembly" * 122805-Holinger-05_itms_4.04801.04801.2 1.4354 0.2229 97.7 2784.5657 2783.1626 4784.8 91 4.34 16.7 1 L.SPPKLTFTPSILHPNIYPNGEVCIS.I YBL003C 4 4 15.2% 132 13989 10.7 U HTA2 SGDID:S000000099, Chr II from 235795-235397, reverse complement, Verified ORF, "One of two nearly identical (see also HTA1) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " YDR225W 4 4 15.2% 132 13989 10.7 U HTA1 SGDID:S000002633, Chr IV from 915524-915922, Verified ORF, "One of two nearly identical (see also HTA2) histone H2A subtypes; core histone required for chromatin assembly and chromosome function; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p " 122805-Holinger-04_itms_10.07484.07484.2 2.6572 0.2452 99.2 917.534 918.0837 3504.0 2 4.678 87.5 1 K.AGLTFPVGR.V 122805-Holinger-04_itms_10.07472.07472.2 1.8931 0.0901 95.4 1032.6014 1033.2156 4059.3 56 4.082 61.1 1 Q.RIGSGAPVYL.T 122805-Holinger-04_itms_9.06983.06983.1 2.0942 0.239 90.6 1133.6534 1134.3207 3371.3 60 4.724 60.0 1 Q.RIGSGAPVYLT.A 122805-Holinger-05_itms_8.06869.06869.2 2.1174 0.2261 93.5 1133.6562 1134.3207 3486.7 24 3.935 60.0 1 Q.RIGSGAPVYLT.A YDR246W-A 1 1 15.2% 66 7667 10.0 U YDR246W-A SGDID:S000028542, Chr IV from 955127-955327, Uncharacterized ORF, "Identified by fungal homology and RT-PCR" * 122805-Holinger-04_itms_18.12003.12003.2 2.0484 0.0384 94.4 1122.2172 1124.2358 6592.7 373 3.986 55.6 1 G.NTIQSITSYP.A YFR031C-A 4 4 15.0% 254 27408 11.1 U RPL2A SGDID:S000002104, Chr VI from 221406-221403,221255-220495, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Bp and has similarity to E. coli L2 and rat L8 ribosomal proteins" YIL018W 4 4 15.0% 254 27408 11.1 U RPL2B SGDID:S000001280, Chr IX from 316766-316769,317170-317930, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl2Ap and has similarity to E. coli L2 and rat L8 ribosomal proteins; expression is upregulated at low temperatures" 122805-Holinger-05_itms_5.05187.05187.2 2.281 0.1515 99.3 1121.6289 1122.2693 3501.3 10 4.833 70.0 1 Q.IVHDSGRGAPL.A 122805-Holinger-03_itms_6.04812.04812.2 3.193 0.2121 99.4 1598.8527 1599.744 6432.2 2 4.943 60.7 1 V.SNVEEKPGDRGALAR.A 122805-Holinger-03_itms_6.04817.04817.2 2.7739 0.2133 98.7 1511.8193 1512.6658 4567.9 59 4.49 53.8 1 S.NVEEKPGDRGALAR.A 122805-Holinger-04_itms_5.04493.04493.2 3.116 0.2477 98.7 1231.5509 1232.3159 5241.8 1 4.57 90.9 1 A.MNPVDHPHGGGN.H YNL178W 3 3 15.0% 240 26503 9.4 U RPS3 SGDID:S000005122, Chr XIV from 302682-303404, Verified ORF, "Protein component of the small (40S) ribosomal subunit, has apurinic/apyrimidinic (AP) endonuclease activity; essential for viability; has similarity to E. coli S3 and rat S3 ribosomal proteins" * 122805-Holinger-03_itms_11.07987.07987.2 2.6507 0.2309 99.3 1626.8412 1627.7942 8269.8 5 4.73 46.4 1 F.LIHSGQPVNDFIDTA.T * 122805-Holinger-02_itms_13.09306.09306.2 4.0648 0.2056 99.8 2232.2417 2233.564 4752.0 31 5.289 42.5 1 K.ALPDAVTIIEPKEEEPILAPS.V * 122805-Holinger-02_itms_11.07947.07947.2 2.4395 0.1985 92.8 1836.0276 1837.1205 6550.5 216 3.881 37.5 1 D.AVTIIEPKEEEPILAPS.V YNL135C 1 1 14.9% 114 12158 6.1 U FPR1 SGDID:S000005079, Chr XIV from 372228-371884, reverse complement, Verified ORF, "Peptidyl-prolyl cis-trans isomerase (PPIase), binds to the drugs FK506 and rapamycin; also binds to the nonhistone chromatin binding protein Hmo1p and may regulate its assembly or function" * 122805-Holinger-05_itms_9.07281.07281.2 2.7768 0.3099 100.0 1730.9417 1731.9463 7658.3 4 5.56 46.9 1 D.RISPGDGATFPKTGDLV.T YJL190C 2 2 14.6% 130 14626 9.9 U RPS22A SGDID:S000003726, Chr X from 75301-74909, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" YLR367W 2 2 14.6% 130 14626 9.9 U RPS22B SGDID:S000004359, Chr XII from 856441-856573,857057-857316, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins" 122805-Holinger-03_itms_11.07899.07899.2 2.4187 0.1798 99.3 1087.6328 1088.292 6330.8 7 4.737 75.0 1 N.VKIGDIEKW.T 122805-Holinger-04_itms_10.07553.07553.2 2.346 0.1729 96.1 1132.977 1131.3201 5001.8 16 4.148 66.7 1 W.TANLLPARQF.G YLR146W-A 1 1 14.5% 62 7078 4.8 U YLR146W-A SGDID:S000113566, Chr XII from 433871-434059, Uncharacterized ORF, "Putative protein of unknown function" * 122805-Holinger-02_itms_5.04465.04465.2 2.3712 0.0736 95.4 1102.6156 1103.2235 4173.1 62 4.07 75.0 1 Q.LRDTNSQIR.C YPR165W 2 2 14.4% 209 23152 6.2 U RHO1 SGDID:S000006369, Chr XVI from 875364-875993, Verified ORF, "GTP-binding protein of the rho subfamily of Ras-like proteins, involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p)" * 122805-Holinger-03_itms_11.07935.07935.2 2.4026 0.1421 97.0 1351.7134 1352.5297 4067.0 2 4.249 59.1 1 F.SKGQFPEVYVPT.V * 122805-Holinger-03_itms_16.10444.10444.2 3.0407 0.1191 91.3 2104.1013 2105.352 8042.4 1 3.795 47.1 1 C.FSIDLPDSLENVQEKWIA.E Reverse_YBR282W 1 1 14.4% 146 16492 10.1 U MRPL27 SGDID:S000000486, Chr II from 768236-768676, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" * 122805-Holinger-05_itms_14.10196.10196.2 2.1144 0.2167 98.6 2210.696 2210.5566 7304.1 6 4.482 35.0 1 R.GIGSARTGKYMTKNGQKTTLP.V YNL188W 5 6 14.3% 433 50653 9.3 U KAR1 SGDID:S000005132, Chr XIV from 286309-287610, Verified ORF, "Essential protein involved in karyogamy during mating and in spindle pole body duplication during mitosis, localizes to the half-bridge of the spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p" * 122805-Holinger-04_itms_8.06635.06635.2 3.2676 0.2768 100.0 1502.7281 1503.6139 6610.3 4 5.778 63.6 2 N.NYNKRETGYNPF.Y * 122805-Holinger-03_itms_10.07162.07162.2 2.6271 0.2671 92.9 1720.7363 1720.6978 7879.4 12 5.451 53.8 1 K.AEEYIS*DEDNVKID.E * 122805-Holinger-03_itms_7.05225.05225.2 2.1527 0.148 92.2 1023.52747 1024.1185 4360.1 13 3.857 71.4 1 Q.RKEEVFTD.E * 122805-Holinger-05_itms_5.05339.05339.2 3.7315 0.1218 99.3 1599.972 1600.8992 6245.2 1 4.704 66.7 1 D.EVLQKKRELIESK.W * 122805-Holinger-04_itms_4.03740.03740.2 2.5729 0.1757 99.4 1762.9628 1763.9457 4575.6 16 4.91 53.6 1 L.KDDTDSKEKRKVVTN.D YMR230W 4 5 14.3% 105 12738 9.1 U RPS10B SGDID:S000004843, Chr XIII from 732413-732464,732875-733140, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Ap and has similarity to rat ribosomal protein S10" YOR293W 4 5 14.3% 105 12739 8.8 U RPS10A SGDID:S000005819, Chr XV from 867095-867146,867584-867849, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps10Bp and has similarity to rat ribosomal protein S10" 122805-Holinger-05_itms_10.07833.07833.2 2.3126 0.249 99.3 1536.849 1537.7587 3771.9 2 4.715 62.5 1 L.REYLNLPEHIVPG.T 122805-Holinger-05_itms_10.08161.08161.2 2.7378 0.298 99.4 1637.8964 1638.8638 4545.4 15 4.915 53.8 2 L.REYLNLPEHIVPGT.Y 122805-Holinger-05_itms_10.08247.08247.2 3.0982 0.372 100.0 1800.9629 1802.0398 3554.3 1 5.621 60.7 1 L.REYLNLPEHIVPGTY.I 122805-Holinger-04_itms_11.08356.08356.2 2.033 0.1315 94.6 1352.7462 1353.5608 3130.6 1 3.994 72.7 1 Y.LNLPEHIVPGTY.I YOL005C 1 1 14.2% 120 13616 5.6 U RPB11 SGDID:S000005365, Chr XV from 316175-315813, reverse complement, Verified ORF, "RNA polymerase II subunit B12.5; part of central core; similar to Rpc19p and bacterial alpha subunit" * 122805-Holinger-04_itms_12.08692.08692.2 2.0623 0.0741 90.2 1842.0719 1843.1736 9880.6 47 3.736 37.5 1 K.LKIDPDTKAPNAVVITF.E YBR072W 2 2 14.0% 214 23880 5.5 U HSP26 SGDID:S000000276, Chr II from 382027-382671, Verified ORF, "Small heat shock protein with chaperone activity that is regulated by a heat induced transition from an inactive oligomeric (24-mer) complex to an active dimer; induced by heat, upon entry into stationary phase, and during sporulation" * 122805-Holinger-03_itms_15.10285.10285.2 2.6501 0.2134 96.8 2028.8878 2030.068 5482.9 1 4.2 43.3 1 L.YDPRDETLDDWFDNDL.S * 122805-Holinger-03_itms_12.08168.08168.2 3.1355 0.3661 100.0 1530.8048 1531.7056 5071.7 1 6.866 61.5 1 K.RVITLPDYPGVDAD.N Reverse_YPR182W 1 1 14.0% 86 9660 6.5 U SMX3 SGDID:S000006386, Chr XVI from 900190-900450, Verified ORF, "Core Sm protein Sm F; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Smd3p, Sme1p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm F" * 122805-Holinger-03_itms_12.08368.08368.2 2.6199 0.0469 97.1 1318.7567 1320.6241 4713.9 6 4.258 63.6 1 K.LKVGVRHNVLGK.L YLR180W 6 7 13.6% 382 41818 5.2 U SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" 122805-Holinger-05_itms_6.05503.05503.2 1.9484 0.0601 94.8 1144.6273 1145.3036 6271.9 1 4.017 87.5 1 A.WLRPDTKTQ.V 122805-Holinger-05_itms_9.07284.07284.2 2.7357 0.1885 99.3 1444.781 1445.6182 8276.6 9 4.739 53.6 1 S.GRFVIGGPQGDAGLT.G * 122805-Holinger-02_itms_11.08419.08419.2 3.9417 0.2657 100.0 1491.8021 1491.6788 5481.6 2 5.856 75.0 1 A.TKSDEEIIDIISK.N 122805-Holinger-04_itms_9.07212.07212.2 2.9942 0.1616 94.9 1153.7139 1154.3953 3584.6 4 4.03 77.8 1 L.VKELDLARPI.Y 122805-Holinger-04_itms_12.08526.08526.2 3.3937 0.3227 100.0 1627.9728 1628.9524 5013.9 1 5.982 69.2 2 L.VKELDLARPIYLPT.A 122805-Holinger-05_itms_10.08314.08314.2 3.3422 0.2253 96.8 1699.0135 1700.0311 5755.4 1 4.202 60.7 1 L.VKELDLARPIYLPTA.S YML022W 2 3 13.4% 187 20587 5.1 U APT1 SGDID:S000004484, Chr XIII from 228937-229500, Verified ORF, "Adenine phosphoribosyltransferase, catalyzes the formation of AMP from adenine and 5-phosphoribosylpyrophosphate; involved in the salvage pathway of purine nucleotide biosynthesis" * 122805-Holinger-04_itms_14.09679.09679.2 2.5213 0.2571 98.7 1661.864 1662.8853 6960.9 17 4.493 46.2 2 A.LHQYPNFPSEGILF.E * 122805-Holinger-05_itms_12.09435.09435.2 2.8996 0.2802 99.5 1202.7363 1203.4673 7478.5 4 4.994 70.0 1 R.SKLNAPVFTLL.N YOR310C 13 16 13.3% 511 56956 8.9 U NOP58 SGDID:S000005837, Chr XV from 898355-896820, reverse complement, Verified ORF, "Protein involved in pre-rRNA processing, 18S rRNA synthesis, and snoRNA synthesis; component of the small subunit processome complex, which is required for processing of pre-18S rRNA" * 122805-Holinger-02_itms_6.05362.05362.2 2.2642 0.1992 99.8 1119.6069 1120.245 6230.0 8 5.246 72.2 1 Q.DLDSSDKVLK.E * 122805-Holinger-02_itms_10.07831.07831.2 3.1226 0.2312 99.4 1395.7234 1396.5371 6990.0 1 4.914 77.3 2 Q.DLDSSDKVLKEF.K * 122805-Holinger-04_itms_5.04936.04936.2 2.7459 0.1119 95.3 1431.8691 1432.7007 6616.6 2 4.065 68.2 1 L.LEEIKKDKKSTL.I * 122805-Holinger-04_itms_7.05857.05857.2 3.2244 0.306 99.7 1731.0585 1732.0709 3721.0 4 5.165 53.6 1 L.LEEIKKDKKSTLIVS.E * 122805-Holinger-02_itms_10.07646.07646.2 2.7292 0.1187 97.7 1338.6638 1339.4418 6276.8 5 4.332 70.0 1 L.LDDLDKELNTY.A * 122805-Holinger-03_itms_14.09315.09315.2 4.5163 0.3545 100.0 2187.1438 2188.3936 5289.0 1 6.346 47.2 1 K.ASETDLSEILPEEIEERVK.T * 122805-Holinger-03_itms_14.09336.09336.3 2.955 0.1114 92.2 2187.1455 2188.3936 5632.8 22 3.936 31.9 2 K.ASETDLSEILPEEIEERVK.T * 122805-Holinger-03_itms_15.09761.09761.2 4.4265 0.121 99.3 2359.2332 2360.5774 5303.4 1 4.888 50.0 1 K.ASETDLSEILPEEIEERVKTA.A * 122805-Holinger-03_itms_15.09752.09752.3 3.703 0.142 99.4 2359.2373 2360.5774 7100.6 2 4.858 31.2 1 K.ASETDLSEILPEEIEERVKTA.A * 122805-Holinger-04_itms_13.09169.09169.2 4.2147 0.1938 99.5 2029.0762 2030.2366 5844.3 1 5.037 56.2 2 S.ETDLSEILPEEIEERVK.T * 122805-Holinger-03_itms_15.09755.09755.2 3.7317 0.2309 99.3 2201.1626 2202.4204 5225.2 28 4.795 38.9 1 S.ETDLSEILPEEIEERVKTA.A * 122805-Holinger-03_itms_11.07920.07920.2 3.0635 0.2968 99.7 1483.8246 1484.6897 4736.3 9 5.176 63.6 1 S.EILPEEIEERVK.T * 122805-Holinger-03_itms_9.06647.06647.2 3.019 0.2253 99.3 913.5617 914.09283 4030.6 1 4.699 87.5 1 Q.LVGELVGAR.L YGL147C 3 3 13.1% 191 21569 9.7 U RPL9A SGDID:S000003115, Chr VII from 228334-227759, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Bp and has similarity to E. coli L6 and rat L9 ribosomal proteins" YNL067W 3 3 13.1% 191 21657 9.7 U RPL9B SGDID:S000005011, Chr XIV from 499682-500257, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl9Ap and has similarity to E. coli L6 and rat L9 ribosomal proteins" 122805-Holinger-03_itms_9.06375.06375.3 2.5486 0.2259 100.0 1503.8767 1504.7697 6168.9 18 5.186 45.8 1 N.IVEKDGAKFIEVR.N 122805-Holinger-03_itms_9.06376.06376.2 3.7562 0.3237 100.0 1503.8774 1504.7697 7869.6 1 6.554 79.2 1 N.IVEKDGAKFIEVR.N 122805-Holinger-02_itms_11.08345.08345.1 2.9755 0.2574 96.8 1345.843 1346.526 3296.3 1 5.09 59.1 1 R.NVPVRDGVTIEF.S YBR127C 5 5 13.0% 517 57749 5.1 U VMA2 SGDID:S000000331, Chr II from 492816-491263, reverse complement, Verified ORF, "Subunit B of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; contains nucleotide binding sites; also detected in the cytoplasm" * 122805-Holinger-02_itms_11.08394.08394.2 2.2901 0.175 91.9 1248.705 1249.4497 6477.5 192 3.834 60.0 1 M.VLSDKELFAIN.K * 122805-Holinger-04_itms_11.07941.07941.3 4.8847 0.324 100.0 1472.8115 1473.7307 8441.6 1 6.937 52.1 1 E.SLRIPVSEDMLGR.I * 122805-Holinger-04_itms_10.07616.07616.2 2.2237 0.1959 98.3 862.52014 863.0446 3848.3 34 4.404 64.3 1 Q.KIPIFSAS.G * 122805-Holinger-03_itms_15.10234.10234.2 3.616 0.2967 100.0 2464.289 2465.8237 5802.4 3 5.642 33.3 1 T.QIPILTMPNDDITHPIPDLTGY.I * 122805-Holinger-02_itms_15.10380.10380.2 3.2073 0.2835 100.0 1369.7957 1370.6317 5605.3 36 6.25 58.3 1 K.GIYPPINVLPSLS.R YML074C 6 7 12.9% 411 46553 4.5 U FPR3 SGDID:S000004539, Chr XIII from 121324-120089, reverse complement, Verified ORF, "Nucleolar peptidyl-prolyl cis-trans isomerase (PPIase); FK506 binding protein; phosphorylated by casein kinase II (Cka1p-Cka2p-Ckb1p-Ckb2p) and dephosphorylated by Ptp1p" * 122805-Holinger-03_itms_15.09804.09804.2 4.5579 0.3615 100.0 2416.3906 2413.8347 6900.4 1 7.23 52.4 2 Y.SLNVEPYTPVPAIDVTMPITVR.I * 122805-Holinger-03_itms_15.09795.09795.2 3.9505 0.3332 99.8 2325.298 2326.7563 6432.9 1 5.419 50.0 1 S.LNVEPYTPVPAIDVTMPITVR.I * 122805-Holinger-03_itms_13.09000.09000.2 3.0739 0.3002 99.8 1609.9282 1610.9525 5973.0 1 5.437 57.1 1 Y.TPVPAIDVTMPITVR.I * 122805-Holinger-02_itms_11.07939.07939.2 2.9147 0.1513 97.7 1144.6572 1145.4027 5683.6 6 4.332 77.8 1 A.IDVTMPITVR.I * 122805-Holinger-03_itms_14.09501.09501.2 4.0627 0.3465 100.0 1758.7606 1759.7827 6799.9 1 5.785 64.3 1 K.RNPDFEDDDFLGGDF.D 122805-Holinger-04_itms_12.08745.08745.2 2.5779 0.2371 98.7 1642.9103 1643.8802 6939.8 32 4.579 46.7 1 Y.GKQALPGIPANSELTF.D YAL047C 9 9 12.7% 622 72105 5.1 U SPC72 SGDID:S000000045, Chr I from 56858-54990, reverse complement, Verified ORF, "Component of the cytoplasmic Tub4p (gamma-tubulin) complex, binds spindle pole bodies and links them to microtubules; has roles in astral microtubule formation and stabilization" * 122805-Holinger-03_itms_5.04577.04577.2 2.4737 0.165 92.6 1065.5486 1066.1588 3719.2 17 3.872 72.2 1 R.SSHNDPIKPA.L * 122805-Holinger-03_itms_5.04553.04553.2 2.0774 0.0608 95.3 1029.6704 1032.1417 3796.3 444 4.065 62.5 1 M.NDSNKVKNL.E * 122805-Holinger-02_itms_8.06274.06274.2 3.6125 0.4282 100.0 1567.7361 1568.6427 6373.2 1 6.95 83.3 1 L.THFNEQDENAHLL.D * 122805-Holinger-02_itms_7.06009.06009.2 2.8265 0.2379 99.4 1182.5588 1183.22 5437.9 2 4.904 83.3 1 F.NEQDENAHLL.D * 122805-Holinger-03_itms_10.06987.06987.2 3.1345 0.1507 98.6 1491.7438 1492.5798 6775.4 16 4.486 63.6 1 L.DKEERETLEETL.E * 122805-Holinger-03_itms_13.08709.08709.2 2.9136 0.1877 97.4 1821.8191 1821.933 6195.1 2 4.302 50.0 1 L.DKEERETLEETLELS.S * 122805-Holinger-03_itms_11.07501.07501.2 3.9227 0.1443 92.3 1342.816 1343.6066 7768.0 5 3.859 80.0 1 N.NLEKLKEDIIK.M * 122805-Holinger-05_itms_8.06875.06875.2 3.1593 0.1004 95.7 1309.8136 1310.5797 7612.8 2 4.11 85.0 1 L.KNLNLIQPKLE.S * 122805-Holinger-02_itms_6.05172.05172.2 2.6517 0.2938 100.0 1188.6073 1189.2676 6345.4 1 5.792 88.9 1 K.ALEQENESLR.S YOL086C 4 4 12.6% 348 36849 6.7 U ADH1 SGDID:S000005446, Chr XV from 160593-159547, reverse complement, Verified ORF, "Alcohol dehydrogenase, fermentative isozyme active as homo- or heterotetramers; required for the reduction of acetaldehyde to ethanol, the last step in the glycolytic pathway" * 122805-Holinger-05_itms_6.05670.05670.2 2.7147 0.2147 98.9 1498.8555 1499.7501 4605.6 7 4.607 62.5 1 L.EYKDIPVPKPKAN.E 122805-Holinger-04_itms_10.07293.07293.2 2.8574 0.3529 100.0 1048.5762 1049.2174 5700.2 2 6.419 81.2 1 W.HGDWPLPVK.L * 122805-Holinger-06_itms_11.09664.09664.2 1.4505 0.1567 91.7 1230.2157 1228.3972 6961.8 1 3.824 54.5 1 T.DLAQVAPILCAG.I * 122805-Holinger-03_itms_13.08688.08688.2 2.7969 0.2546 100.0 1124.6313 1125.3127 5733.4 2 5.62 77.8 1 E.LFRSIGGEVF.I YGL123W 5 5 12.6% 254 27450 10.4 U RPS2 SGDID:S000003091, Chr VII from 277623-278387, Verified ORF, "Protein component of the small (40S) subunit, essential for control of translational accuracy; has similarity to E. coli S5 and rat S2 ribosomal proteins" * 122805-Holinger-02_itms_16.11003.11003.2 2.9819 0.2612 99.5 1684.9122 1685.9734 4349.9 16 4.985 57.1 1 F.QIIDTLLPGLQDEVM.N * 122805-Holinger-04_itms_15.10607.10607.2 3.6088 0.1457 92.8 2236.269 2237.66 4781.0 52 3.884 42.1 1 F.QIIDTLLPGLQDEVMNIKPV.Q * 122805-Holinger-02_itms_14.10036.10036.2 3.0503 0.1469 98.5 1349.7681 1350.6006 5007.3 1 4.434 72.7 1 N.LWAEQPLPVSPL.D * 122805-Holinger-02_itms_14.10034.10034.1 2.2053 0.2614 98.0 1349.7688 1350.6006 6335.2 1 5.511 59.1 1 N.LWAEQPLPVSPL.D * 122805-Holinger-02_itms_11.08158.08158.1 2.1818 0.2487 97.4 1050.6038 1051.2279 5216.6 67 5.725 55.6 1 W.AEQPLPVSPL.D YPL119C-A 1 1 12.6% 87 10112 6.8 U YPL119C-A SGDID:S000028859, Chr XVI from 324286-324023, reverse complement, Uncharacterized ORF, "Identified by expression profiling and mass spectrometry" * 122805-Holinger-03_itms_9.06760.06760.2 1.5761 0.1844 95.4 1150.6399 1151.2615 4504.5 3 4.081 60.0 1 T.HGTSVLSSSLY.S Reverse_YLR099W-A 1 1 12.6% 87 9985 4.4 U YLR099W-A SGDID:S000007618, Chr XII from 341326-341589, Uncharacterized ORF, "Hypothetical protein identified by homology. See FEBS Letters [2000] 487:31-36." * 122805-Holinger-03_itms_19.12362.12362.2 1.5311 0.1865 92.8 1209.1208 1206.2488 4924.9 250 3.896 50.0 1 G.DEELGEVSNIT.D YDR385W 14 16 12.5% 842 93289 6.3 U EFT2 SGDID:S000002793, Chr IV from 1243220-1245748, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT1; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" YOR133W 14 16 12.5% 842 93289 6.3 U EFT1 SGDID:S000005659, Chr XV from 575098-577626, Verified ORF, "Elongation factor 2 (EF-2), also encoded by EFT2; catalyzes ribosomal translocation during protein synthesis; contains diphthamide, the unique posttranslationally modified histidine residue specifically ADP-ribosylated by diphtheria toxin" 122805-Holinger-05_itms_6.05632.05632.1 1.9481 0.3101 96.3 949.52875 950.08246 5179.1 2 4.992 62.5 1 L.HLPSPVTAQ.A 122805-Holinger-04_itms_8.06577.06577.2 2.6055 0.2377 97.2 1425.9517 1423.6952 3721.4 2 4.276 68.2 1 N.YVPGKKDDLFIK.A 122805-Holinger-03_itms_14.09691.09691.2 3.4368 0.3768 100.0 2074.0515 2075.3533 7090.5 1 6.512 44.4 1 M.MGRFVEPIDDCPAGNIIGL.V 122805-Holinger-03_itms_14.09436.09436.2 4.2276 0.3788 100.0 1943.0076 1944.1608 6239.8 1 7.831 61.8 3 M.GRFVEPIDDCPAGNIIGL.V 122805-Holinger-03_itms_14.09487.09487.2 2.6298 0.2671 99.8 1885.9852 1887.1089 7622.8 1 5.215 46.9 1 G.RFVEPIDDCPAGNIIGL.V 122805-Holinger-04_itms_9.06770.06770.2 2.7355 0.2456 99.4 990.5786 991.17535 3386.4 16 4.959 81.2 1 M.KFSVSPVVQ.V 122805-Holinger-02_itms_12.08917.08917.2 2.8818 0.2139 99.9 1097.6393 1098.2847 4625.2 1 5.466 83.3 1 A.NDLPKLVEGL.K 122805-Holinger-05_itms_8.06848.06848.2 2.876 0.1546 98.7 976.59796 974.1882 4590.1 10 4.519 75.0 1 L.KISPPVVAY.R 122805-Holinger-03_itms_14.09481.09481.2 3.238 0.2281 99.8 1482.8845 1483.7911 7555.6 7 5.296 62.5 1 F.LLADPKIQEPVFL.V 122805-Holinger-03_itms_15.09879.09879.2 2.4772 0.257 99.3 1581.9563 1582.9237 5797.2 70 4.8 46.2 1 F.LLADPKIQEPVFLV.E 122805-Holinger-03_itms_14.09548.09548.2 3.1596 0.278 100.0 1711.0027 1712.0392 5917.3 1 5.54 60.7 1 F.LLADPKIQEPVFLVE.I 122805-Holinger-03_itms_13.09005.09005.2 2.3789 0.1693 98.8 1369.798 1370.6317 6419.0 232 4.543 50.0 1 L.LADPKIQEPVFL.V 122805-Holinger-02_itms_6.05166.05166.2 2.0295 0.1293 90.2 1113.5732 1114.2004 5274.8 352 3.736 61.1 1 V.SEEQRPGTPL.F 122805-Holinger-03_itms_14.09167.09167.2 2.3824 0.2493 99.3 1526.7461 1527.6733 2840.4 38 4.768 59.1 1 E.EVPGWQEYYDKL.- YBR191W 2 2 12.5% 160 18242 10.4 U RPL21A SGDID:S000000395, Chr II from 606265-606275,606664-607135, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp and has similarity to rat L21 ribosomal protein" YPL079W 2 2 12.5% 160 18274 10.4 U RPL21B SGDID:S000006000, Chr XVI from 406633-406643,407065-407536, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Ap and has similarity to rat L21 ribosomal protein" 122805-Holinger-03_itms_9.06501.06501.1 2.1983 0.1594 97.7 986.6075 987.1845 4075.8 26 5.136 56.2 1 Y.KVGDIVDIK.A 122805-Holinger-05_itms_7.06169.06169.2 2.7228 0.2299 98.8 1289.7142 1290.5046 8083.4 3 4.551 70.0 1 H.KFYQGKTGVVY.N YIL148W 1 1 12.5% 128 14554 9.8 U RPL40A SGDID:S000001410, Chr IX from 68708-68715,69150-69528, Verified ORF, "Fusion protein, identical to Rpl40Bp, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" YLR167W 1 1 10.5% 152 17216 9.9 U RPS31 SGDID:S000004157, Chr XII from 498949-499407, Verified ORF, "Fusion protein that is cleaved to yield a ribosomal protein of the small (40S) subunit and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B" YLL039C 1 5 4.2% 381 42826 7.6 U UBI4 SGDID:S000003962, Chr XII from 65206-64061, reverse complement, Verified ORF, "Ubiquitin, becomes conjugated to proteins, marking them for selective degradation via the ubiquitin-26S proteasome system; essential for the cellular stress response" YKR094C 1 1 12.5% 128 14554 9.8 U RPL40B SGDID:S000001802, Chr XI from 618392-618385,618016-617638, reverse complement, Verified ORF, "Fusion protein, identical to Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes" 122805-Holinger-03_itms_11.07998.07998.3 3.0616 0.0782 96.9 1897.0485 1898.1692 4371.3 2 4.185 43.3 1 K.IQDKEGIPPDQQRLIF.A YMR242C 3 4 12.4% 178 21236 10.3 U RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein" YOR312C 3 4 12.6% 174 20713 10.3 U RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein" 122805-Holinger-04_itms_7.05790.05790.2 3.0634 0.086 93.2 1252.7098 1253.441 4002.4 6 3.918 85.0 2 R.RLPTESVPEPK.L 122805-Holinger-05_itms_10.07854.07854.2 2.7832 0.1576 95.7 1512.8687 1513.7771 4523.8 1 4.106 66.7 1 R.RLPTESVPEPKLF.R 122805-Holinger-05_itms_6.05927.05927.2 2.1815 0.208 99.5 1148.5934 1149.2914 5873.7 6 5.015 68.8 1 F.SYKRPSTFY.- YER165W 7 7 12.3% 577 64344 6.0 U PAB1 SGDID:S000000967, Chr V from 510368-512101, Verified ORF, "Poly(A) binding protein, part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G" * 122805-Holinger-02_itms_13.09164.09164.1 2.0195 0.2458 92.3 1022.56 1022.143 3799.6 2 4.853 50.0 1 Y.DIFSPIGSVS.S * 122805-Holinger-05_itms_6.05782.05782.2 2.4461 0.1075 95.4 1224.6649 1222.396 4368.3 39 4.073 72.2 1 L.NYTPIKGRLC.R * 122805-Holinger-05_itms_9.07717.07717.2 2.982 0.3963 100.0 1036.6027 1037.2468 5521.4 1 5.953 77.8 1 L.FAKFGPIVSA.S * 122805-Holinger-03_itms_6.04992.04992.2 3.0808 0.214 99.0 1203.6815 1204.366 4478.7 50 4.656 65.0 1 A.SLEKDADGKLK.G * 122805-Holinger-03_itms_13.08747.08747.2 4.0591 0.3459 100.0 2355.1387 2356.5017 5259.4 1 6.13 50.0 1 F.VKNLDDSVDDEKLEEEFAPY.G * 122805-Holinger-02_itms_13.09280.09280.2 3.2314 0.1277 92.2 2127.9604 2129.195 4386.0 1 3.857 55.9 1 K.NLDDSVDDEKLEEEFAPY.G * 122805-Holinger-02_itms_14.09912.09912.2 2.5237 0.0837 94.4 1154.6302 1155.336 4417.1 2 3.984 72.2 1 L.DLPPQEVFPL.L YPL061W 5 5 12.2% 500 54414 5.4 U ALD6 SGDID:S000005982, Chr XVI from 432585-434087, Verified ORF, "Cytosolic aldehyde dehydrogenase that is activated by Mg2+ and utilizes NADP+ as the preferred coenzyme; required for the conversion of acetaldehyde to acetate; constitutively expressed" * 122805-Holinger-03_itms_13.08766.08766.2 2.7795 0.1507 98.6 1352.8064 1353.6017 5185.3 1 4.447 70.8 1 D.TAEPVKITLPNGL.T * 122805-Holinger-04_itms_18.12254.12254.3 2.5142 0.1885 99.5 1711.2262 1706.9341 4027.5 1 4.576 41.7 1 G.KSVAVDSSESNLKKIT.L * 122805-Holinger-04_itms_8.06312.06312.3 3.1411 0.1866 99.5 1724.9282 1725.942 4377.1 1 4.497 45.0 1 L.TGGEKVGDKGYFIRPT.V * 122805-Holinger-03_itms_11.07725.07725.2 4.6157 0.3352 100.0 1701.8527 1702.8638 7950.2 1 6.817 78.6 1 N.TYNDFDSRVPFGGVK.Q * 122805-Holinger-03_itms_11.07615.07615.2 3.1387 0.2119 99.8 1829.9127 1830.9945 6928.7 1 5.233 46.7 1 N.TYNDFDSRVPFGGVKQ.S YGR159C 4 4 12.1% 414 44535 4.9 U NSR1 SGDID:S000003391, Chr VII from 807661-806417, reverse complement, Verified ORF, "Nucleolar protein that binds nuclear localization sequences, required for pre-rRNA processing and ribosome biogenesis" * 122805-Holinger-03_itms_6.05066.05066.2 2.5686 0.1882 96.3 1258.6423 1259.3708 5185.3 13 4.162 70.0 1 Q.GKEIDGRPINC.D * 122805-Holinger-02_itms_13.09377.09377.2 2.5029 0.3233 99.3 1378.661 1379.4631 3808.3 195 4.903 50.0 1 F.GDTPSEPSDTLFL.G * 122805-Holinger-04_itms_21.13650.13650.2 2.7833 0.17 92.9 1544.764 1545.6915 6346.8 5 3.906 62.5 1 L.SFNADRDAIFELF.A * 122805-Holinger-04_itms_7.06043.06043.2 2.7533 0.1284 99.3 1480.7684 1481.6482 4420.6 3 4.81 54.2 1 R.IPTHPETEQPKGF.G YOR096W 2 3 12.1% 190 21622 9.8 U RPS7A SGDID:S000005622, Chr XV from 505794-505937,506339-506767, Verified ORF, "Protein component of the small (40S) ribosomal subunit, nearly identical to Rps7Bp; interacts with Kti11p; deletion causes hypersensitivity to zymocin; has similarity to rat S7 and Xenopus S8 ribosomal proteins" * 122805-Holinger-02_itms_14.09977.09977.1 2.001 0.2003 90.2 1013.62134 1014.2529 5578.4 3 4.712 61.1 1 L.AIFVPVPSLA.G * 122805-Holinger-05_itms_24.15946.15946.2 2.6651 0.288 99.8 1524.4961 1526.7728 6030.6 2 5.444 62.5 2 A.VHDKILEDLVFPT.E YLR249W 16 20 12.0% 1044 115945 6.0 U YEF3 SGDID:S000004239, Chr XII from 636782-639916, Verified ORF, "Translational elongation factor, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1 alpha from the ribosomal complex; contains two ABC cassettes; binds and hydrolyses ATP" * 122805-Holinger-03_itms_14.09582.09582.2 2.4991 0.0251 91.2 1118.6672 1119.3464 6409.3 1 3.793 87.5 1 K.VLEELFQKL.S * 122805-Holinger-03_itms_13.09007.09007.2 3.9276 0.3898 100.0 1966.9672 1968.1326 7327.6 1 6.567 50.0 2 F.LNGNIIEHDVPEHFFGE.L * 122805-Holinger-03_itms_14.09305.09305.2 3.1321 0.1852 99.8 1681.858 1682.873 7565.3 2 5.422 53.8 2 N.IIEHDVPEHFFGEL.A * 122805-Holinger-04_itms_10.07355.07355.2 2.0708 0.0708 92.3 878.5266 879.047 4063.8 19 3.86 78.6 1 K.ALLPHLTN.A * 122805-Holinger-03_itms_6.04993.04993.2 2.2437 0.1263 94.6 1175.6649 1176.358 4251.8 13 4.004 72.2 1 M.WDTKKEVKAA.A * 122805-Holinger-02_itms_13.09394.09394.2 2.2198 0.1526 92.8 1227.6809 1228.4308 5782.5 93 3.891 60.0 1 K.LVEDPQVIAPF.L * 122805-Holinger-02_itms_11.08402.08402.2 3.0933 0.0993 93.0 1598.8677 1599.7814 5525.9 2 3.908 73.1 1 A.IGADLIDERIIDQQ.A * 122805-Holinger-03_itms_11.07942.07942.2 2.4902 0.0546 94.6 1076.6532 1077.3091 6968.9 20 4.0 75.0 1 E.AIKDKLIEF.G 122805-Holinger-02_itms_9.06967.06967.2 2.968 0.2293 99.3 1366.7081 1367.4985 7503.1 14 4.75 63.6 1 L.LLDEPTNHLDTV.N * 122805-Holinger-02_itms_15.10394.10394.2 4.0556 0.3365 100.0 2413.1882 2414.6277 7141.4 1 5.733 50.0 2 Y.EELSNTDLEFKFPEPGYLEGV.K * 122805-Holinger-02_itms_14.10094.10094.2 2.5237 0.2409 99.2 1583.7915 1584.7656 6160.7 5 4.669 58.3 1 T.DLEFKFPEPGYLE.G * 122805-Holinger-03_itms_15.10231.10231.2 3.8848 0.0225 98.3 1739.8864 1740.9501 5689.4 3 4.407 57.1 1 T.DLEFKFPEPGYLEGV.K * 122805-Holinger-03_itms_15.09972.09972.2 2.8188 0.1175 98.9 1627.1465 1625.8615 6976.1 2 4.6 57.7 1 D.LEFKFPEPGYLEGV.K * 122805-Holinger-03_itms_12.08379.08379.2 2.0898 0.1572 93.0 1236.6527 1236.41 6950.7 116 3.911 55.0 1 F.KFPEPGYLEGV.K 122805-Holinger-03_itms_8.06214.06214.2 2.649 0.0747 90.3 1419.7823 1418.5461 6265.2 4 3.746 63.6 1 E.SHLDKTPSEYIQ.W 122805-Holinger-03_itms_12.08260.08260.2 3.8315 0.3629 100.0 1603.8008 1604.7594 6757.4 1 6.8 75.0 2 E.SHLDKTPSEYIQW.R YGL078C 6 9 11.9% 523 58827 9.1 U DBP3 SGDID:S000003046, Chr VII from 361862-360291, reverse complement, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box family involved in ribosomal biogenesis" * 122805-Holinger-03_itms_6.04998.04998.3 5.8448 0.3872 100.0 2297.23 2298.5522 6372.6 1 6.987 47.4 1 K.KGEKEVEVPEKESEKKPEPT.S * 122805-Holinger-03_itms_6.04753.04753.2 2.5196 0.2867 99.0 1226.6699 1227.3628 4055.8 2 4.642 70.0 1 Y.GGVPKDEQRIQ.L * 122805-Holinger-02_itms_14.09582.09582.2 3.1398 0.299 100.0 1333.7341 1334.515 6942.9 1 6.068 80.0 2 K.GFEEDIKNIIR.E * 122805-Holinger-05_itms_24.16122.16122.2 2.744 0.2806 99.8 1563.8309 1564.7356 7816.9 1 5.299 58.3 3 K.GFEEDIKNIIRET.D * 122805-Holinger-02_itms_14.09879.09879.2 3.5412 0.1141 95.5 1968.0779 1968.2603 7694.3 2 4.096 55.9 1 L.VNVLNGANQPVPEDLIKF.G * 122805-Holinger-02_itms_14.09603.09603.2 3.1404 0.2068 98.6 1757.9181 1755.0238 4862.5 1 4.467 66.7 1 N.VLNGANQPVPEDLIKF.G YOL061W 4 6 11.9% 496 53505 7.3 U PRS5 SGDID:S000005422, Chr XV from 212243-213733, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, involved in nucleotide, histidine, and tryptophan biosynthesis; one of a five related enzymes, which are active as heteromultimeric complexes" * 122805-Holinger-05_itms_8.06890.06890.2 2.9894 0.1582 98.4 1564.8667 1565.8094 8331.9 9 4.417 53.8 1 K.GAPIISKPKENYTF.E * 122805-Holinger-04_itms_9.06861.06861.2 2.2992 0.2697 99.3 1679.8992 1680.8583 5061.7 235 4.809 42.9 1 T.INLENPQPIRTPNSS.A * 122805-Holinger-03_itms_17.11151.11151.2 3.8563 0.402 100.0 2086.0315 2087.296 4727.2 1 7.596 52.9 3 M.DLHDPQFPGFFDIPVDNL.Y * 122805-Holinger-05_itms_8.06873.06873.2 3.5099 0.3004 99.9 1166.678 1167.3506 3495.3 2 5.482 68.2 1 T.SGGSLPVSPRPL.V YLL045C 3 3 11.7% 256 28112 10.0 U RPL8B SGDID:S000003968, Chr XII from 48628-47858, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Ap and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits" * 122805-Holinger-05_itms_9.07735.07735.3 3.1793 0.1519 99.2 1317.755 1318.5614 7424.5 2 4.359 66.7 1 Y.VKWPEYVRLQ.R 122805-Holinger-05_itms_7.06554.06554.2 1.9881 0.128 96.9 838.5556 839.066 5009.0 142 4.211 64.3 1 R.LKVPPTIA.Q 122805-Holinger-05_itms_8.06983.06983.2 2.7478 0.1345 90.4 1338.7402 1339.537 4921.2 2 3.762 77.3 1 Y.DEVKKHWGGGIL.G YBL087C 2 2 11.7% 137 14473 10.3 U RPL23A SGDID:S000000183, Chr II from 60735-60694,60189-59818, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl23Bp and has similarity to E. coli L14 and rat L23 ribosomal proteins" YER117W 2 2 11.7% 137 14473 10.3 U RPL23B SGDID:S000000919, Chr V from 396765-396806,397278-397649, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl23Ap and has similarity to E. coli L14 and rat L23 ribosomal proteins" 122805-Holinger-03_itms_7.05315.05315.1 2.4325 0.2633 100.0 1031.5398 1032.148 5694.6 1 6.511 66.7 1 S.AITGPVGKEC.A 122805-Holinger-04_itms_10.07704.07704.2 4.1848 0.2862 100.0 1769.9323 1770.9922 8058.7 1 5.962 63.3 1 S.AITGPVGKECADLWPR.V YFL037W 7 7 11.4% 457 50923 4.7 U TUB2 SGDID:S000001857, Chr VI from 56335-57708, Verified ORF, "Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules" * 122805-Holinger-04_itms_5.04441.04441.2 2.5084 0.3023 99.8 1397.683 1398.4777 4416.8 1 5.387 75.0 1 T.YHGHDDIQKER.L * 122805-Holinger-04_itms_6.05385.05385.2 2.7698 0.1051 99.3 1510.7666 1511.6371 4801.1 1 4.753 77.3 1 T.YHGHDDIQKERL.N * 122805-Holinger-04_itms_9.06740.06740.2 3.1722 0.1058 98.1 1886.9478 1888.0494 6017.1 1 4.386 64.3 1 T.YHGHDDIQKERLNVY.F * 122805-Holinger-04_itms_9.07238.07238.2 2.9518 0.3077 100.0 1062.6017 1063.2389 4134.2 1 5.534 83.3 1 T.FSVLPSPKTS.D * 122805-Holinger-03_itms_12.08542.08542.2 3.0889 0.1589 99.0 1865.985 1867.1058 4159.0 25 4.631 46.9 1 T.FSVLPSPKTSDTVVEPY.N * 122805-Holinger-03_itms_8.06206.06206.2 3.0998 0.2493 100.0 1248.6434 1249.366 6181.3 1 5.68 85.0 1 L.KLNQPSYGDLN.N * 122805-Holinger-05_itms_10.07814.07814.2 2.3582 0.1717 95.6 1012.61224 1013.22784 4534.0 35 4.103 68.8 1 L.AVNLVPFPR.L YCR012W 5 5 11.3% 416 44738 7.6 U PGK1 SGDID:S000000605, Chr III from 137743-138993, Verified ORF, "3-phosphoglycerate kinase, catalyzes transfer of high-energy phosphoryl groups from the acyl phosphate of 1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme in glycolysis and gluconeogenesis" * 122805-Holinger-04_itms_11.07838.07838.2 2.3363 0.0863 95.3 1908.0513 1908.1589 8287.9 7 4.068 50.0 1 F.KKVLENTEIGDSIFDKA.G * 122805-Holinger-02_itms_18.11916.11916.2 2.6585 0.2274 99.3 1214.7266 1215.4753 4688.3 32 4.693 65.0 1 V.EVVLPVDFIIA.D * 122805-Holinger-03_itms_9.06534.06534.2 2.0406 0.2316 99.3 1162.6063 1163.2755 4534.4 43 4.711 66.7 1 L.DNGPESRKLF.A * 122805-Holinger-02_itms_10.07341.07341.1 1.8057 0.0747 97.8 973.57477 974.1424 6920.0 236 5.127 56.2 1 K.ALLDEVVKS.S * 122805-Holinger-02_itms_10.07357.07357.2 2.5633 0.1675 98.5 975.62396 974.1424 5298.5 5 4.437 81.2 1 K.ALLDEVVKS.S YBR154C 2 2 11.2% 215 25079 9.1 U RPB5 SGDID:S000000358, Chr II from 549003-548356, reverse complement, Verified ORF, "RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III; contacts DNA and affects transactivation" * 122805-Holinger-02_itms_15.10289.10289.2 2.3776 0.0826 99.5 1219.5946 1220.3184 5426.7 12 5.032 61.1 1 Q.EEVELPLEDF.K * 122805-Holinger-05_itms_11.08521.08521.2 3.0366 0.1977 99.5 1512.8953 1513.8174 5964.4 1 5.007 69.2 1 M.KLVPSIPPATIETF.N YML031W 11 12 11.0% 655 74134 8.3 U NDC1 SGDID:S000004493, Chr XIII from 214189-216156, Verified ORF, "Nuclear envelope protein with multiple putative transmembrane domains, required for nuclear pore complex assembly and spindle pole body duplication; required for meiosis II" * 122805-Holinger-03_itms_6.04983.04983.2 2.3894 0.1529 93.4 1035.5479 1036.1326 4357.6 18 3.934 75.0 1 Q.HHVTDADKL.S * 122805-Holinger-05_itms_10.07760.07760.2 2.0832 0.1283 98.0 1184.6267 1185.325 5168.0 180 4.368 55.6 1 S.RQKSGLFDSF.T * 122805-Holinger-02_itms_12.08482.08482.2 1.6845 0.1382 93.1 900.46063 901.0068 4421.5 2 3.915 85.7 1 Q.KSGLFDSF.T * 122805-Holinger-04_itms_9.07036.07036.2 1.7543 0.1305 98.8 1034.7935 1035.1852 6368.9 210 4.595 61.1 1 L.LSGLSADKPF.T * 122805-Holinger-04_itms_8.06297.06297.2 2.0145 0.2018 94.2 1034.5808 1035.1881 3193.9 1 3.958 81.2 2 L.SADKPFTRL.T * 122805-Holinger-04_itms_7.06068.06068.2 2.1971 0.149 99.8 1135.6302 1136.2932 3071.2 10 5.21 72.2 1 L.SADKPFTRLT.A * 122805-Holinger-04_itms_9.07158.07158.2 3.0581 0.2888 99.7 1556.8368 1557.7465 6530.3 1 5.189 69.2 1 A.TSLDPSLRAPIYHS.K * 122805-Holinger-04_itms_9.07065.07065.2 2.4829 0.1417 97.2 1368.7534 1369.5632 4466.8 1 4.269 68.2 1 T.SLDPSLRAPIYH.S * 122805-Holinger-04_itms_9.07069.07069.2 2.7819 0.176 99.4 1455.7848 1456.6415 5999.5 6 4.862 62.5 1 T.SLDPSLRAPIYHS.K * 122805-Holinger-04_itms_8.06413.06413.2 3.5713 0.2339 99.3 1654.8907 1655.8112 2694.4 1 4.798 73.1 1 L.RDNGLLDESPNRLR.V * 122805-Holinger-02_itms_13.09349.09349.1 2.8027 0.3401 100.0 1283.5111 1284.3394 5767.4 1 6.421 65.0 1 L.GEFADWDPESM.A YML063W 3 5 11.0% 255 28812 10.0 U RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein" 122805-Holinger-04_itms_8.06653.06653.2 3.0471 0.0422 90.2 1140.7177 1141.3965 4181.5 6 3.739 83.3 1 T.SKLIPEVINK.E 122805-Holinger-03_itms_17.11289.11289.2 3.0069 0.2225 98.7 1696.9829 1697.9695 6027.8 1 4.566 64.3 3 T.SKLIPEVINKEIENA.T * 122805-Holinger-03_itms_6.04726.04726.2 2.9208 0.3372 100.0 1309.6995 1310.4496 4844.7 3 5.543 58.3 1 E.GSGEEKGKKVSGF.K YLR293C 3 5 11.0% 219 24810 6.5 U GSP1 SGDID:S000004284, Chr XII from 721432-720773, reverse complement, Verified ORF, "GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Prp20p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; yeast Gsp2p homolog" YOR185C 3 5 10.9% 220 24991 6.7 U GSP2 SGDID:S000005711, Chr XV from 682106-681444, reverse complement, Verified ORF, "GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); Gsp1p homolog that is not required for viability" 122805-Holinger-03_itms_15.09856.09856.2 3.5022 0.2206 99.4 1447.8077 1445.6171 6475.3 1 4.847 80.0 1 K.SNYNFEKPFLW.L 122805-Holinger-04_itms_14.09834.09834.2 3.2526 0.155 99.5 1243.6401 1244.435 5753.9 1 5.07 87.5 2 N.YNFEKPFLW.L 122805-Holinger-02_itms_12.08674.08674.2 3.0374 0.2173 99.5 1387.8063 1385.4674 4665.1 1 5.081 79.2 2 A.TALPLPDEDDADL.- YIL043C 3 4 10.9% 322 36199 9.3 U CBR1 SGDID:S000001305, Chr IX from 275039-274071, reverse complement, Verified ORF, "Microsomal cytochrome b reductase, not essential for viability; also detected in mitochondria" * 122805-Holinger-03_itms_14.09211.09211.2 3.5969 0.2546 100.0 1501.8285 1502.7104 3502.7 1 5.8 75.0 2 F.GLPHADDVLGLPIGQ.H * 122805-Holinger-03_itms_8.06027.06027.2 2.3266 0.0782 96.8 1225.7501 1224.4429 4713.3 47 4.203 66.7 1 N.VHEEDILLKK.E * 122805-Holinger-04_itms_7.05795.05795.2 2.1099 0.1126 92.0 1150.5792 1150.3634 4889.4 159 3.847 61.1 1 T.KDVIKEHLPA.A YCR031C 2 2 10.9% 137 14537 10.7 U RPS14A SGDID:S000000627, Chr III from 178215-178209,177901-177495, reverse complement, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Bp and similar to E. coli S11 and rat S14 ribosomal proteins" YJL191W 2 2 10.9% 138 14650 10.5 U RPS14B SGDID:S000003727, Chr X from 73786-73795,74204-74610, Verified ORF, "Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing; mutations confer cryptopleurine resistance; nearly identical to Rps14Ap and similar to E. coli S11 and rat S14 ribosomal proteins" 122805-Holinger-02_itms_7.05603.05603.2 2.7141 0.2718 100.0 1573.7856 1572.7153 5823.5 4 5.69 57.7 1 G.RIEDVTPVPSDSTR.K 122805-Holinger-03_itms_7.05537.05537.2 2.7269 0.1964 98.8 1699.9276 1700.8894 5930.4 4 4.596 60.7 1 G.RIEDVTPVPSDSTRK.K YGR027W-B 18 20 10.8% 1755 198656 8.2 U YGR027W-B SGDID:S000007406, Chr VII from 536061-537365,537367-541329, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-02_itms_13.09399.09399.2 2.5867 0.0504 96.8 1373.7311 1376.4631 5304.8 85 4.198 45.8 1 H.TNQDPLDVSASKT.E 122805-Holinger-04_itms_5.04523.04523.2 2.6805 0.2122 99.3 1457.7046 1458.5303 5092.3 36 4.721 57.7 1 A.SSAVPENPHHASPQ.T 122805-Holinger-05_itms_4.04282.04282.2 1.8017 0.1702 96.1 1283.6372 1284.3738 3211.1 2 4.141 72.7 1 S.AVPENPHHASPQ.T 122805-Holinger-04_itms_5.04912.04912.2 2.3809 0.2207 98.8 1212.5688 1212.2639 3160.2 78 4.598 75.0 1 Q.SHSPQNGPYPQ.Q 122805-Holinger-04_itms_10.07722.07722.2 2.8047 0.1751 98.1 1831.988 1833.0514 8324.0 142 4.39 40.0 2 T.VNGKPVRQITDDELTF.L 122805-Holinger-05_itms_11.08816.08816.2 2.7555 0.1065 96.4 2108.1423 2109.3867 5747.9 9 4.172 41.2 1 T.VNGKPVRQITDDELTFLY.N 122805-Holinger-04_itms_10.07598.07598.2 2.8205 0.2843 99.3 1618.8735 1619.815 5706.4 2 4.789 57.7 1 N.GKPVRQITDDELTF.L 122805-Holinger-05_itms_11.08539.08539.2 2.4678 0.1542 94.4 1731.9624 1732.9744 6015.1 1 3.98 50.0 1 N.GKPVRQITDDELTFL.Y 122805-Holinger-04_itms_10.07500.07500.2 2.374 0.093 97.0 1071.6704 1072.2932 5783.1 1 4.246 81.2 1 T.KVTNIIDRL.N 122805-Holinger-02_itms_12.08567.08567.2 1.8681 0.1985 92.8 886.4817 887.02325 3876.2 1 3.888 83.3 1 A.ELFLDIH.A 122805-Holinger-04_itms_5.04740.04740.2 2.2204 0.13 92.4 1072.6582 1073.278 3646.6 142 3.862 61.1 1 Y.TNTTKPKVIA.R 122805-Holinger-02_itms_5.04327.04327.2 3.4181 0.2757 100.0 1465.6678 1466.4583 6232.3 1 5.571 65.4 1 S.NNSPSTDNDSISKS.T 122805-Holinger-04_itms_9.07233.07233.2 3.0446 0.2882 100.0 1584.7695 1585.6732 7625.1 3 6.077 57.7 2 N.HTNHSDDELPGHLL.L 122805-Holinger-04_itms_14.09598.09598.2 2.7675 0.2627 99.8 1416.8059 1417.688 10218.8 1 5.21 63.6 1 N.SYGYIIYLPSLK.K 122805-Holinger-04_itms_8.06586.06586.2 3.7131 0.2921 100.0 1837.9965 1839.0557 5923.1 1 6.505 62.5 1 N.SSHNIVPIKTPTTVSEQ.N 122805-Holinger-05_itms_14.10111.10111.3 3.1329 0.1026 96.3 3158.6765 3159.5627 5166.6 5 4.133 25.0 1 A.DLPLPDLPPESPTEFPDPFKELPPINSR.Q 122805-Holinger-05_itms_5.05029.05029.2 3.9988 0.1193 99.8 1676.9154 1677.8522 5999.9 2 5.378 61.5 1 N.SKKRSLEDNETEIK.V 122805-Holinger-04_itms_8.06426.06426.2 2.1728 0.0457 93.5 894.55786 895.0898 3703.7 26 3.936 78.6 1 K.LNVPLNPK.G YER056C-A 1 1 10.7% 121 13639 10.8 U RPL34A SGDID:S000002135, Chr V from 270183-270147,269749-269421, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl34Bp and has similarity to rat L34 ribosomal protein" YIL052C 1 1 10.7% 121 13641 10.8 U RPL34B SGDID:S000001314, Chr IX from 257061-257025,256552-256224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl34Ap and has similarity to rat L34 ribosomal protein" 122805-Holinger-04_itms_5.04808.04808.2 3.1106 0.3532 100.0 1392.6637 1393.4718 5862.9 1 6.552 66.7 1 L.ATRPKCGDCGSAL.Q YBR054W 6 8 10.5% 344 38720 9.2 U YRO2 SGDID:S000000258, Chr II from 343099-344133, Verified ORF, "Putative plasma membrane protein of unknown function, transcriptionally regulated by Haa1p; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and bud" 122805-Holinger-02_itms_10.07755.07755.2 4.0035 0.3121 100.0 1600.8236 1601.7563 5817.7 6 5.587 60.0 1 R.GGNEAIKINPPTGADF.H 122805-Holinger-03_itms_12.08109.08109.2 4.6186 0.3042 100.0 1952.0199 1953.1619 6619.7 1 6.122 58.3 3 R.GGNEAIKINPPTGADFHIT.S 122805-Holinger-04_itms_10.07806.07806.2 2.4457 0.0699 91.7 1243.6897 1244.4331 5670.9 31 3.821 63.6 1 E.AIKINPPTGADF.H 122805-Holinger-04_itms_8.06191.06191.1 2.2119 0.0963 96.3 910.5523 911.0892 2957.9 1 4.992 62.5 1 A.IKINPPTGA.D 122805-Holinger-05_itms_3.03805.03805.2 1.8976 0.2866 99.5 1115.5826 1116.2217 6379.7 12 5.019 62.5 1 S.TQKEHPGYR.Q * 122805-Holinger-02_itms_16.10814.10814.2 1.9711 0.1846 97.0 971.55255 972.17474 3295.2 30 4.243 78.6 1 L.AFPWPIIQ.M Reverse_YDR115W 1 1 10.5% 105 12030 12.5 U YDR115W SGDID:S000002522, Chr IV from 682170-682487, Verified ORF, "Putative mitochondrial ribosomal protein of the large subunit, has similarity to E. coli L34 ribosomal protein; required for respiratory growth, as are most mitochondrial ribosomal proteins" * 122805-Holinger-04_itms_16.10921.10921.2 1.8013 0.0107 92.7 1214.6494 1216.4696 6129.6 45 3.877 55.0 1 K.LIKSGQKSKAR.A YAL012W 4 5 10.4% 394 42542 6.5 U CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine;" * 122805-Holinger-03_itms_12.08245.08245.2 3.5855 0.3677 100.0 1598.9055 1599.8676 7882.9 1 7.563 73.1 1 L.VWIETPTNPTLKVT.D * 122805-Holinger-03_itms_14.09395.09395.2 3.3548 0.3006 100.0 1209.2825 1208.3568 6930.8 2 6.074 70.0 2 A.SGVFDDLVRIS.V * 122805-Holinger-02_itms_13.09376.09376.2 4.0716 0.3071 100.0 1575.8794 1575.71 6648.1 1 6.776 80.8 1 S.VGIEDTDDLLEDIK.Q * 122805-Holinger-03_itms_14.09576.09576.2 3.6375 0.2544 100.0 1773.9115 1774.9196 8345.3 1 5.856 66.7 1 S.VGIEDTDDLLEDIKQA.L YJR104C 1 1 10.4% 154 15855 6.0 U SOD1 SGDID:S000003865, Chr X from 622927-622463, reverse complement, Verified ORF, "Cu, Zn superoxide dismutase; some mutations are analogous to those that cause ALS (amyotrophic lateral sclerosis) in humans" * 122805-Holinger-05_itms_19.13459.13459.2 2.1823 0.1434 97.9 1607.3295 1605.8314 5188.8 22 4.357 40.0 1 V.LKGDAGVSGVVKFEQA.S YGL031C 2 2 10.3% 155 17614 11.3 U RPL24A SGDID:S000002999, Chr VII from 437939-437472, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Bp and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" YGR148C 2 2 10.3% 155 17547 11.4 U RPL24B SGDID:S000003380, Chr VII from 787784-787317, reverse complement, Verified ORF, "Ribosomal protein L30 of the large (60S) ribosomal subunit, nearly identical to Rpl24Ap and has similarity to rat L24 ribosomal protein; not essential for translation but may be required for normal translation rate" 122805-Holinger-03_itms_5.04588.04588.2 2.3958 0.0395 97.9 813.47186 813.9321 4647.0 34 4.349 71.4 1 K.AQRPITGA.S 122805-Holinger-03_itms_9.06465.06465.2 2.3465 0.2357 99.3 973.58606 974.1454 6971.4 32 4.835 78.6 1 A.SLDLIKER.R YJR123W 2 2 10.2% 225 25039 8.6 U RPS5 SGDID:S000003884, Chr X from 651816-652493, Verified ORF, "Protein component of the small (40S) ribosomal subunit, the least basic of the non-acidic ribosomal proteins; phosphorylated in vivo; essential for viability; has similarity to E. coli S7 and rat S5 ribosomal proteins" * 122805-Holinger-02_itms_7.05943.05943.2 1.7206 0.1338 95.9 966.4937 967.0636 3303.5 237 4.123 71.4 1 W.SFEEVEVK.D * 122805-Holinger-03_itms_5.04637.04637.2 2.6091 0.1944 92.1 1430.7233 1431.5051 4984.1 181 3.849 42.9 1 N.TGPREDTTRVGGGGA.A Reverse_YDR367W 1 1 10.0% 221 25484 8.1 U YDR367W SGDID:S000002775, Chr IV from 1212838-1212867,1212969-1213604, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-03_itms_5.04097.04097.3 1.2831 0.0094 92.7 2349.4397 2346.7412 3628.8 110 3.977 14.3 1 D.LPHGTFLALIGYAGSCKNLISI.G YFL010C 2 2 10.0% 211 22655 4.5 U WWM1 SGDID:S000001884, Chr VI from 115737-115102, reverse complement, Verified ORF, "WW domain containing protein of unknown function; binds to Mca1p, a caspase-related protease that regulates H2O2-induced apoptosis; overexpression causes Gi phase growth arrest and clonal death that is suppressed by overexpression of MCA1" * 122805-Holinger-05_itms_8.06676.06676.2 3.1997 0.2411 99.3 2408.189 2409.6226 6439.4 2 4.719 47.2 1 Q.AQQPRYYQPQQPQYPQYPQ.Q * 122805-Holinger-05_itms_7.06516.06516.2 4.0628 0.2748 99.8 2664.3064 2665.884 6515.8 1 5.43 52.5 1 Q.AQQPRYYQPQQPQYPQYPQQQ.R YGL194C-A 1 1 10.0% 80 9624 8.5 U YGL194C-A SGDID:S000087160, Chr VII from 139967-139725, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, identified based on comparisons of the genome sequences of six Saccharomyces species" * 122805-Holinger-03_itms_13.08701.08701.2 2.7425 0.2576 99.8 999.58 1000.1857 3176.4 6 5.23 85.7 1 Q.VSPLLERW.V YOL040C 1 1 9.9% 142 16002 10.7 U RPS15 SGDID:S000005400, Chr XV from 253575-253147, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; has similarity to E. coli S19 and rat S15 ribosomal proteins" * 122805-Holinger-05_itms_4.04428.04428.2 2.642 0.3037 99.5 1516.8171 1517.6847 4841.0 1 4.989 57.7 1 L.AAPENEKPAPVRTH.M YNL064C 3 3 9.8% 409 44671 6.3 U YDJ1 SGDID:S000005008, Chr XIV from 507098-505869, reverse complement, Verified ORF, "Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family" * 122805-Holinger-02_itms_16.11006.11006.2 2.3523 0.1455 98.2 1655.8997 1655.8883 3732.9 14 4.399 46.7 1 E.ADQAPDVIPGDVVFIV.S * 122805-Holinger-04_itms_11.08117.08117.2 2.7059 0.2773 99.8 1394.8053 1395.7032 4700.0 4 5.212 53.8 1 K.VGIVPGEVIAPGMR.K * 122805-Holinger-05_itms_8.06935.06935.3 2.1406 0.0963 92.7 1233.6493 1234.3971 2694.4 21 3.973 41.7 1 F.TIKFPENHFT.S YOR078W 2 3 9.8% 214 24385 6.6 U BUD21 SGDID:S000005604, Chr XV from 472726-473370, Verified ORF, "Component of small ribosomal subunit (SSU) processosome that contains U3 snoRNA; originally isolated as bud-site selection mutant that displays a random budding pattern" * 122805-Holinger-03_itms_17.10980.10980.2 4.3412 0.3578 100.0 2359.872 2358.6018 9711.5 2 6.947 42.5 2 K.SVNETEVTDEVIAELPEELLK.N * 122805-Holinger-03_itms_16.10419.10419.2 3.7738 0.2059 99.4 1826.9995 1828.0668 7987.1 3 4.956 60.0 1 T.EVTDEVIAELPEELLK.N YDR342C 8 8 9.5% 570 62735 7.8 U HXT7 SGDID:S000002750, Chr IV from 1155920-1154208, reverse complement, Verified ORF, "High-affinity glucose transporter of the major facilitator superfamily, nearly identical to Hxt6p, expressed at high basal levels relative to other HXTs, expression repressed by high glucose levels" 122805-Holinger-03_itms_8.06291.06291.2 3.6033 0.3389 100.0 1872.9769 1874.0605 5284.5 1 5.719 59.4 1 Y.GEGEEHEPVVEIPKRPA.S 122805-Holinger-03_itms_9.06828.06828.2 3.8402 0.1884 99.3 2194.1165 2195.3936 5733.0 1 4.806 47.4 1 Y.GEGEEHEPVVEIPKRPASAY.V 122805-Holinger-03_itms_9.06808.06808.3 3.7456 0.1537 99.4 2195.083 2195.3936 8139.0 4 4.771 34.2 1 Y.GEGEEHEPVVEIPKRPASAY.V 122805-Holinger-04_itms_13.09338.09338.2 2.6763 0.1569 99.4 1355.7681 1356.5675 6465.3 1 4.875 68.2 1 Y.SNSVQWRVPLGL.C 122805-Holinger-05_itms_12.09119.09119.2 3.1622 0.2844 100.0 1154.6904 1155.3854 6013.4 2 5.825 77.8 1 N.SVQWRVPLGL.C 122805-Holinger-05_itms_11.08769.08769.2 2.9289 0.3008 100.0 1314.7244 1315.5242 6931.6 4 5.523 65.0 1 N.SVQWRVPLGLC.F 122805-Holinger-03_itms_11.07752.07752.2 2.065 0.1281 97.2 1279.6941 1280.4662 3535.1 138 4.263 55.0 1 M.TFVPESPRYLA.E * 122805-Holinger-04_itms_5.04556.04556.2 2.9997 0.1806 99.8 1272.6947 1273.4343 6553.0 1 5.286 83.3 1 M.THDDKPLYKR.M Reverse_YPR062W 1 1 9.5% 158 17507 5.9 U FCY1 SGDID:S000006266, Chr XVI from 677162-677638, Verified ORF, "Cytosine deaminase, zinc metalloenzyme that catalyzes the hydrolytic deamination of cytosine to uracil; of biomedical interest because it also catalyzes the deamination of 5-fluorocytosine (5FC) to form anticancer drug 5-fluorouracil (5FU)" * 122805-Holinger-04_itms_21.13616.13616.2 2.1145 0.069 95.9 1653.0262 1655.832 6007.9 118 4.128 35.7 1 F.RMNHGRGLVSGDKNN.I Reverse_YNR040W 1 1 9.4% 256 28636 10.1 U YNR040W SGDID:S000005323, Chr XIV from 699692-700462, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_17.11335.11335.2 1.5785 0.3009 93.8 2799.2122 2798.9988 6604.3 36 5.871 19.6 1 D.EMGQS*GVGTFIKTAKNKS*LENIER.T YJL148W 2 2 9.4% 233 26875 8.7 U RPA34 SGDID:S000003684, Chr X from 140355-141056, Verified ORF, "RNA polymerase I subunit A34.5" * 122805-Holinger-03_itms_12.08563.08563.2 3.5146 0.2553 100.0 1680.89 1681.8859 9576.4 2 5.784 53.6 1 A.STAKDNAPLQFDKVF.S * 122805-Holinger-02_itms_5.04414.04414.2 2.3735 0.0569 97.4 814.48395 814.9573 3454.1 43 4.294 83.3 1 R.KDVPKVE.G Reverse_YLR243W 2 2 9.2% 272 30653 4.5 U YLR243W SGDID:S000004233, Chr XII from 624205-625023, Uncharacterized ORF, "Protein required for cell viability" * 122805-Holinger-04_itms_13.09398.09398.2 3.7513 0.2255 98.7 2013.0707 2014.2947 7534.5 30 4.53 43.8 1 I.VFPAELLYTACLNFNLQ.Q * 122805-Holinger-04_itms_6.05213.05213.2 1.1744 0.1939 99.4 830.4678 831.0642 2595.6 261 5.004 57.1 1 P.GLVMVGVR.S YLR390W-A 2 2 9.2% 238 23268 5.9 U CCW14 SGDID:S000006429, Chr XII from 903724-904440, Verified ORF, "Covalently linked cell wall glycoprotein, present in the inner layer of the cell wall" * 122805-Holinger-01_itms_12.09346.09346.2 2.2051 0.0369 93.0 1069.591 1067.0978 13191.5 19 3.911 59.1 1 A.SSSSAAPSSSKA.S * 122805-Holinger-02_itms_22.14137.14137.2 1.3039 0.0638 92.6 924.6619 924.9402 2753.1 18 3.875 44.4 1 S.SSAASSTVSQ.E YDL136W 1 1 9.2% 120 13910 10.6 U RPL35B SGDID:S000002295, Chr IV from 217600-217602,218008-218367, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl35Ap and has similarity to rat L35 ribosomal protein" YDL191W 1 1 9.2% 120 13910 10.6 U RPL35A SGDID:S000002350, Chr IV from 117665-117667,118159-118518, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl35Bp and has similarity to rat L35 ribosomal protein" 122805-Holinger-03_itms_12.08137.08137.3 2.4652 0.0919 94.7 1284.2588 1286.5547 6198.4 12 4.075 47.5 1 L.VDLKKELAELK.V YNL301C 3 4 9.1% 186 20563 11.7 U RPL18B SGDID:S000005245, Chr XIV from 64562-64451,64018-63570, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Ap and has similarity to rat L18 ribosomal protein" YOL120C 3 4 9.1% 186 20563 11.7 U RPL18A SGDID:S000005480, Chr XV from 94401-94290,93842-93394, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl18Bp and has similarity to rat L18 ribosomal protein; intron of RPL18A pre-mRNA forms stem-loop structures that are a target for Rnt1p cleavage leading to degradation" 122805-Holinger-05_itms_6.06001.06001.2 2.0919 0.0463 90.6 881.5363 882.05066 4632.9 68 3.774 71.4 1 K.INRPPVSV.S 122805-Holinger-05_itms_6.05564.05564.2 2.4365 0.0875 93.9 968.5713 969.12885 4306.5 47 3.951 62.5 2 K.INRPPVSVS.R 122805-Holinger-02_itms_8.06587.06587.2 2.2901 0.2906 100.0 936.4975 937.04034 3909.3 1 5.617 85.7 1 T.VTDDARIF.E YOR063W 4 4 9.0% 387 43758 10.3 U RPL3 SGDID:S000005589, Chr XV from 444687-445850, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to E. coli L3 and rat L3 ribosomal proteins; involved in the replication and maintenance of killer double stranded RNA virus" * 122805-Holinger-05_itms_6.05919.05919.2 2.5591 0.1959 98.6 1443.8239 1444.6738 4493.9 2 4.45 62.5 1 K.AFPKDDRSKPVAL.T * 122805-Holinger-05_itms_6.05852.05852.2 2.1411 0.1884 99.3 1544.8728 1545.7788 6013.3 2 4.802 53.8 1 K.AFPKDDRSKPVALT.S * 122805-Holinger-03_itms_5.04572.04572.2 2.1344 0.1876 99.3 983.54254 984.10016 3649.9 1 4.888 78.6 1 E.HLSDEVKR.R * 122805-Holinger-04_itms_8.06431.06431.2 3.2556 0.2115 98.6 1674.8542 1675.8412 6590.8 45 4.471 58.3 1 S.EKVDWAREHFEKT.V YMR142C 4 7 9.0% 199 22525 11.1 U RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein" * 122805-Holinger-04_itms_9.06950.06950.2 3.3658 0.3281 100.0 1541.863 1542.7753 8518.2 1 5.74 65.4 3 K.IIVFPRDGKAPEAE.Q * 122805-Holinger-04_itms_10.07341.07341.2 4.2298 0.3597 100.0 1769.0004 1770.0385 9446.9 1 7.297 56.7 1 K.IIVFPRDGKAPEAEQV.L * 122805-Holinger-04_itms_11.08121.08121.2 3.3654 0.2281 99.3 1882.079 1883.198 9489.4 11 4.761 43.8 1 K.IIVFPRDGKAPEAEQVL.S * 122805-Holinger-04_itms_11.07860.07860.2 3.9328 0.187 97.3 1969.1132 1970.2761 10644.5 5 4.285 47.1 2 K.IIVFPRDGKAPEAEQVLS.A YLL003W 9 13 8.9% 946 112978 9.8 U SFI1 SGDID:S000003926, Chr XII from 143200-146040, Verified ORF, "Centrin (Cdc31p)-binding protein required for spindle pole body (SPB) duplication, localizes to the half-bridge of the SPB, required for progression through G(2)-M transition, has similarity to Xenopus laevis XCAP-C" * 122805-Holinger-04_itms_14.09773.09773.2 2.7994 0.1035 99.5 1985.9679 1987.1754 6171.2 1 5.081 44.1 1 E.GFFEDPPFHLPSPPVDST.N * 122805-Holinger-03_itms_13.08978.08978.2 2.49 0.1566 99.5 1781.8706 1782.947 6851.5 1 5.07 53.3 1 F.FEDPPFHLPSPPVDST.N * 122805-Holinger-03_itms_15.09781.09781.2 3.3129 0.2689 99.4 1495.8086 1496.7031 4654.0 1 4.922 72.7 2 E.VIEDLYRQIEAF.L * 122805-Holinger-06_itms_14.11452.11452.2 3.1485 0.1948 99.3 1305.7188 1306.4985 5628.2 2 4.745 75.0 1 F.NSVIEEILEIF.L * 122805-Holinger-04_itms_6.05546.05546.2 1.9953 0.1644 98.6 949.5621 950.1258 5677.9 1 4.488 85.7 1 S.IAEKVRSF.S * 122805-Holinger-04_itms_14.09567.09567.2 3.1722 0.3153 99.9 1577.8013 1578.7161 4893.5 5 5.464 58.3 3 S.EELADEVREEFVL.V * 122805-Holinger-04_itms_13.09328.09328.2 2.5927 0.1408 93.1 1450.9626 1449.6006 5174.9 24 3.918 59.1 2 E.ELADEVREEFVL.V * 122805-Holinger-05_itms_7.06546.06546.2 2.2017 0.1409 94.6 1477.8282 1478.6885 4191.9 73 4.005 50.0 1 L.KIKRNDETVEVF.R * 122805-Holinger-05_itms_5.05007.05007.2 2.2712 0.1 92.5 1195.6635 1196.3488 4340.1 16 3.865 55.6 1 K.HELKTPIRSD.S YNL050C 1 1 8.9% 270 31437 7.5 U YNL050C SGDID:S000004995, Chr XIV from 534983-534967,534875-534080, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.09466.09466.2 1.4044 0.1124 90.4 2880.6536 2879.237 8234.6 56 3.75 23.9 1 S.SIDYDVIIQESTKILEDDLRIRDK.W YBR181C 2 2 8.9% 236 26996 10.4 U RPS6B SGDID:S000000385, Chr II from 592769-592764,592411-591707, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Ap and has similarity to rat S6 ribosomal protein" YPL090C 2 2 8.9% 236 26996 10.4 U RPS6A SGDID:S000006011, Chr XVI from 378392-378387,377992-377288, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein" 122805-Holinger-02_itms_7.05647.05647.2 2.7725 0.2405 99.4 1392.6992 1393.4961 4450.6 261 4.852 50.0 1 F.FDKRIGQEVDGE.A 122805-Holinger-02_itms_6.05295.05295.1 2.0778 0.3068 98.6 1110.5251 1111.1533 4934.7 1 5.276 56.2 1 L.SKEDDVRDF.V Reverse_YPR143W 1 1 8.8% 250 28212 5.7 U RRP15 SGDID:S000006347, Chr XVI from 818319-819071, Verified ORF, "Nucleolar protein, constituent of pre-60S ribosomal particles; required for processing of the 27S pre-rRNA at the A2 site to yield 5.8S and 25S rRNA" * 122805-Holinger-06_itms_11.09623.09623.3 2.5433 0.1772 94.0 2219.5566 2216.3286 5264.0 120 4.034 25.0 1 L.HSSLIANVAASFGTSGDDHKSN.K YDR156W 1 1 8.8% 137 14585 5.2 U RPA14 SGDID:S000002563, Chr IV from 769520-769933, Verified ORF, "RNA polymerase I subunit A14" * 122805-Holinger-05_itms_8.07135.07135.2 2.5896 0.2238 99.5 1390.7374 1391.5693 4633.4 1 5.052 68.2 1 Q.RDFKGLPPAQDF.S YDL069C 1 1 8.7% 229 26586 9.9 U CBS1 SGDID:S000002227, Chr IV from 333810-333121, reverse complement, Verified ORF, "Mitochondrial translational activator of the COB mRNA; membrane protein that interacts with translating ribosomes, acts on the COB mRNA 5'-untranslated leader" * 122805-Holinger-04_itms_15.10210.10210.2 2.8992 0.1291 94.8 2252.2668 2254.7275 4417.0 114 4.023 36.8 1 L.IKNSLKINQLAHLRIPANLP.K YLR355C 4 4 8.6% 395 44368 9.0 U ILV5 SGDID:S000004347, Chr XII from 839252-838065, reverse complement, Verified ORF, "Acetohydroxyacid reductoisomerase, mitochondrial protein involved in branched-chain amino acid biosynthesis, also required for maintenance of wild-type mitochondrial DNA" * 122805-Holinger-04_itms_8.06705.06705.2 2.1999 0.1418 99.4 977.5587 978.1362 4278.6 174 4.838 68.8 1 G.LKQINFGGT.V * 122805-Holinger-02_itms_14.09639.09639.2 3.2617 0.2631 99.5 1445.7687 1446.6458 4715.2 13 5.064 62.5 1 A.AIEDGWVPGKNLF.T * 122805-Holinger-04_itms_12.08597.08597.2 1.988 0.0794 90.4 1122.6406 1123.3373 6098.9 5 3.765 75.0 1 A.LKPVFQDLY.E * 122805-Holinger-03_itms_13.08724.08724.2 2.1425 0.2324 99.3 1439.7684 1440.636 5544.5 352 4.697 45.5 1 A.LKPVFQDLYEST.K YNR022C 1 1 8.6% 139 16283 8.7 U MRPL50 SGDID:S000005305, Chr XIV from 670195-669776, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit, not essential for mitochondrial translation" * 122805-Holinger-04_itms_6.05170.05170.2 2.5912 0.1325 90.4 1483.7107 1485.816 5151.1 1 3.765 68.2 1 H.RVKVQVLKDFPR.F YDR158W 3 3 8.5% 365 39544 6.7 U HOM2 SGDID:S000002565, Chr IV from 770352-771449, Verified ORF, "Aspartic beta semi-aldehyde dehydrogenase, catalyzes the second step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis" * 122805-Holinger-05_itms_10.08094.08094.2 2.6868 0.1957 98.4 1421.8566 1421.6829 5813.8 50 4.424 59.1 1 Y.RREQDVPLIVPV.V * 122805-Holinger-05_itms_9.07746.07746.2 2.06 0.091 94.6 907.613 908.17224 5527.1 20 4.009 75.0 1 A.GLVAPLKPL.I * 122805-Holinger-03_itms_12.08161.08161.2 1.9517 0.1359 96.5 1245.704 1246.449 5938.8 19 4.178 61.1 1 R.IREDPLLDFK.M Reverse_YER063W 1 1 8.3% 218 24138 7.2 U THO1 SGDID:S000000865, Chr V from 281708-282364, Verified ORF, "Protein of unknown function; overproduction suppresses the transcriptional defect caused by an hpr1 mutation" * 122805-Holinger-04_itms_26.16373.16373.2 1.8544 0.1615 91.6 1651.4384 1648.6805 4810.0 357 3.812 32.4 1 L.APAATSAAAQENESATAS.P YHR089C 12 23 8.3% 205 21480 11.5 U GAR1 SGDID:S000001131, Chr VIII from 283300-282683, reverse complement, Verified ORF, "Protein component of the H/ACA snoRNP pseudouridylase complex, involved in the modification and cleavage of the 18S pre-rRNA" * 122805-Holinger-04_itms_13.09160.09160.2 3.4191 0.3536 100.0 1640.8986 1641.9072 6058.9 1 5.705 69.2 1 R.SINTKIPYFNAPIY.L * 122805-Holinger-05_itms_13.09668.09668.2 4.3807 0.4141 100.0 1753.9874 1755.0667 6022.9 1 6.064 64.3 3 R.SINTKIPYFNAPIYL.E * 122805-Holinger-04_itms_14.09664.09664.2 4.5892 0.3671 100.0 1883.0347 1884.1821 6408.3 1 6.586 66.7 4 R.SINTKIPYFNAPIYLE.N * 122805-Holinger-05_itms_12.09113.09113.2 4.8913 0.368 100.0 1997.0748 1998.286 6741.5 1 7.107 62.5 3 R.SINTKIPYFNAPIYLEN.K * 122805-Holinger-05_itms_13.09663.09663.2 3.5646 0.1842 100.0 1666.9532 1667.9884 6033.9 3 5.605 61.5 2 S.INTKIPYFNAPIYL.E * 122805-Holinger-05_itms_12.09326.09326.2 3.368 0.1648 99.4 1795.9994 1797.1039 6575.1 1 4.969 57.1 1 S.INTKIPYFNAPIYLE.N * 122805-Holinger-05_itms_12.09085.09085.2 4.1923 0.3072 100.0 1910.0442 1911.2078 8014.5 1 6.547 60.0 3 S.INTKIPYFNAPIYLEN.K * 122805-Holinger-05_itms_13.09489.09489.2 2.8933 0.1439 99.3 1439.8225 1440.7252 7878.8 5 4.721 68.2 1 N.TKIPYFNAPIYL.E * 122805-Holinger-04_itms_13.09428.09428.2 4.2071 0.3128 100.0 1568.8662 1569.8407 7996.0 1 6.736 83.3 1 N.TKIPYFNAPIYLE.N * 122805-Holinger-05_itms_12.09454.09454.2 2.1234 0.1658 97.2 1338.7714 1339.6201 7242.8 1 4.267 75.0 1 T.KIPYFNAPIYL.E * 122805-Holinger-05_itms_12.09104.09104.2 3.0753 0.2096 98.8 1467.8153 1468.7356 7303.8 7 4.542 63.6 2 T.KIPYFNAPIYLE.N * 122805-Holinger-05_itms_11.08847.08847.2 3.6264 0.155 99.3 1581.8646 1582.8395 7793.7 1 4.833 83.3 1 T.KIPYFNAPIYLEN.K YDL137W 2 3 8.3% 181 20658 7.4 U ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p" YDL192W 2 3 8.3% 181 20529 7.4 U ARF1 SGDID:S000002351, Chr IV from 116322-116867, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf2p" 122805-Holinger-03_itms_15.09872.09872.2 2.1705 0.1688 96.9 1488.8965 1489.7954 4795.7 5 4.207 50.0 1 L.KLGEVITTIPTIGF.N 122805-Holinger-03_itms_14.09411.09411.2 3.1017 0.1372 99.5 1602.9413 1603.8993 6444.4 1 5.115 57.1 2 L.KLGEVITTIPTIGFN.V Reverse_YDR404C 1 1 8.2% 171 19058 7.8 U RPB7 SGDID:S000002812, Chr IV from 1277159-1276644, reverse complement, Verified ORF, "RNA polymerase II subunit B16; forms two subunit dissociable complex with Rpb4p" * 122805-Holinger-01_itms_14.10296.10296.2 2.0672 0.0548 95.2 1759.0918 1757.9441 3737.1 28 4.041 42.3 1 R.QIDINDYDLVCLIY.G Reverse_YHR126C 1 1 8.2% 159 16635 5.9 U YHR126C SGDID:S000001168, Chr VIII from 360184-359705, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_17.11892.11892.2 1.2914 0.1106 90.6 1219.3845 1222.2946 3854.0 18 3.77 54.2 1 S.VNATSSPTTAATT.E YBR196C 3 4 8.1% 554 61299 6.4 U PGI1 SGDID:S000000400, Chr II from 613895-612231, reverse complement, Verified ORF, "Glycolytic enzyme phosphoglucose isomerase, catalyzes the interconversion of glucose-6-phosphate and fructose-6-phosphate; required for cell cycle progression and completion of the gluconeogenic events of sporulation" * 122805-Holinger-03_itms_14.09259.09259.2 3.6104 0.3512 100.0 1754.0017 1755.0214 7567.2 2 5.728 52.9 1 K.KITDVVNIGIGGSDLGPV.M * 122805-Holinger-03_itms_14.09490.09490.2 2.9458 0.2225 99.3 1694.9059 1695.9127 3536.9 2 4.886 71.4 2 N.HFTQTPLEDNIPLLG.G * 122805-Holinger-03_itms_14.09516.09516.2 2.553 0.1583 95.5 1274.7611 1275.5309 4468.9 46 4.094 59.1 1 Q.GTKLIPSDFILA.A YAL036C 2 2 8.1% 369 40701 8.3 U RBG1 SGDID:S000000034, Chr I from 76153-75044, reverse complement, Verified ORF, "Member of the DRG family of GTP-binding proteins; interacts with translating ribosomes" * 122805-Holinger-04_itms_11.08351.08351.2 2.8002 0.1921 98.6 1368.7413 1369.5602 6134.9 1 4.444 53.8 1 A.SVGFVGFPSVGKST.L * 122805-Holinger-05_itms_11.08387.08387.2 2.5826 0.2102 95.3 1755.0037 1756.052 6165.2 57 4.063 43.3 1 Y.TKPKGQIPDFTDPVVL.R YNL055C 2 2 8.1% 283 30428 7.9 U POR1 SGDID:S000005000, Chr XIV from 518846-517995, reverse complement, Verified ORF, "Mitochondrial porin (voltage-dependent anion channel), outer membrane protein required for the maintenance of mitochondrial osmotic stability and mitochondrial membrane permeability" * 122805-Holinger-03_itms_11.07737.07737.2 2.6742 0.1083 97.4 1312.7726 1313.537 6401.7 5 4.29 68.2 1 A.NLTPGLKNELIT.S * 122805-Holinger-03_itms_11.07970.07970.2 2.8978 0.3218 100.0 1177.6648 1178.3708 8599.5 1 5.961 75.0 1 C.LKSPTFVGDLT.M YER074W 3 4 8.1% 135 15329 10.5 U RPS24A SGDID:S000000876, Chr V from 306319-306321,306788-307192, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Bp and has similarity to rat S24 ribosomal protein" YIL069C 3 4 8.1% 135 15329 10.5 U RPS24B SGDID:S000001331, Chr IX from 232366-232364,231954-231550, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps24Ap and has similarity to rat S24 ribosomal protein" 122805-Holinger-05_itms_9.07270.07270.2 3.6734 0.3749 100.0 1295.7332 1296.5118 6399.9 1 6.612 80.0 1 R.KQFVVDVLHPN.R 122805-Holinger-05_itms_9.07299.07299.3 3.1954 0.1487 99.5 1295.7347 1296.5118 5600.7 27 4.548 52.5 1 R.KQFVVDVLHPN.R 122805-Holinger-03_itms_12.08100.08100.2 3.3082 0.2722 100.0 1039.5741 1040.2072 3704.8 1 5.558 87.5 2 Q.FVVDVLHPN.R YML073C 1 1 8.0% 176 19961 10.1 U RPL6A SGDID:S000004538, Chr XIII from 124172-124158,123742-123227, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, has similarity to Rpl6Bp and to rat L6 ribosomal protein; binds to 5.8S rRNA" * 122805-Holinger-05_itms_10.07850.07850.2 3.2951 0.2628 99.8 1574.8484 1575.8046 6085.0 11 5.271 57.7 1 Q.KAPKWYPSEDVAAL.K YDL075W 1 2 8.0% 113 12953 10.0 U RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p" YLR406C 1 2 8.0% 113 12967 10.0 U RPL31B SGDID:S000004398, Chr XII from 931753-931697,931347-931063, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Ap and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p" 122805-Holinger-03_itms_7.05653.05653.2 2.9871 0.0615 94.8 958.5853 959.1337 4970.2 2 4.017 81.2 2 M.AGLKDVVTR.E YDR172W 4 4 7.9% 685 76551 7.0 U SUP35 SGDID:S000002579, Chr IV from 808319-810376, Verified ORF, "Translation termination factor eRF3; altered protein conformation creates the [PSI(+)] prion, a dominant cytoplasmically inherited protein aggregate that alters translational fidelity and creates a nonsense suppressor phenotype" * 122805-Holinger-02_itms_7.05904.05904.2 3.3246 0.2134 99.3 1789.8282 1790.8322 5567.6 1 4.812 64.3 1 L.IKEQEEEVDDEVVND.M * 122805-Holinger-04_itms_6.05381.05381.2 2.8519 0.267 99.8 1371.6909 1372.4801 4940.8 3 5.245 65.0 1 A.RKGEYETGFER.G * 122805-Holinger-03_itms_14.09248.09248.2 3.6857 0.3787 100.0 2027.9938 2029.2225 5431.5 1 7.096 62.5 1 K.DHVDPKECPWYTGPTLL.E * 122805-Holinger-05_itms_5.05269.05269.2 1.9143 0.133 99.4 1169.6521 1172.3672 5195.8 40 4.917 55.0 1 L.TSPKNPIKSVT.K YCL037C 3 3 7.8% 434 48060 8.9 U SRO9 SGDID:S000000542, Chr III from 58678-57374, reverse complement, Verified ORF, "Cytoplasmic RNA-binding protein that associates with translating ribosomes; involved in heme regulation of Hap1p as a component of the HMC complex, also involved in the organization of actin filaments; contains a La motif" * 122805-Holinger-05_itms_14.10410.10410.2 2.0373 0.1138 90.4 1225.3756 1227.3712 4969.0 17 3.755 55.6 1 N.GPQRRKFHNS.N * 122805-Holinger-05_itms_10.08250.08250.2 2.8079 0.1616 98.5 1322.6783 1323.4937 5729.7 1 4.436 70.0 1 Q.NQGFPPQFKPY.Q * 122805-Holinger-05_itms_9.07325.07325.2 2.6512 0.203 99.3 1549.867 1550.7979 5060.5 3 4.744 58.3 1 E.AKEPSPLDKYFVR.S YNR061C 1 1 7.8% 219 24317 4.9 U YNR061C SGDID:S000005344, Chr XIV from 743540-742881, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_12.09291.09291.2 2.026 0.1569 90.1 1821.7122 1823.967 8190.1 32 3.735 37.5 1 L.SQAKENGSSTRSVLKAC.V YFL039C 4 6 7.7% 375 41690 5.7 U ACT1 SGDID:S000001855, Chr VI from 54695-54686,54377-53260, reverse complement, Verified ORF, "Actin, structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions" * 122805-Holinger-04_itms_7.05936.05936.2 1.8436 0.1894 98.0 1146.6482 1147.3195 4605.1 31 4.37 61.1 1 L.RVAPEEHPVL.L * 122805-Holinger-05_itms_8.06811.06811.2 1.8938 0.2877 99.5 1259.7339 1260.4789 5431.4 55 5.067 65.0 1 L.RVAPEEHPVLL.T * 122805-Holinger-04_itms_8.06604.06604.2 2.5301 0.2363 99.0 1360.781 1361.584 3608.1 3 4.619 72.7 2 L.RVAPEEHPVLLT.E * 122805-Holinger-02_itms_13.09497.09497.2 4.3505 0.3843 100.0 1848.9888 1850.0758 6044.9 1 6.758 53.1 2 S.SIEKSYELPDGQVITIG.N YBR031W 7 7 7.7% 362 39092 10.6 U RPL4A SGDID:S000000235, Chr II from 300166-301254, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Bp and has similarity to E. coli L4 and rat L4 ribosomal proteins" YDR012W 7 7 7.7% 362 39062 10.6 U RPL4B SGDID:S000002419, Chr IV from 471850-472938, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins" 122805-Holinger-05_itms_11.08777.08777.2 2.5628 0.1981 97.0 1391.8889 1392.7251 5562.2 3 4.225 68.2 1 H.RVEKIPEIPLVV.S 122805-Holinger-05_itms_10.08264.08264.2 2.4449 0.0316 92.1 1478.9213 1479.8033 7157.3 3 3.85 58.3 1 H.RVEKIPEIPLVVS.T 122805-Holinger-05_itms_10.08289.08289.2 2.2422 0.1035 93.1 1579.9708 1580.9083 9172.9 1 3.919 53.8 1 H.RVEKIPEIPLVVST.D 122805-Holinger-03_itms_13.08852.08852.2 1.8317 0.1388 97.4 908.5974 909.15704 5756.1 1 4.301 78.6 1 E.KIPEIPLV.V 122805-Holinger-03_itms_14.09265.09265.2 2.306 0.185 95.5 1007.66797 1008.28955 5114.1 10 4.089 75.0 1 E.KIPEIPLVV.S 122805-Holinger-03_itms_9.06351.06351.2 2.1987 0.0381 92.8 951.5376 952.09534 4307.9 3 3.904 75.0 1 S.SKVGYTLPS.H 122805-Holinger-05_itms_8.07164.07164.2 2.7994 0.1901 98.1 1502.8484 1503.7385 5729.6 2 4.379 57.7 1 S.SKVGYTLPSHIIST.S YHR203C 2 2 7.7% 261 29410 10.1 U RPS4B SGDID:S000001246, Chr VIII from 505530-505517,505247-504476, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" YJR145C 2 2 7.7% 261 29410 10.1 U RPS4A SGDID:S000003906, Chr X from 702983-702970,702713-701942, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein" 122805-Holinger-05_itms_14.10446.10446.2 2.0042 0.166 98.6 1186.7457 1187.4679 5652.8 30 4.476 66.7 1 L.RESLPLIVFL.R 122805-Holinger-04_itms_8.06221.06221.3 2.3352 0.1042 98.4 1216.6885 1217.4105 4063.7 2 4.314 55.6 1 R.TIRYPDPNIK.V YBL092W 1 1 7.7% 130 14771 11.2 U RPL32 SGDID:S000000188, Chr II from 45975-46367, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to rat L32 ribosomal protein; overexpression disrupts telomeric silencing" * 122805-Holinger-03_itms_8.06125.06125.2 2.6075 0.2052 99.3 1049.5784 1050.1998 3850.3 1 4.894 77.8 1 N.ISQPKIGYGS.N YER160C 15 17 7.6% 1755 198568 8.5 U YER160C SGDID:S000000962, Chr V from 498119-496818,496816-492851, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-04_itms_5.04523.04523.2 2.6805 0.2122 99.3 1457.7046 1458.5303 5092.3 36 4.721 57.7 1 A.SSAVPENPHHASPQ.P 122805-Holinger-05_itms_4.04282.04282.2 1.8017 0.1702 96.1 1283.6372 1284.3738 3211.1 2 4.141 72.7 1 S.AVPENPHHASPQ.P 122805-Holinger-04_itms_10.07722.07722.2 2.8047 0.1751 98.1 1831.988 1833.0514 8324.0 142 4.39 40.0 2 T.VNGKPVRQITDDELTF.L 122805-Holinger-05_itms_11.08816.08816.2 2.7555 0.1065 96.4 2108.1423 2109.3867 5747.9 9 4.172 41.2 1 T.VNGKPVRQITDDELTFLY.N 122805-Holinger-04_itms_10.07598.07598.2 2.8205 0.2843 99.3 1618.8735 1619.815 5706.4 2 4.789 57.7 1 N.GKPVRQITDDELTF.L 122805-Holinger-05_itms_11.08539.08539.2 2.4678 0.1542 94.4 1731.9624 1732.9744 6015.1 1 3.98 50.0 1 N.GKPVRQITDDELTFL.Y 122805-Holinger-04_itms_10.07500.07500.2 2.374 0.093 97.0 1071.6704 1072.2932 5783.1 1 4.246 81.2 1 T.KVTNIIDRL.N 122805-Holinger-02_itms_12.08567.08567.2 1.8681 0.1985 92.8 886.4817 887.02325 3876.2 1 3.888 83.3 1 A.ELFLDIH.A 122805-Holinger-04_itms_5.04740.04740.2 2.2204 0.13 92.4 1072.6582 1073.278 3646.6 142 3.862 61.1 1 Y.TNTTKPKVIA.R 122805-Holinger-02_itms_5.04327.04327.2 3.4181 0.2757 100.0 1465.6678 1466.4583 6232.3 1 5.571 65.4 1 S.NNSPSTDNDSISKS.T 122805-Holinger-04_itms_9.07233.07233.2 3.0446 0.2882 100.0 1584.7695 1585.6732 7625.1 3 6.077 57.7 2 N.HTNHSDDELPGHLL.L 122805-Holinger-04_itms_14.09598.09598.2 2.7675 0.2627 99.8 1416.8059 1417.688 10218.8 1 5.21 63.6 1 N.SYGYIIYLPSLK.K 122805-Holinger-02_itms_12.08959.08959.2 2.5234 0.1062 90.5 1574.7917 1576.7435 6435.7 54 3.768 50.0 1 T.ELSDSFKELPPINS.H 122805-Holinger-05_itms_5.05029.05029.2 3.9988 0.1193 99.8 1676.9154 1677.8522 5999.9 2 5.378 61.5 1 N.SKKRSLEDNETEIK.V 122805-Holinger-04_itms_8.06426.06426.2 2.1728 0.0457 93.5 894.55786 895.0898 3703.7 26 3.936 78.6 1 K.LNVPLNPK.G Reverse_YDL129W 1 1 7.6% 291 32916 9.5 U YDL129W SGDID:S000002287, Chr IV from 231024-231899, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-06_itms_7.07585.07585.3 2.3901 0.1716 98.4 2714.0327 2710.0083 6162.7 56 4.318 25.0 1 V.RVYENTAPNDSRRRMRPHPKNN.E YHL034C 2 2 7.5% 294 32990 5.7 U SBP1 SGDID:S000001026, Chr VIII from 34075-33191, reverse complement, Verified ORF, "Nucleolar single-strand nucleic acid binding protein; associates with small nuclear RNAs" * 122805-Holinger-03_itms_9.06697.06697.2 5.3595 0.3685 100.0 2617.2158 2618.6814 9918.7 1 6.914 57.1 1 A.VIRPENDEEEIEQETGSEEKQE.- * 122805-Holinger-03_itms_9.06683.06683.3 4.6845 0.1754 98.1 2617.2197 2618.6814 5809.5 1 4.285 39.3 1 A.VIRPENDEEEIEQETGSEEKQE.- YNL107W 1 1 7.5% 226 25981 5.4 U YAF9 SGDID:S000005051, Chr XIV from 420100-420780, Verified ORF, "Subunit of both the NuA4 histone H4 acetyltransferase complex and the SWR1 complex, may function to antagonize silencing near telomeres; interacts directly with Swc4p, has homology to human leukemogenic protein AF9, contains a YEATS domain" * 122805-Holinger-04_itms_16.10897.10897.2 3.9419 0.2742 100.0 2130.0881 2131.3894 8219.7 1 6.946 59.4 1 Y.FDEIVFNEPNEEFFKIL.M Reverse_YDL226C 1 1 7.4% 352 39296 5.9 U GCS1 SGDID:S000002385, Chr IV from 52174-51116, reverse complement, Verified ORF, "ADP-ribosylation factor GTPase activating protein (ARF GAP), involved in ER-Golgi transport; shares functional similarity with Glo3p" * 122805-Holinger-04_itms_22.14161.14161.2 1.1228 0.2675 92.9 2783.4521 2786.0793 3352.5 38 3.907 14.0 1 P.TSGFGQYKGGQSPPLHDPRSQNKKGL.E YLR061W 1 1 7.4% 121 13693 6.2 U RPL22A SGDID:S000004051, Chr XII from 263195-263206,263596-263949, Verified ORF, "Protein component of the large (60S) ribosomal subunit, has similarity to Rpl22Bp and to rat L22 ribosomal protein" * 122805-Holinger-03_itms_11.07578.07578.2 2.5034 0.2319 100.0 1129.644 1130.3293 6914.9 5 5.673 81.2 1 K.YLIDHIKVE.G YIL127C 1 1 7.3% 206 23845 9.8 U YIL127C SGDID:S000001389, Chr IX from 117644-117024, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_15.10160.10160.2 3.555 0.0765 90.4 1860.8887 1860.9263 7081.3 3 3.752 57.1 1 W.DLEEEVRDELEDIQQ.S Reverse_YNL281W 1 1 7.2% 153 17246 4.8 U HCH1 SGDID:S000005225, Chr XIV from 108467-108928, Verified ORF, "Heat shock protein regulator that binds to Hsp90p and may stimulate ATPase activity; originally identified as a high-copy number suppressor of a HSP90 loss-of-function mutation; GFP-fusion protein localizes to the cytoplasm and nucleus" * 122805-Holinger-04_itms_13.09387.09387.3 2.1022 0.1264 96.2 1198.8544 1198.402 4440.4 6 4.159 50.0 1 F.EPIELKGDALI.G YMR056C 1 1 7.1% 309 34121 9.7 U AAC1 SGDID:S000004660, Chr XIII from 388243-387314, reverse complement, Verified ORF, "Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; Aac1p is a minor isoform while Pet9p is the major ADP/ATP translocator" * 122805-Holinger-04_itms_14.09854.09854.2 1.7326 0.1549 94.4 2330.7883 2329.7043 8399.8 88 3.98 26.2 1 G.AAGGLSLLFVYSLDYARTRLAA.D Reverse_YHL043W 1 1 7.1% 170 19812 8.7 U ECM34 SGDID:S000001035, Chr VIII from 14899-15411, Verified ORF, "Non-essential protein of unknown function" * 122805-Holinger-03_itms_12.08398.08398.2 1.8919 0.0787 91.1 1219.6876 1220.4569 7699.2 214 3.793 45.5 1 R.GGIGSFVKWGVI.L Reverse_YDR308C 1 1 7.1% 140 16071 5.0 U SRB7 SGDID:S000002716, Chr IV from 1078443-1078021, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation; target of the global repressor Tup1p" * 122805-Holinger-03_itms_5.04469.04469.3 3.962 0.1001 94.5 1216.6859 1217.405 5927.9 2 4.095 63.9 1 I.KEDEVEVLKK.Q YEL026W 1 1 7.1% 126 13569 7.9 U SNU13 SGDID:S000000752, Chr V from 101943-102323, Verified ORF, "RNA binding protein, part of U3 snoRNP involved in rRNA processing, part of U4/U6-U5 tri-snRNP involved in mRNA splicing, similar to human 15.5K protein" * 122805-Holinger-04_itms_7.05845.05845.2 1.7272 0.0246 91.3 869.5354 870.0397 3370.0 29 3.802 62.5 1 C.GVSRPVIAA.S YBR012W-B 11 12 7.0% 1756 198868 8.5 U YBR012W-B SGDID:S000002155, Chr II from 259867-261171,261173-265138, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-04_itms_5.04523.04523.2 2.6805 0.2122 99.3 1457.7046 1458.5303 5092.3 36 4.721 57.7 1 A.SSAVPENPHHASPQ.P 122805-Holinger-05_itms_4.04282.04282.2 1.8017 0.1702 96.1 1283.6372 1284.3738 3211.1 2 4.141 72.7 1 S.AVPENPHHASPQ.P 122805-Holinger-05_itms_11.08573.08573.2 2.6805 0.229 98.5 1700.954 1701.9603 5487.2 63 4.437 42.9 1 N.GKPVRPITDDELTFL.Y 122805-Holinger-04_itms_10.07500.07500.2 2.374 0.093 97.0 1071.6704 1072.2932 5783.1 1 4.246 81.2 1 T.KVTNIIDRL.N 122805-Holinger-02_itms_12.08567.08567.2 1.8681 0.1985 92.8 886.4817 887.02325 3876.2 1 3.888 83.3 1 A.ELFLDIH.A 122805-Holinger-04_itms_5.04740.04740.2 2.2204 0.13 92.4 1072.6582 1073.278 3646.6 142 3.862 61.1 1 Y.TNTTKPKVIA.R 122805-Holinger-02_itms_5.04327.04327.2 3.4181 0.2757 100.0 1465.6678 1466.4583 6232.3 1 5.571 65.4 1 S.NNSPSTDNDSISKS.T 122805-Holinger-04_itms_9.07233.07233.2 3.0446 0.2882 100.0 1584.7695 1585.6732 7625.1 3 6.077 57.7 2 N.HTNHSDDELPGHLL.L 122805-Holinger-04_itms_14.09598.09598.2 2.7675 0.2627 99.8 1416.8059 1417.688 10218.8 1 5.21 63.6 1 N.SYGYIIYLPSLK.K 122805-Holinger-02_itms_12.08959.08959.2 2.5234 0.1062 90.5 1574.7917 1576.7435 6435.7 54 3.768 50.0 1 T.ELSDSFKELPPINS.R 122805-Holinger-05_itms_5.05029.05029.2 3.9988 0.1193 99.8 1676.9154 1677.8522 5999.9 2 5.378 61.5 1 N.SKKRSLEDNETEIK.V Reverse_YMR311C 1 1 7.0% 229 26649 4.7 U GLC8 SGDID:S000004928, Chr XIII from 897602-896913, reverse complement, Verified ORF, "Regulatory subunit of protein phosphatase 1 (Glc7p), involved in glycogen metabolism and chromosome segregation; proposed to regulate Glc7p activity via conformational alteration; ortholog of the mammalian protein phosphatase inhibitor 2" * 122805-Holinger-04_itms_15.10665.10665.2 2.8312 0.2111 99.5 1792.9883 1794.067 5291.8 32 5.123 50.0 1 L.GPINRKHSTLKANKQT.N YOL127W 2 2 7.0% 142 15758 10.1 U RPL25 SGDID:S000005487, Chr XV from 80347-80359,80774-81189, Verified ORF, "Primary rRNA-binding ribosomal protein component of the large (60S) ribosomal subunit, has similarity to E. coli L23 and rat L23a ribosomal proteins; binds to 26S rRNA via a conserved C-terminal motif" * 122805-Holinger-02_itms_6.05261.05261.2 2.1735 0.0589 97.2 1014.6007 1015.1949 5482.8 1 4.281 75.0 1 Y.KVIEQPITS.E * 122805-Holinger-02_itms_6.05458.05458.2 2.3095 0.1202 99.7 1143.6448 1144.3104 5474.7 1 5.168 77.8 1 Y.KVIEQPITSE.T YDR155C 1 1 6.8% 162 17391 7.5 U CPR1 SGDID:S000002562, Chr IV from 768995-768507, reverse complement, Verified ORF, "Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A" * 122805-Holinger-05_itms_18.12441.12441.2 1.514 0.0217 97.0 1005.1047 1005.0697 4202.3 301 4.232 45.0 1 K.VESLGSPSGAT.K YDL212W 1 1 6.7% 210 23512 8.1 U SHR3 SGDID:S000002371, Chr IV from 78427-79059, Verified ORF, "Endoplasmic reticulum packaging chaperone, required for incorporation of amino acid permeases into COPII coated vesicles for transport to the cell surface" * 122805-Holinger-04_itms_14.09809.09809.2 2.3238 0.1501 91.9 1572.6539 1573.9164 8531.2 18 3.832 46.2 1 Y.QILHETPLPVIVTL.C YBR062C 1 1 6.7% 180 20596 4.8 U YBR062C SGDID:S000000266, Chr II from 366598-366583,366500-365974, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-01_itms_19.13205.13205.2 1.6459 0.2144 96.9 1178.8247 1177.0831 2706.4 347 4.207 45.5 1 G.NTSGEGDAHSDS.T YLR081W 5 5 6.6% 574 63626 7.3 U GAL2 SGDID:S000004071, Chr XII from 290213-291937, Verified ORF, "Galactose permease, required for utilization of galactose; also able to transport glucose" * 122805-Holinger-04_itms_16.10975.10975.2 1.69 0.1284 91.8 1718.0369 1716.8424 7749.7 3 3.825 43.3 1 G.EDVISSLSKDSHLSAQ.S 122805-Holinger-04_itms_13.09338.09338.2 2.6763 0.1569 99.4 1355.7681 1356.5675 6465.3 1 4.875 68.2 1 Y.SNSVQWRVPLGL.C 122805-Holinger-05_itms_12.09119.09119.2 3.1622 0.2844 100.0 1154.6904 1155.3854 6013.4 2 5.825 77.8 1 N.SVQWRVPLGL.C 122805-Holinger-05_itms_11.08769.08769.2 2.9289 0.3008 100.0 1314.7244 1315.5242 6931.6 4 5.523 65.0 1 N.SVQWRVPLGLC.F 122805-Holinger-03_itms_13.09153.09153.2 2.5272 0.2354 97.2 1116.5659 1114.3293 6178.1 1 4.278 75.0 1 Y.VFFFVPETK.G YJL170C 1 1 6.6% 183 21995 5.9 U ASG7 SGDID:S000003706, Chr X from 101695-101144, reverse complement, Verified ORF, "Protein that regulates signaling from a G protein beta subunit Ste4p and its relocalization within the cell; specific to a-cells and induced by alpha-factor" * 122805-Holinger-03_itms_10.06920.06920.2 3.0347 0.1251 91.0 1439.7047 1437.5028 6925.5 1 3.789 72.7 1 S.FLNVNTEQVEDE.N YER052C 4 6 6.5% 527 58110 6.7 U HOM3 SGDID:S000000854, Chr V from 257957-256374, reverse complement, Verified ORF, "Aspartate kinase (L-aspartate 4-P-transferase); cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis; expression regulated by Gcn4p and the general control of amino acid synthesis" * 122805-Holinger-03_itms_15.10212.10212.2 2.7981 0.2144 99.3 1820.9408 1821.9817 7273.5 19 4.83 46.4 2 A.SQESEFQDIIEVIRQ.D * 122805-Holinger-02_itms_15.10562.10562.2 3.6202 0.2419 99.8 1605.8402 1606.7728 6763.3 2 5.288 70.8 2 Q.ESEFQDIIEVIRQ.D * 122805-Holinger-05_itms_8.06846.06846.2 2.4067 0.2101 98.7 1019.5814 1017.2566 6090.4 18 4.568 75.0 1 Q.ALKEKLAPF.V * 122805-Holinger-04_itms_6.05124.05124.2 2.0104 0.1278 91.1 1122.5924 1124.156 6133.4 3 3.792 61.1 1 N.ISCVINESDS.I YMR244W 1 1 6.5% 355 37383 5.3 U YMR244W SGDID:S000004858, Chr XIII from 757249-758316, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_10.07159.07159.3 3.0519 0.1598 94.3 2240.2373 2241.608 4470.6 30 4.039 29.5 1 P.GNEAMLIPTLVGSGSKQTLAVPG.T Reverse_YGR262C 1 1 6.5% 261 29936 8.7 U BUD32 SGDID:S000003494, Chr VII from 1017765-1016980, reverse complement, Verified ORF, "Protein involved in bud-site selection; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern" * 122805-Holinger-05_itms_24.16186.16186.2 1.6634 0.2419 93.5 1944.9967 1943.3466 7686.1 7 3.934 31.2 1 Q.PVCLGPILYLKALLRSE.N YML118W 1 1 6.3% 505 57742 7.5 U NGL3 SGDID:S000004587, Chr XIII from 32334-33851, Verified ORF, "Putative endonuclease, has a domain similar to a magnesium-dependent endonuclease motif in mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p" * 122805-Holinger-05_itms_13.09984.09984.3 2.2221 0.0967 90.5 3304.0532 3305.5828 5871.2 122 3.899 20.2 1 Q.VEGKISPSQKESSSTSGLVSPSEDGPAHQKIH.R YJL138C 2 3 6.3% 395 44697 5.1 U TIF2 SGDID:S000003674, Chr X from 154609-153422, reverse complement, Verified ORF, "Translation initiation factor eIF4A, identical to Tif1p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" YKR059W 2 3 6.3% 395 44697 5.1 U TIF1 SGDID:S000001767, Chr XI from 554629-555816, Verified ORF, "Translation initiation factor eIF4A, identical to Tif2p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G" 122805-Holinger-05_itms_8.06821.06821.2 3.5159 0.1704 99.5 1610.9543 1611.8821 6195.0 1 4.991 64.3 2 A.ALQRIDTSVKAPQAL.M 122805-Holinger-04_itms_10.07610.07610.2 1.9049 0.0923 98.4 1044.6378 1045.27 6653.2 36 4.423 66.7 1 Q.IVVGTPGRVF.D YOR004W 1 1 6.3% 254 28801 10.0 U YOR004W SGDID:S000005530, Chr XV from 333592-334356, Uncharacterized ORF, "Protein required for cell viability" * 122805-Holinger-03_itms_5.04503.04503.2 1.0225 0.1558 90.2 1857.7712 1857.2992 2143.3 91 3.738 33.3 1 L.RRKLRTVPGVPLIHLT.R Reverse_YGL258W 1 1 6.3% 206 22152 4.5 U YGL258W SGDID:S000003227, Chr VII from 11110-11730, Uncharacterized ORF, "Hypothetical protein" Reverse_YOR387C 1 1 6.3% 206 22140 4.5 U YOR387C SGDID:S000005914, Chr XV from 1070237-1069617, reverse complement, Uncharacterized ORF, "Hypothetical protein" 122805-Holinger-05_itms_7.06423.06423.2 2.0942 0.1432 93.7 1294.6417 1292.3446 3236.4 45 3.941 54.2 1 A.WADGASETLVDAG.V YML036W 1 1 6.3% 189 21771 6.0 U YML036W SGDID:S000004500, Chr XIII from 205642-206211, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_14.09538.09538.2 3.0816 0.2159 99.3 1355.8188 1356.6482 4768.8 24 4.813 63.6 1 M.VVSIIPQFPDIK.V YMR001C 4 5 6.2% 705 81031 9.0 U CDC5 SGDID:S000004603, Chr XIII from 271136-269019, reverse complement, Verified ORF, "Polo-like kinase with similarity to Xenopus Plx1 and S. pombe Plo1p; found at bud neck, nucleus and SPBs; has multiple functions in mitosis and cytokinesis through phosphorylation of substrates; may be a Cdc28p substrate" * 122805-Holinger-03_itms_12.08360.08360.2 2.8695 0.101 96.0 1964.0493 1965.2133 6999.9 1 4.129 53.1 1 R.DFSFPRDKPISDEGKIL.I * 122805-Holinger-02_itms_9.06948.06948.2 2.5933 0.1579 94.5 1227.678 1228.388 6855.5 45 3.991 65.0 1 L.SLDPIERPSLT.E * 122805-Holinger-03_itms_10.07276.07276.2 4.2864 0.3774 100.0 1656.8309 1657.8229 3523.9 1 6.427 80.8 1 L.KYGEIPGYPESNFR.E * 122805-Holinger-04_itms_9.06768.06768.2 3.9459 0.3016 100.0 1913.9734 1915.1124 4831.4 1 5.549 66.7 2 L.KYGEIPGYPESNFREK.L YBR101C 1 1 6.2% 290 32604 5.1 U FES1 SGDID:S000000305, Chr II from 444687-443815, reverse complement, Verified ORF, "Hsp70 (Ssa1p) nucleotide exchange factor, cytosolic homolog of Sil1p, which is the nucleotide exchange factor for BiP (Kar2p) in the endoplasmic reticulum" * 122805-Holinger-04_itms_7.06065.06065.2 1.0689 0.4033 100.0 1980.953 1978.2963 2113.1 266 6.002 29.4 1 M.RAIALLTAYLSSVKIDEN.I YDR328C 1 1 6.2% 194 22330 4.5 U SKP1 SGDID:S000002736, Chr IV from 1126011-1125427, reverse complement, Verified ORF, "Evolutionarily conserved kinetochore protein that is part of multiple protein complexes, including the SCF ubiquitin ligase complex, the CBF3 complex that binds centromeric DNA, and the RAVE complex that regulates assembly of the V-ATPase" * 122805-Holinger-04_itms_26.16610.16610.3 2.3229 0.0523 94.8 1306.1207 1306.4612 3248.5 1 4.067 47.7 1 S.NVVLVSGEGERF.T YLR109W 1 1 6.2% 176 19115 5.2 U AHP1 SGDID:S000004099, Chr XII from 368782-369312, Verified ORF, "Thiol-specific peroxiredoxin, reduces hydroperoxides to protect against oxidative damage; function in vivo requires covalent conjugation to Urm1p" * 122805-Holinger-05_itms_6.05816.05816.2 2.5306 0.0995 98.6 1216.6973 1217.4105 5527.5 15 4.461 60.0 1 L.GVKDTTHIKFA.S Reverse_YLR042C 1 1 6.2% 161 16950 7.1 U YLR042C SGDID:S000004032, Chr XII from 230452-229967, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_15.10611.10611.2 1.9786 0.0145 97.4 1021.57196 1022.2322 4148.4 1 4.305 66.7 1 L.VIPAFALSGF.Q Reverse_YJL190C 1 1 6.2% 130 14626 9.9 U RPS22A SGDID:S000003726, Chr X from 75301-74909, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Bp and has similarity to E. coli S8 and rat S15a ribosomal proteins" Reverse_YLR367W 1 1 6.2% 130 14626 9.9 U RPS22B SGDID:S000004359, Chr XII from 856441-856573,857057-857316, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps22Ap and has similarity to E. coli S8 and rat S15a ribosomal proteins" 122805-Holinger-05_itms_8.07085.07085.2 1.722 0.1136 95.0 947.5822 949.0977 5250.3 6 4.037 64.3 1 I.DGIKVNFR.P YNL061W 2 4 6.1% 618 69812 5.0 U NOP2 SGDID:S000005005, Chr XIV from 510541-512397, Verified ORF, "Probable RNA m(5)C methyltransferase, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; localized to the nucleolus; constituent of 66S pre-ribosomal particles" * 122805-Holinger-03_itms_16.10522.10522.2 4.4852 0.3411 100.0 2944.282 2945.9685 8560.3 1 6.217 37.5 3 S.LFDDEEDDDEAGLVDEELKDEFDLE.Q * 122805-Holinger-05_itms_10.08140.08140.2 2.6445 0.256 99.3 1439.8027 1440.645 6109.1 2 4.823 58.3 1 L.VNRGVNLQPIGSW.T Reverse_YDR145W 2 2 6.1% 539 61073 9.6 U TAF12 SGDID:S000002552, Chr IV from 746733-748352, Verified ORF, "Subunit (61/68 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification, similar to histone H2A" * 122805-Holinger-02_itms_12.08570.08570.2 3.0928 0.2039 95.4 1418.777 1419.5284 8863.9 2 4.071 65.4 1 I.VTEGDGEDIGVTKV.L * 122805-Holinger-06_itms_11.09949.09949.3 1.9767 0.0863 90.3 1938.3594 1937.9744 5326.3 141 3.888 27.8 1 T.PISAPNSSNSNSTNNYAQA.A YKL060C 3 4 6.1% 359 39621 5.8 U FBA1 SGDID:S000001543, Chr XI from 327131-326052, reverse complement, Verified ORF, "Fructose 1,6-bisphosphate aldolase, a cytosolic enzyme required for glycolysis and gluconeogenesis; catalyzes the conversion of fructose 1,6 bisphosphate into two 3-carbon products: glyceraldehyde-3-phosphate and dihydroxyacetone phosphate" * 122805-Holinger-04_itms_12.08648.08648.2 3.7198 0.3536 100.0 1336.7878 1337.6047 4303.7 1 6.764 79.2 2 R.SIAPAYGIPVVLH.S * 122805-Holinger-04_itms_12.08490.08490.2 2.2258 0.3415 100.0 1249.7507 1250.5266 3404.3 1 5.522 68.2 1 S.IAPAYGIPVVLH.S * 122805-Holinger-05_itms_13.09823.09823.2 2.7967 0.256 99.0 1106.5922 1107.3557 3796.6 4 4.624 81.2 1 K.KLLPWFDGM.L YBR035C 1 1 6.1% 228 26908 7.5 U PDX3 SGDID:S000000239, Chr II from 306955-306269, reverse complement, Verified ORF, "Pyridoxine (pyridoxamine) phosphate oxidase, has homologs in E. coli and Myxococcus xanthus; transcription is under the general control of nitrogen metabolism " * 122805-Holinger-03_itms_12.08497.08497.3 2.4267 0.1512 99.2 1428.2439 1425.5382 5104.3 2 4.338 42.3 1 I.TFSSAELPSGRVSS.R YER056C 2 3 6.0% 533 58201 5.2 U FCY2 SGDID:S000000858, Chr V from 268112-266511, reverse complement, Verified ORF, "Purine-cytosine permease, mediates purine (adenine, guanine, and hypoxanthine) and cytosine accumulation" YER060W-A 2 3 6.0% 530 57327 5.2 U FCY22 SGDID:S000002958, Chr V from 276570-278162, Verified ORF, "Putative purine-cytosine permease, very similar to Fcy2p but cannot substitute for its function" 122805-Holinger-04_itms_13.09036.09036.3 2.3267 0.1607 92.1 1586.8584 1583.7814 5487.6 297 3.943 35.0 1 M.AGNAATLGISIPATYY.F 122805-Holinger-03_itms_16.10489.10489.2 2.9955 0.2394 99.5 1907.9276 1909.0648 4952.5 3 4.994 46.7 2 Y.NIDDWDNWEHLPIGIA.G YGL103W 2 2 6.0% 149 16722 10.6 U RPL28 SGDID:S000003071, Chr VII from 310970-311018,311530-311930, Verified ORF, "Ribosomal protein L29 of the large (60S) ribosomal subunit, has similarity to E. coli L15 and rat L27a ribosomal proteins; may have peptidyl transferase activity; can mutate to cycloheximide resistance" * 122805-Holinger-05_itms_9.07194.07194.2 2.4291 0.1681 95.6 978.65204 979.25104 2768.8 14 4.101 81.2 1 R.IPNVPVIVK.A * 122805-Holinger-05_itms_9.07225.07225.1 2.24 0.0186 91.6 978.65326 979.25104 6355.6 3 4.797 62.5 1 R.IPNVPVIVK.A YER091C 4 5 5.9% 767 85860 6.5 U MET6 SGDID:S000000893, Chr V from 342163-339860, reverse complement, Verified ORF, "Cobalamin-independent methionine synthase, involved in amino acid biosynthesis; requires a minimum of two glutamates on the methyltetrahydrofolate substrate, similar to bacterial metE homologs" * 122805-Holinger-04_itms_14.09735.09735.2 3.2071 0.2834 100.0 1589.9954 1590.9469 4526.9 5 5.835 56.7 2 T.VVPNLDAIKGLPVAAL.H * 122805-Holinger-03_itms_14.09172.09172.2 2.2897 0.209 98.3 1180.753 1181.4612 7042.7 167 4.404 59.1 1 N.LDAIKGLPVAAL.H * 122805-Holinger-03_itms_13.08793.08793.2 2.3892 0.2961 98.8 1928.9873 1930.1271 4173.9 1 4.591 40.6 1 L.HVDFVRAPEQFDEVVAA.I * 122805-Holinger-05_itms_7.06579.06579.2 2.4976 0.2022 97.4 1548.7852 1549.686 6130.4 17 4.304 59.1 1 L.RWSFPRDDVDQK.T YOR061W 2 2 5.9% 339 39404 8.5 U CKA2 SGDID:S000005587, Chr XV from 441535-442554, Verified ORF, "Alpha' catalytic subunit of casein kinase 2, a Ser/Thr protein kinase with roles in cell growth and proliferation; the holoenzyme also contains CKA1, CKB1 and CKB2, the many substrates include transcription factors and all RNA polymerases" * 122805-Holinger-03_itms_14.09170.09170.2 2.6519 0.174 98.6 1186.6361 1187.3806 8397.6 2 4.443 81.2 1 T.FKLPDIQYY.F * 122805-Holinger-05_itms_7.06430.06430.2 2.1687 0.1944 99.4 1366.6777 1367.5065 5296.9 4 4.98 55.0 1 E.FYHPGVDYNVR.V YHR172W 6 6 5.8% 823 96825 6.4 U SPC97 SGDID:S000001215, Chr VIII from 448335-450806, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" * 122805-Holinger-03_itms_14.09323.09323.2 3.2826 0.138 99.3 1012.6588 1013.26575 6585.9 9 4.901 87.5 1 L.VVKDLLNVL.I * 122805-Holinger-02_itms_12.08498.08498.2 5.1884 0.3886 100.0 2090.9583 2092.2227 4981.4 1 6.848 75.0 1 R.YFNDYEPSDPETPIEFK.I * 122805-Holinger-02_itms_11.07944.07944.2 3.6752 0.3356 100.0 1927.8882 1929.0466 4968.8 1 6.372 63.3 1 Y.FNDYEPSDPETPIEFK.I * 122805-Holinger-02_itms_10.07445.07445.2 3.9095 0.2548 99.8 1780.821 1781.8701 4623.8 1 5.418 67.9 1 F.NDYEPSDPETPIEFK.I * 122805-Holinger-04_itms_10.07737.07737.3 2.6892 0.2469 99.5 1336.7234 1337.5211 4165.4 134 4.567 50.0 1 R.DFNKVPNFSIR.E * 122805-Holinger-04_itms_8.06207.06207.2 2.4685 0.1779 98.5 1350.7094 1351.5115 4877.8 1 4.436 75.0 1 L.EKCYRNPTLAV.A YPL145C 2 2 5.8% 434 49492 6.0 U KES1 SGDID:S000006066, Chr XVI from 279698-278394, reverse complement, Verified ORF, "Member of the oxysterol binding protein family, which includes seven yeast homologs; involved in negative regulation of Sec14p-dependent Golgi complex secretory functions, peripheral membrane protein that localizes to the Golgi complex" * 122805-Holinger-05_itms_7.06127.06127.2 2.2268 0.276 99.5 1435.7235 1436.5669 7274.9 12 5.09 50.0 1 L.SEQVSHHPPVTAF.S * 122805-Holinger-04_itms_12.08626.08626.2 3.0439 0.0784 97.7 1365.7676 1366.6 3761.9 1 4.332 77.3 1 E.SYLVTPPPLHIE.G YNL010W 1 1 5.8% 241 27481 5.4 U YNL010W SGDID:S000004955, Chr XIV from 613636-614361, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.09051.09051.2 2.1776 0.122 92.6 1683.9114 1684.9391 4888.5 3 3.874 50.0 1 L.ESIHTPFPECIKIL.E YER031C 1 1 5.8% 223 24469 5.1 U YPT31 SGDID:S000000833, Chr V from 214746-214075, reverse complement, Verified ORF, "GTPase of the Ypt/Rab family, very similar to Ypt32p; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi" YGL210W 1 1 5.9% 222 24520 5.5 U YPT32 SGDID:S000003178, Chr VII from 93797-94465, Verified ORF, "GTPase of the Ypt/Rab family, very similar to Ypt31p; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi" 122805-Holinger-02_itms_18.12087.12087.2 2.0711 0.083 95.4 1301.7223 1302.427 2925.0 9 4.075 50.0 1 D.DNVAVGLIGNKSD.L YMR186W 4 4 5.7% 705 80900 4.8 U HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" * 122805-Holinger-04_itms_8.06539.06539.3 2.3859 0.1651 94.3 1551.9365 1552.8546 5855.8 81 4.039 37.5 1 R.ITPKPEEKVLEIR.D * 122805-Holinger-04_itms_8.06538.06538.2 2.6599 0.2575 99.7 1551.9379 1552.8546 6026.6 15 5.195 54.2 1 R.ITPKPEEKVLEIR.D * 122805-Holinger-05_itms_12.09250.09250.2 2.4789 0.0561 90.4 1876.0803 1877.1882 8038.3 15 3.754 46.9 1 K.ALKDILGDQVEKVVVSY.K 122805-Holinger-05_itms_7.06383.06383.2 3.0321 0.101 94.4 1067.6763 1068.3048 5209.9 120 3.98 72.2 1 Y.KLLDAPAAIR.T Reverse_YDL111C 1 1 5.7% 265 29055 5.5 U RRP42 SGDID:S000002269, Chr IV from 264110-263313, reverse complement, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3- 5 exonuclease complex with Rrp4p, Rrp41p, Rrp43p and Dis3p" * 122805-Holinger-06_itms_12.10273.10273.2 2.0249 0.0472 93.8 1701.0065 1699.0642 9354.5 28 3.95 46.4 1 P.AYKEVMALGQKLLHP.K YBR153W 1 1 5.7% 244 27116 6.8 U RIB7 SGDID:S000000357, Chr II from 547454-548188, Verified ORF, "Diaminohydroxyphoshoribosylaminopyrimidine deaminase; catalyzes the second step of the riboflavin biosynthesis pathway" * 122805-Holinger-04_itms_11.08054.08054.2 1.5631 0.1736 92.6 1476.7781 1477.62 5856.7 19 3.874 46.2 1 T.YAQSLDARVSRGPG.V YCR004C 1 1 5.7% 247 26350 8.2 U YCP4 SGDID:S000000597, Chr III from 120315-119572, reverse complement, Verified ORF, "Protein of unknown function, has sequence and structural similarity to flavodoxins; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-05_itms_22.14739.14739.3 2.1042 0.1594 94.6 1563.099 1566.7942 3137.7 6 4.054 40.4 1 I.AIITYSTYGHIDVL.A YJL158C 1 1 5.7% 227 23242 4.7 U CIS3 SGDID:S000003694, Chr X from 122865-122182, reverse complement, Verified ORF, "Mannose-containing glycoprotein constituent of the cell wall; member of the PIR (proteins with internal repeats) family" YKL164C 1 1 3.8% 341 34622 6.5 U PIR1 SGDID:S000001647, Chr XI from 142824-141799, reverse complement, Verified ORF, "O-glycosylated protein required for cell wall stability; attached to the cell wall via beta-1,3-glucan; mediates mitochondrial translocation of Apn1p; expression regulated by the cell integrity pathway and by Swi5p during the cell cycle" YKL163W 1 1 4.0% 325 33004 5.7 U PIR3 SGDID:S000001646, Chr XI from 144406-145383, Verified ORF, "O-glycosylated covalently-bound cell wall protein required for cell wall stability; expression is cell cycle regulated, peaking in M/G1 and also subject to regulation by the cell integrity pathway" YJL160C 1 1 4.5% 287 30215 9.0 U YJL160C SGDID:S000003696, Chr X from 118820-117957, reverse complement, Uncharacterized ORF, "Hypothetical protein" YJL159W 1 1 3.4% 387 38619 5.4 U HSP150 SGDID:S000003695, Chr X from 120444-121607, Verified ORF, "O-mannosylated heat shock protein that is secreted and covalently attached to the cell wall via beta-1,3-glucan and disulfide bridges; required for cell wall stability; induced by heat shock, oxidative stress, and nitrogen limitation" 122805-Holinger-05_itms_8.06656.06656.2 2.7473 0.3587 99.8 1444.7227 1445.5773 6078.5 1 5.264 66.7 1 N.RQFQFDGPPPQAG.A YHR094C 5 5 5.6% 570 63261 7.4 U HXT1 SGDID:S000001136, Chr VIII from 292628-290916, reverse complement, Verified ORF, "Low-affinity glucose transporter of the major facilitator superfamily, expression is induced by Hxk2p in the presence of glucose and repressed by Rgt1p when glucose is limiting" 122805-Holinger-04_itms_13.09338.09338.2 2.6763 0.1569 99.4 1355.7681 1356.5675 6465.3 1 4.875 68.2 1 Y.SNSVQWRVPLGL.C 122805-Holinger-05_itms_12.09119.09119.2 3.1622 0.2844 100.0 1154.6904 1155.3854 6013.4 2 5.825 77.8 1 N.SVQWRVPLGL.C 122805-Holinger-05_itms_11.08769.08769.2 2.9289 0.3008 100.0 1314.7244 1315.5242 6931.6 4 5.523 65.0 1 N.SVQWRVPLGLC.F * 122805-Holinger-05_itms_5.05273.05273.2 2.0475 0.1864 97.1 1257.6425 1255.382 3871.9 18 4.261 66.7 1 N.KCPPDHPYIQ.Y 122805-Holinger-03_itms_13.09153.09153.2 2.5272 0.2354 97.2 1116.5659 1114.3293 6178.1 1 4.278 75.0 1 Y.VFFFVPETK.G YDR345C 5 5 5.6% 567 62558 7.1 U HXT3 SGDID:S000002753, Chr IV from 1164652-1162949, reverse complement, Verified ORF, "Low affinity glucose transporter of the major facilitator superfamily, expression is induced in low or high glucose conditions" 122805-Holinger-04_itms_13.09338.09338.2 2.6763 0.1569 99.4 1355.7681 1356.5675 6465.3 1 4.875 68.2 1 Y.SNSVQWRVPLGL.C 122805-Holinger-05_itms_12.09119.09119.2 3.1622 0.2844 100.0 1154.6904 1155.3854 6013.4 2 5.825 77.8 1 N.SVQWRVPLGL.C 122805-Holinger-05_itms_11.08769.08769.2 2.9289 0.3008 100.0 1314.7244 1315.5242 6931.6 4 5.523 65.0 1 N.SVQWRVPLGLC.F * 122805-Holinger-05_itms_6.06054.06054.2 3.4602 0.2709 100.0 1151.6409 1152.3384 5582.1 8 6.144 77.8 1 N.KVAPDHPFIQ.Q 122805-Holinger-03_itms_13.09153.09153.2 2.5272 0.2354 97.2 1116.5659 1114.3293 6178.1 1 4.278 75.0 1 Y.VFFFVPETK.G YLR186W 1 1 5.6% 252 27895 8.4 U EMG1 SGDID:S000004176, Chr XII from 523634-524392, Verified ORF, "Protein required for the maturation of the 18S rRNA and for 40S ribosome production; associated with spindle/microtubules; nuclear localization depends on physical interaction with Nop14p; may bind snoRNAs" * 122805-Holinger-03_itms_7.05446.05446.2 2.6612 0.2113 99.1 1594.8234 1595.7123 5120.8 7 4.659 53.8 1 M.GRDISEARPDITHQ.C Reverse_YMR242C 1 1 5.6% 178 21236 10.3 U RPL20A SGDID:S000004855, Chr XIII from 754196-754178,753741-753224, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Bp and has similarity to rat L18a ribosomal protein" Reverse_YOR312C 1 1 5.7% 174 20713 10.3 U RPL20B SGDID:S000005839, Chr XV from 901176-901170,900762-900245, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl20Ap and has similarity to rat L18a ribosomal protein" 122805-Holinger-02_itms_20.13461.13461.2 1.8627 0.167 93.9 1192.8032 1193.2211 3486.1 1 3.954 83.3 1 M.NHTGSRSDYR.V YEL027W 2 2 5.6% 160 16351 8.0 U CUP5 SGDID:S000000753, Chr V from 100769-101251, Verified ORF, "Proteolipid subunit of the vacuolar H(+)-ATPase V0 sector (subunit c; dicyclohexylcarbodiimide binding subunit); required for vacuolar acidification and important for copper and iron metal ion homeostasis" * 122805-Holinger-04_itms_13.09481.09481.2 2.2224 0.0898 93.8 1132.6396 1133.3422 4348.4 70 3.948 68.8 1 T.CVLRPDLLF.K * 122805-Holinger-04_itms_13.09293.09293.2 1.8141 0.091 92.0 972.6059 973.2034 4051.1 112 3.844 71.4 1 C.VLRPDLLF.K YPL204W 2 3 5.5% 494 57340 9.3 U HRR25 SGDID:S000006125, Chr XVI from 164275-165759, Verified ORF, "Protein kinase involved in regulating diverse events including vesicular trafficking, gene expression, DNA repair, and chromosome segregation; binds the CTD of RNA pol II; homolog of mammalian casein kinase 1delta (CK1delta)" * 122805-Holinger-05_itms_5.05127.05127.2 2.6957 0.1257 91.9 1387.6985 1388.4825 6285.5 20 3.832 60.0 1 R.SRHPQLDYESR.V * 122805-Holinger-04_itms_5.04669.04669.2 4.4629 0.304 100.0 1920.9761 1922.0616 7923.3 1 6.29 70.0 2 Y.KNEDKHNPSPEEIKQQ.T YMR322C 1 1 5.5% 237 26040 8.1 U SNO4 SGDID:S000004941, Chr XIII from 919077-918364, reverse complement, Uncharacterized ORF, "Possible chaperone and cysteine protease with similarity to E. coli Hsp31 and S. cerevisiae Hsp31p, Hsp32p, and Hsp33p; member of the DJ-1/ThiJ/PfpI superfamily; may have a role in pyridoxine metabolism" YPL280W 1 1 5.5% 237 25940 7.6 U HSP32 SGDID:S000006201, Chr XVI from 11887-12600, Uncharacterized ORF, "Possible chaperone and cysteine protease with similarity to E. coli Hsp31 and S. cerevisiae Hsp31p, Hsp33p, and Sno4p; member of the DJ-1/ThiJ/PfpI superfamily, which includes human DJ-1 involved in Parkinson's disease" YOR391C 1 1 5.5% 237 25926 7.6 U HSP33 SGDID:S000005918, Chr XV from 1079254-1078541, reverse complement, Uncharacterized ORF, "Possible chaperone and cysteine protease with similarity to E. coli Hsp31 and S. cerevisiae Hsp32p, Hsp33p, and Sno4p; member of the DJ-1/ThiJ/PfpI superfamily, which includes human DJ-1 involved in Parkinson's disease" 122805-Holinger-04_itms_6.05529.05529.2 3.1344 0.0177 91.6 1463.8036 1465.6921 5765.1 1 3.814 70.8 1 H.GALFDYPKAKNLQ.D YKL145W 2 2 5.4% 467 51983 5.5 U RPT1 SGDID:S000001628, Chr XI from 174218-175621, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and the E3 ubiquitin-protein ligase Ubr1p" * 122805-Holinger-04_itms_26.16587.16587.2 2.8055 0.2894 99.5 1683.9794 1684.9762 6253.9 1 5.086 57.7 1 L.REVVELPLLSPERF.A 122805-Holinger-05_itms_7.06539.06539.2 2.2988 0.2559 100.0 1103.631 1104.2914 5054.5 99 5.552 60.0 1 L.LYGPPGTGKTL.C Reverse_YOR274W 1 1 5.4% 428 50237 9.0 U MOD5 SGDID:S000005800, Chr XV from 837671-838957, Verified ORF, "Delta 2-isopentenyl pyrophosphate:tRNA isopentenyl transferase, required for biosynthesis of the modified base isopentenyladenosine in mitochondrial and cytoplasmic tRNAs; gene is nuclear and encodes two isozymic forms" * 122805-Holinger-03_itms_19.12255.12255.2 1.4537 0.3191 99.3 2539.5254 2538.7332 4910.1 20 4.836 20.5 1 S.IFDNSIAIARQSANTDWQSLDTA.D Reverse_YPR174C 1 1 5.4% 221 25411 9.9 U YPR174C SGDID:S000006378, Chr XVI from 888704-888039, reverse complement, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nuclear periphery; potential Cdc28p substrate" * 122805-Holinger-05_itms_12.09065.09065.2 2.0426 0.0986 90.1 1241.8042 1240.4453 9872.0 48 3.736 50.0 1 S.STVLPNVARVPS.P YJL177W 1 1 5.4% 184 20551 10.9 U RPL17B SGDID:S000003713, Chr X from 90784-91092,91410-91655, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Ap and has similarity to E. coli L22 and rat L17 ribosomal proteins" * 122805-Holinger-03_itms_10.07023.07023.2 2.3199 0.2332 99.2 1261.6897 1259.4044 2807.0 44 4.68 77.8 1 Q.KYLDQVLDHQ.R YKL180W 1 1 5.4% 184 20549 10.9 U RPL17A SGDID:S000001663, Chr XI from 109274-109582,109889-110134, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl17Bp and has similarity to E. coli L22 and rat L17 ribosomal proteins; copurifies with the components of the outer kinetochore DASH complex" * 122805-Holinger-03_itms_10.06988.06988.2 3.0724 0.2601 99.8 1272.6812 1273.4313 5320.8 2 5.397 77.8 1 Q.KYLEQVLDHQ.R YBR029C 1 1 5.3% 457 51823 8.6 U CDS1 SGDID:S000000233, Chr II from 297742-296369, reverse complement, Verified ORF, "Phosphatidate cytidylyltransferase (CDP-diglyceride synthetase); an enzyme that catalyzes that conversion of CTP + phosphate into diphosphate + CDP-diaclglyerol, a critical step in the synthesis of all major yeast phospholipids" * 122805-Holinger-03_itms_13.08604.08604.2 1.9202 0.1371 90.4 2790.5833 2790.2495 8659.6 27 3.751 23.9 1 F.WFLLPCGLVIVNDIFAYLCGITFG.K YKR048C 2 3 5.3% 417 47885 4.3 U NAP1 SGDID:S000001756, Chr XI from 526282-525029, reverse complement, Verified ORF, "Protein that interacts with mitotic cyclin Clb2p; required for the regulation of microtubule dynamics during mitosis; controls bud morphogenesis; involved in the transport of H2A and H2B histones to the nucleus" * 122805-Holinger-03_itms_16.10374.10374.2 3.0199 0.0364 90.4 1368.6945 1369.5144 7033.2 45 3.755 63.6 1 I.NEEDILANQPLL.L * 122805-Holinger-03_itms_14.09368.09368.2 3.0841 0.2376 99.1 1252.6593 1253.443 3804.1 1 4.661 77.8 2 F.FNFFDPPKIQ.N YMR079W 1 1 5.3% 304 34901 5.5 U SEC14 SGDID:S000004684, Chr XIII from 424988-424996,425153-426058, Verified ORF, "Phosphatidylinositol/phosphatidylcholine transfer protein involved in coordinate regulation of PtdIns and PtdCho metabolism, products of which are regulators in Golgi to plasma membrane transport; functionally homologous to mammalian PITPs" * 122805-Holinger-03_itms_10.07371.07371.2 2.7826 0.2837 99.5 1775.8923 1776.9432 6196.3 4 5.037 53.3 1 W.RDPKYIGPEGEAPEAF.S Reverse_YMR084W 1 1 5.3% 262 29272 6.2 U YMR084W SGDID:S000004689, Chr XIII from 436627-437415, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_26.16740.16740.2 1.599 0.1359 96.3 1625.6522 1627.8125 9952.8 50 4.163 42.3 1 H.TARRTHAIGCHSIF.P YHR020W 3 3 5.2% 688 77386 6.4 U YHR020W SGDID:S000001062, Chr VIII from 143989-146055, Uncharacterized ORF, "Protein required for cell viability" * 122805-Holinger-04_itms_10.07731.07731.2 2.3422 0.1894 99.5 1296.6656 1297.4625 7088.2 8 5.04 60.0 1 S.GCYILRPPSYA.I * 122805-Holinger-02_itms_9.07022.07022.2 2.721 0.1453 96.2 1267.7101 1268.4528 6319.4 1 4.159 85.0 1 S.ELEEPIAIRPT.S * 122805-Holinger-03_itms_11.08002.08002.2 2.8674 0.1722 99.8 1539.806 1540.716 8039.2 1 5.29 61.5 1 L.SVENPLGSDHPKIF.A Reverse_YPR103W 1 1 5.2% 287 31637 6.2 U PRE2 SGDID:S000006307, Chr XVI from 732347-733210, Verified ORF, "20S proteasome beta-type subunit, responsible for the chymotryptic activity of the proteasome" * 122805-Holinger-03_itms_15.10251.10251.2 2.4158 0.0533 94.1 1585.8508 1587.8601 7071.3 208 3.96 42.9 1 L.NSLIKSAAAVSIREK.E Q0250 1 1 5.2% 251 28567 4.6 U COX2 SGDID:S000007281, Chr Mito from 73758-74513, Verified ORF, "Subunit II of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain; one of three mitochondrially-encoded subunits" * 122805-Holinger-02_itms_12.08464.08464.2 2.5658 0.335 100.0 1513.6986 1511.7153 4654.4 1 5.832 66.7 1 Y.VIPDELLEEGQLR.L Reverse_YER062C 1 1 5.2% 250 27814 6.2 U HOR2 SGDID:S000000864, Chr V from 280680-279928, reverse complement, Verified ORF, "One of two redundant DL-glycerol-3-phosphatases (RHR2/GPP1 encodes the other) involved in glycerol biosynthesis; induced in response to hyperosmotic stress and oxidative stress, and during the diauxic transition" * 122805-Holinger-02_itms_4.03707.03707.2 1.841 0.093 96.5 1228.6283 1230.4595 3842.0 93 4.175 45.8 1 T.AIGIIKCGAAKGA.A Reverse_YBR223C 1 1 5.1% 544 62333 8.2 U TDP1 SGDID:S000000427, Chr II from 670292-668658, reverse complement, Verified ORF, "Tyrosyl-DNA Phosphodiesterase I, hydrolyzes 3'-phosphotyrosyl bonds to generate 3'-phosphate DNA and tyrosine, involved in the repair of DNA lesions created by topoisomerase I" * 122805-Holinger-04_itms_19.12402.12402.3 2.9865 0.1185 96.6 3269.7378 3267.657 8778.6 1 4.163 25.9 1 V.FELESLPAFNVEEVSKTILEDIDKLHYS.N YMR099C 1 1 5.1% 297 33956 6.1 U YMR099C SGDID:S000004705, Chr XIII from 464826-463933, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_15.09828.09828.2 2.2994 0.1732 93.1 1797.936 1799.0361 5762.7 210 3.917 35.7 1 Y.NLPDTVVWNPWIEKS.Q YGL198W 1 1 5.1% 235 25995 7.0 U YIP4 SGDID:S000003166, Chr VII from 123596-124303, Verified ORF, "Protein that interacts with Rab GTPases; computational analysis of large-scale protein-protein interaction data suggests a possible role in vesicle-mediated transport" * 122805-Holinger-04_itms_16.11157.11157.2 2.0908 0.1646 95.4 1312.3958 1311.6078 5829.6 13 4.078 59.1 1 P.QVLNALVSQILL.P Reverse_YDR177W 1 1 5.1% 215 24178 5.2 U UBC1 SGDID:S000002584, Chr IV from 816873-817520, Verified ORF, "Ubiquitin-conjugating enzyme that mediates selective degradation of short-lived and abnormal proteins; plays a role in vesicle biogenesis and ER-associated protein degradation (ERAD); component of the cellular stress response" * 122805-Holinger-03_itms_8.05931.05931.2 2.4441 0.1732 94.4 1203.6782 1203.4308 4309.2 109 3.986 60.0 1 N.KLIDLCIAGTV.S Reverse_YEL024W 1 1 5.1% 215 23365 8.1 U RIP1 SGDID:S000000750, Chr V from 107260-107907, Verified ORF, "Ubiquinol-cytochrome-c reductase, a Rieske iron-sulfur protein of the mitochondrial cytochrome bc1 complex; transfers electrons from ubiquinol to cytochrome c1 during respiration" * 122805-Holinger-04_itms_26.16514.16514.2 1.9271 0.1258 93.0 1233.7079 1233.512 5995.3 18 3.908 60.0 1 Q.SILRKSTLSMP.K Reverse_YDR066C 1 1 5.1% 196 22541 5.0 U YDR066C SGDID:S000002473, Chr IV from 582495-581905, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_6.05538.05538.2 2.3059 0.1064 94.3 1195.6641 1196.3458 3781.0 90 3.979 66.7 1 A.EVISLQEHLQ.H YNL126W 7 15 5.0% 846 98227 7.5 U SPC98 SGDID:S000005070, Chr XIV from 387229-389769, Verified ORF, "Component of the microtubule-nucleating Tub4p (gamma-tubulin) complex; interacts with Spc110p at the spindle pole body (SPB) inner plaque and with Spc72p at the SPB outer plaque" * 122805-Holinger-03_itms_12.08293.08293.2 4.0904 0.3069 99.9 1938.9882 1940.1198 6272.1 1 5.496 56.2 1 F.DHEQIQIPSKIPNFESG.L * 122805-Holinger-03_itms_13.09097.09097.2 4.6338 0.2895 100.0 2052.0798 2053.2793 6277.5 1 6.45 61.8 1 F.DHEQIQIPSKIPNFESGL.L * 122805-Holinger-03_itms_15.10148.10148.2 4.0897 0.3211 100.0 2165.1677 2166.4387 7097.4 1 6.135 50.0 8 F.DHEQIQIPSKIPNFESGLL.H * 122805-Holinger-05_itms_12.09346.09346.2 3.4029 0.2421 99.3 1784.0316 1785.0935 6327.2 4 4.902 50.0 2 E.QIQIPSKIPNFESGLL.H * 122805-Holinger-03_itms_13.08976.08976.2 2.4641 0.2188 99.3 1117.6451 1118.3184 5555.9 1 4.722 77.8 1 S.KIPNFESGLL.H * 122805-Holinger-03_itms_13.08781.08781.2 2.9482 0.316 100.0 1604.8711 1605.791 5608.4 2 5.816 58.3 1 T.ENKSQNQFDLIRL.N * 122805-Holinger-02_itms_7.06132.06132.2 2.2586 0.1462 93.3 1145.6409 1146.2859 4938.7 327 3.93 66.7 1 F.NTNLKEIVSQ.Y YHR001W 1 1 5.0% 437 49805 7.2 U OSH7 SGDID:S000001043, Chr VIII from 106050-107363, Verified ORF, "Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability" * 122805-Holinger-06_itms_14.11359.11359.2 1.4489 0.1829 98.5 2567.7122 2566.0244 4100.0 243 4.432 14.3 1 E.KSSKKTVLFDTHQHFPLAPKVR.P YOR261C 1 1 5.0% 338 38313 5.6 U RPN8 SGDID:S000005787, Chr XV from 816929-815913, reverse complement, Verified ORF, "Essential, non-ATPase regulatory subunit of the 26S proteasome; has similarity to the human p40 proteasomal subunit and to another S. cerevisiae regulatory subunit, Rpn11p" * 122805-Holinger-06_itms_7.07436.07436.2 1.4242 0.2539 98.1 1802.6621 1803.0654 4738.7 40 4.376 21.9 1 L.IVDVKQQGVGLPTDAYV.A Reverse_YMR193W 1 1 5.0% 258 30049 10.1 U MRPL24 SGDID:S000004806, Chr XIII from 650035-650811, Verified ORF, "Mitochondrial ribosomal protein of the large subunit" * 122805-Holinger-03_itms_19.12025.12025.2 1.7187 0.124 91.3 1440.5648 1438.6207 4364.1 97 3.806 45.8 1 E.KTLYNDIGGEKSI.T Reverse_YFL060C 1 1 5.0% 222 25132 7.5 U SNO3 SGDID:S000001834, Chr VI from 10969-10301, reverse complement, Verified ORF, "Protein of unknown function, nearly identical to Sno2p; expression is induced before the diauxic shift and also in the absence of thiamin" * 122805-Holinger-04_itms_15.10182.10182.2 1.7174 0.0755 90.2 1214.6401 1216.4636 5518.5 452 3.738 55.0 1 N.LTKVLKAENSL.Q YIL133C 1 1 5.0% 199 22201 10.5 U RPL16A SGDID:S000001395, Chr IX from 99416-99386,99095-98527, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has similarity to Rpl16Bp, E. coli L13 and rat L13a ribosomal proteins; transcriptionally regulated by Rap1p" YNL069C 1 1 5.1% 198 22249 10.5 U RPL16B SGDID:S000005013, Chr XIV from 495002-494975,494525-493957, reverse complement, Verified ORF, "N-terminally acetylated protein component of the large (60S) ribosomal subunit, binds to 5.8 S rRNA; has similarity to Rpl16Ap, E. coli L13 and rat L13a ribosomal proteins; transcriptionally regulated by Rap1p" 122805-Holinger-05_itms_6.05685.05685.2 3.5382 0.2873 100.0 1125.7313 1126.3878 3843.4 1 6.013 94.4 1 L.LNGQKIVVVR.A YHR126C 1 1 5.0% 159 16635 5.9 U YHR126C SGDID:S000001168, Chr VIII from 360184-359705, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_8.06344.06344.2 1.7926 0.1174 91.8 837.497 837.8186 3181.6 190 3.835 64.3 1 A.QVSNSSDT.L Reverse_YJR067C 1 1 5.0% 141 16076 5.2 U YAE1 SGDID:S000003828, Chr X from 567358-566933, reverse complement, Verified ORF, "Essential protein of unknown function" * 122805-Holinger-02_itms_9.06959.06959.2 1.6578 0.2185 98.6 809.4323 806.8913 3608.2 140 4.489 58.3 1 L.KEEKSSV.I Reverse_YMR113W 1 1 4.9% 427 47851 6.8 U FOL3 SGDID:S000004719, Chr XIII from 494998-496281, Verified ORF, "Dihydrofolate synthetase, involved in folic acid biosynthesis; catalyzes the conversion of dihydropteroate to dihydrofolate in folate coenzyme biosynthesis" * 122805-Holinger-05_itms_11.08607.08607.3 2.7796 0.1686 92.8 2533.3728 2535.9268 9251.2 11 4.002 31.2 1 Y.DMRYLRGPWDVKALRTSVENK.T YBR251W 1 1 4.9% 307 34883 9.6 U MRPS5 SGDID:S000000455, Chr II from 721385-722308, Verified ORF, "Mitochondrial ribosomal protein of the small subunit" * 122805-Holinger-03_itms_13.08992.08992.2 3.8298 0.4068 100.0 1812.933 1813.0197 7995.5 1 6.452 64.3 1 S.RNVEFAPPYLDDFTK.I YBR011C 2 5 4.9% 287 32300 5.6 U IPP1 SGDID:S000000215, Chr II from 257973-257110, reverse complement, Verified ORF, "Cytoplasmic inorganic pyrophosphatase (PPase), catalyzes the rapid exchange of oxygens from Pi with water, highly expressed and essential for viability, active-site residues show identity to those from E. coli PPase" * 122805-Holinger-04_itms_16.10860.10860.2 2.1159 0.1326 90.2 1651.8549 1652.8413 5538.5 142 3.737 46.2 1 L.NDIEDVEKYFPGLL.R * 122805-Holinger-04_itms_15.10559.10559.2 3.2085 0.2577 99.3 1537.8085 1538.7374 4640.8 1 4.722 66.7 4 N.DIEDVEKYFPGLL.R YOR362C 1 1 4.9% 288 31536 5.2 U PRE10 SGDID:S000005889, Chr XV from 1018742-1017876, reverse complement, Verified ORF, "20S proteasome alpha-type subunit" * 122805-Holinger-03_itms_11.07469.07469.2 2.7398 0.0819 99.4 1437.7191 1438.6232 5318.2 1 4.842 61.5 1 R.PFGVSTIFGGVDKN.G Reverse_YFR007W 1 1 4.8% 353 39885 6.8 U YFR007W SGDID:S000001903, Chr VI from 159293-160354, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_8.06731.06731.2 2.0602 0.0239 91.2 1667.9484 1669.8813 4736.5 186 3.795 37.5 1 P.NDVAAIRIANATGGRAV.V YGL120C 3 3 4.7% 767 87562 6.4 U PRP43 SGDID:S000003088, Chr VII from 283943-281640, reverse complement, Verified ORF, "RNA helicase in the DEAH-box family, involved in release of the lariat-intron from the spliceosome" * 122805-Holinger-03_itms_11.07881.07881.2 1.9714 0.1524 94.2 1364.7444 1365.5718 4123.3 46 3.967 54.5 1 L.AVPGRTYPVELY.Y * 122805-Holinger-04_itms_10.07481.07481.2 2.3692 0.1865 98.7 1014.6344 1015.2383 5061.6 83 4.489 72.2 1 E.SLLVSPISKA.S * 122805-Holinger-03_itms_10.06979.06979.2 3.3821 0.1549 99.8 1745.8829 1746.917 7441.2 1 5.333 65.4 1 T.DYESPKYFDNIRKA.L YGR155W 2 2 4.7% 507 56022 6.7 U CYS4 SGDID:S000003387, Chr VII from 798548-800071, Verified ORF, "Cystathionine beta-synthase, catalyzes the synthesis of cystathionine from serine and homocysteine, the first committed step in cysteine biosynthesis" * 122805-Holinger-02_itms_16.11168.11168.2 2.6527 0.0861 92.5 1338.8318 1338.6305 4062.9 352 3.868 58.3 1 N.VIDLVGNTPLIAL.K * 122805-Holinger-03_itms_16.10341.10341.2 2.5456 0.1403 97.4 1364.6912 1364.5004 6199.9 9 4.294 65.0 1 N.NLWDDDVLARF.D YMR293C 2 2 4.7% 464 50919 8.6 U YMR293C SGDID:S000004907, Chr XIII from 856792-855398, reverse complement, Uncharacterized ORF, "protein similar to bacterial glutamyl-tRNA amidotransferases" * 122805-Holinger-05_itms_18.12656.12656.2 1.8512 0.1438 97.0 1803.3522 1802.0427 5633.2 75 4.256 36.7 1 K.PSYGRLSRFGVIAYSQ.S * 122805-Holinger-06_itms_13.11192.11192.2 1.7147 0.2151 95.7 1250.7334 1253.3947 7065.3 20 4.111 54.5 1 G.VIAYSQSLDTVG.I Reverse_YBR078W 2 2 4.7% 468 48237 5.1 U ECM33 SGDID:S000000282, Chr II from 393118-393175,393506-394854, Verified ORF, "GPI-anchored protein of unknown function, has a possible role in apical bud growth; GPI-anchoring on the plasma membrane crucial to function; similar to Sps2p and Pst1p" * 122805-Holinger-05_itms_8.06818.06818.2 2.0568 0.1138 90.7 1306.7372 1306.5627 4184.4 475 3.78 46.2 1 V.GVAAVVGMFSTAPV.L * 122805-Holinger-03_itms_10.07344.07344.2 1.6271 0.1111 93.6 896.50275 896.9726 4439.3 113 3.938 64.3 1 S.VSELSSQF.S YGL171W 3 3 4.6% 564 63653 9.1 U ROK1 SGDID:S000003139, Chr VII from 182396-184090, Verified ORF, "ATP-dependent RNA helicase of the DEAD box family; required for 18S rRNA synthesis" * 122805-Holinger-02_itms_16.11180.11180.1 2.3537 0.3482 100.0 1128.6533 1129.3416 4458.0 12 6.101 55.0 1 S.GIDIPLPIGSF.E * 122805-Holinger-03_itms_16.10484.10484.2 3.9733 0.3405 100.0 1758.018 1759.0984 9253.5 1 6.016 64.3 1 R.QLVQEGEFKPPIIIF.L * 122805-Holinger-03_itms_15.10225.10225.2 2.5009 0.1795 92.8 1517.8728 1517.8082 8147.8 1 3.899 58.3 1 L.VQEGEFKPPIIIF.L YNL112W 3 3 4.6% 546 60999 8.8 U DBP2 SGDID:S000005056, Chr XIV from 413641-414913,415916-416283, Verified ORF, "Essential ATP-dependent RNA helicase of the DEAD-box protein family, involved in nonsense-mediated mRNA decay and rRNA processing" * 122805-Holinger-03_itms_13.08841.08841.2 3.2479 0.2093 99.4 1745.9084 1746.9574 7596.4 1 4.84 61.5 1 N.WDEELPKLPTFEKN.F * 122805-Holinger-04_itms_6.05568.05568.2 2.534 0.2162 99.8 1080.6046 1079.2413 4465.4 47 5.417 61.1 1 S.GHDIPKPITT.F * 122805-Holinger-04_itms_9.07194.07194.2 2.836 0.3013 100.0 1225.6797 1226.4178 3907.1 1 5.569 80.0 1 S.GHDIPKPITTF.D YDR005C 1 2 4.6% 395 44733 5.3 U MAF1 SGDID:S000002412, Chr IV from 458100-458095,458014-456833, reverse complement, Verified ORF, "Negative regulator of RNA polymerase III; component of several signaling pathways that repress polymerase III transcription in response to changes in cellular environment; targets the initiation factor TFIIIB" * 122805-Holinger-04_itms_7.05764.05764.2 2.626 0.0217 94.8 2135.0024 2137.1956 6718.0 241 4.018 29.4 2 N.QSPCSSPFYSNRRDSNSF.W YML052W 1 1 4.6% 302 33830 7.5 U SUR7 SGDID:S000004516, Chr XIII from 170402-171310, Verified ORF, "Integral membrane protein localized to cortical patch structures; multicopy suppressor of rvs167 mutation; mutants show defects in sporulation and altered sphingolipid content in plasma membrane" * 122805-Holinger-04_itms_14.09728.09728.2 2.2855 0.1681 94.2 1649.805 1650.7905 4267.8 1 3.964 57.7 1 T.GIPNAGDETRWTFW.G YGL245W 2 3 4.5% 708 80843 7.5 U GUS1 SGDID:S000003214, Chr VII from 39023-41149, Verified ORF, "Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm" * 122805-Holinger-03_itms_17.10984.10984.2 3.0421 0.1534 98.7 1834.9047 1836.0173 4177.0 1 4.572 56.7 2 T.YDFCVPIVDAIEGVTH.A * 122805-Holinger-02_itms_15.10287.10287.2 3.9624 0.3324 100.0 1826.9473 1828.0288 5083.4 1 5.912 73.3 1 A.DTKDVVPVDLVDFDHL.I YHR007C 2 2 4.5% 530 60720 8.7 U ERG11 SGDID:S000001049, Chr VIII from 121678-120086, reverse complement, Verified ORF, "Lanosterol 14-alpha-demethylase, catalyzes the C-14 demethylation of lanosterol to form 4,4''-dimethyl cholesta-8,14,24-triene-3-beta-ol in the ergosterol biosynthesis pathway; member of the cytochrome P450 family" * 122805-Holinger-02_itms_13.09136.09136.2 2.4556 0.1549 96.0 1353.6875 1354.5022 7408.9 6 4.13 68.2 1 Y.SDLDKGFTPINF.V * 122805-Holinger-04_itms_12.08786.08786.2 2.6314 0.1745 98.7 1294.7291 1295.5211 3589.7 2 4.561 77.3 1 A.ISKGVSSPYLPF.G YIL106W 1 2 4.5% 314 35882 6.6 U MOB1 SGDID:S000001368, Chr IX from 166412-166431,166517-167441, Verified ORF, "Component of the mitotic exit network; associates with and is required for the activation and Cdc15p-dependent phosphorylation of the Dbf2p kinase; required for cytokinesis and cell separation; component of the CCR4 transcriptional complex" * 122805-Holinger-02_itms_19.12677.12677.2 2.6265 0.1774 94.2 1568.8712 1570.6989 5458.4 21 3.963 50.0 2 H.APPPEQLQNVTDFN.Y YNL200C 1 1 4.5% 246 27521 8.3 U YNL200C SGDID:S000005144, Chr XIV from 264454-263714, reverse complement, Uncharacterized ORF, "Hypothetical protein; similarity to human TGR-CL10C, thyroidal receptor for N-acetylglucosamine" * 122805-Holinger-04_itms_5.04867.04867.2 2.1316 0.1563 95.4 1111.5718 1110.3391 4083.1 184 4.08 65.0 1 I.NPAVLVSLTVP.K YJL130C 8 9 4.4% 2214 245123 5.9 U URA2 SGDID:S000003666, Chr X from 172285-165641, reverse complement, Verified ORF, "Bifunctional carbamoylphosphate synthetase (CPSase)-aspartate transcarbamylase (ATCase), catalyzes the first two enzymatic steps in the de novo biosynthesis of pyrimidines; both activities are subject to feedback inhibition by UTP" * 122805-Holinger-04_itms_9.06907.06907.2 2.57 0.1011 99.4 1250.6859 1250.4467 2665.5 146 4.954 65.0 1 L.EAKKTPVFGIC.L * 122805-Holinger-05_itms_7.06433.06433.2 3.2059 0.3037 99.8 1590.8881 1591.8075 6086.5 2 5.338 46.2 1 G.GLLEDNVKAHPRIE.A * 122805-Holinger-03_itms_14.09328.09328.2 2.4418 0.1662 98.8 1100.6915 1101.3745 6186.5 1 4.547 72.2 1 A.VKEIGFPVIV.R * 122805-Holinger-03_itms_13.08727.08727.2 1.5859 0.2063 94.1 1029.6283 1030.2554 3535.4 83 3.958 62.5 1 K.EIGFPVIVR.A * 122805-Holinger-05_itms_8.06710.06710.2 2.7614 0.1636 99.3 1414.8329 1415.6757 6103.0 1 4.783 75.0 1 F.AEKVGYPVLVRPS.Y * 122805-Holinger-04_itms_21.13866.13866.2 2.0283 0.0726 90.7 1788.1122 1787.2115 7575.0 4 3.779 40.6 1 I.SKVVGVNLIELATKAIM.G * 122805-Holinger-02_itms_14.09787.09787.2 2.882 0.2449 98.8 2086.1472 2087.4204 7349.9 1 4.549 44.4 1 M.GLPLTPYPVEKLPDDYVAV.K * 122805-Holinger-05_itms_12.09095.09095.2 2.8368 0.1685 96.6 1419.8486 1420.6921 4722.1 3 4.186 66.7 2 N.LVSPPELRLPEGL.R YLR259C 3 3 4.4% 572 60752 5.3 U HSP60 SGDID:S000004249, Chr XII from 665004-663286, reverse complement, Verified ORF, "Tetradecameric mitochondrial chaperonin required for ATP-dependent folding of precursor polypeptides and complex assembly; prevents aggregation and mediates protein refolding after heat shock; role in mtDNA transmission; similarity to groEL" * 122805-Holinger-05_itms_11.08352.08352.2 3.6094 0.227 99.8 1552.9031 1553.8418 9504.8 2 5.409 61.5 1 R.NVLIEQPFGPPKIT.K * 122805-Holinger-05_itms_12.09140.09140.2 2.9958 0.1388 98.8 1328.8434 1329.6659 9422.4 2 4.541 70.0 1 S.KVEFEKPLLLL.S * 122805-Holinger-05_itms_12.09026.09026.2 2.2278 0.0784 90.7 972.66705 973.2438 7217.7 61 3.778 78.6 1 E.FEKPLLLL.S YHR216W 2 2 4.4% 523 56530 8.5 U IMD2 SGDID:S000001259, Chr VIII from 554396-555967, Verified ORF, "Inosine monophosphate dehydrogenase, catalyzes the first step of GMP biosynthesis, expression is induced by mycophenolic acid resulting in resistance to the drug, expression is repressed by nutrient limitation" 122805-Holinger-02_itms_19.12464.12464.1 2.2273 0.2669 97.6 1433.7958 1434.675 5850.8 4 5.684 45.8 1 Y.NDFLILPGLVDFA.S * 122805-Holinger-02_itms_14.09651.09651.1 1.7443 0.2129 97.6 989.5482 990.1442 4902.9 106 5.151 50.0 1 E.SFPGLEVIAG.N YER143W 2 2 4.4% 428 47354 5.1 U DDI1 SGDID:S000000945, Chr V from 456314-457600, Verified ORF, "DNA damage-inducible v-SNARE binding protein, contains a ubiquitin-associated (UBA) domain, may act as a negative regulator of constitutive exocytosis, may play a role in S-phase checkpoint control" * 122805-Holinger-03_itms_12.08317.08317.2 2.1027 0.0157 92.8 952.52997 953.17584 4966.3 75 3.88 64.3 1 L.GPLILQRR.Y * 122805-Holinger-02_itms_22.14193.14193.2 1.7661 0.167 90.2 1060.7137 1063.1063 3700.5 334 3.738 60.0 1 L.PAPTSVTTSSD.K Reverse_YDR502C 1 1 4.4% 384 42256 5.4 U SAM2 SGDID:S000002910, Chr IV from 1454454-1453300, reverse complement, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" Reverse_YLR180W 1 1 4.5% 382 41818 5.2 U SAM1 SGDID:S000004170, Chr XII from 515264-516412, Verified ORF, "S-adenosylmethionine synthetase, catalyzes transfer of the adenosyl group of ATP to the sulfur atom of methionine; one of two differentially regulated isozymes (Sam1p and Sam2p)" 122805-Holinger-03_itms_8.06049.06049.2 2.2142 0.156 95.5 1628.8994 1629.8131 2543.0 269 4.095 37.5 1 G.TLGADGQPGGIVFRGSP.Q Reverse_YDL099W 1 1 4.4% 341 38295 4.6 U BUG1 SGDID:S000002257, Chr IV from 283419-284444, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-03_itms_11.07639.07639.3 2.4986 0.0905 96.0 1828.912 1833.0055 6188.2 20 4.128 35.7 1 L.KENEARLKTLEDEEK.Q YBR160W 1 1 4.4% 298 34061 8.4 U CDC28 SGDID:S000000364, Chr II from 560072-560968, Verified ORF, "Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates" * 122805-Holinger-04_itms_13.09245.09245.2 3.0608 0.1666 98.1 1550.857 1551.8254 5121.4 6 4.378 66.7 1 D.IVYLPDFKPSFPQ.W YIL124W 1 1 4.4% 297 32814 9.2 U AYR1 SGDID:S000001386, Chr IX from 126204-127097, Verified ORF, "NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase found in lipid particles and ER; involved in phosphatidic acid biosynthesis and required for spore germination; capable of metabolizing mammalian steroid hormones" * 122805-Holinger-03_itms_13.08739.08739.2 3.2453 0.1729 99.6 1518.87 1519.7783 8818.6 1 5.159 75.0 1 Y.KLDISKPEEIVTF.S YLR150W 1 1 4.4% 273 29995 9.7 U STM1 SGDID:S000004140, Chr XII from 440468-441289, Verified ORF, "Protein that binds G4 quadruplex and purine motif triplex nucleic acid; acts with Cdc13p to maintain telomere structure; interacts with ribosomes and subtelomeric Y' DNA; multicopy suppressor of tom1 and pop2 mutations" * 122805-Holinger-03_itms_6.05016.05016.2 2.3594 0.1629 96.6 1362.7876 1363.5968 3724.3 21 4.192 54.5 1 A.EKEAYVPATKVK.N YPL003W 1 1 4.3% 462 52853 5.3 U ULA1 SGDID:S000005924, Chr XVI from 552017-553405, Verified ORF, "Protein that acts together with Uba3p to activate Rub1p before its conjugation to proteins (neddylation), which may play a role in protein degradation" * 122805-Holinger-06_itms_15.12194.12194.2 1.091 0.1024 97.0 2324.912 2323.564 6315.8 166 4.222 18.4 1 M.VQFWEQPAVTAEDKDEFIGL.R YER081W 1 1 4.3% 469 51193 5.6 U SER3 SGDID:S000000883, Chr V from 322682-324091, Verified ORF, "3-phosphoglycerate dehydrogenase, catalyzes the first step in serine and glycine biosynthesis; isozyme of Ser33p" YIL074C 1 1 4.3% 469 51188 6.4 U SER33 SGDID:S000001336, Chr IX from 222487-221078, reverse complement, Verified ORF, "3-phosphoglycerate dehydrogenase, catalyzes the first step in serine and glycine biosynthesis; isozyme of Ser3p" 122805-Holinger-04_itms_14.09908.09908.2 3.3706 0.2343 99.4 2049.1655 2050.3599 5891.6 2 4.85 44.7 1 W.TSELVSLPNIILTPHIGGST.E YLR312C 1 1 4.3% 398 46628 9.7 U YLR312C SGDID:S000004303, Chr XII from 758835-757639, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_5.04316.04316.3 2.7463 0.0991 92.9 1901.9194 1903.0563 5064.2 64 3.992 35.9 1 K.DSTIRNSSTLSDHIIDK.S Reverse_YJR107W 1 1 4.3% 328 37261 6.1 U YJR107W SGDID:S000003868, Chr X from 627254-628240, Uncharacterized ORF, "Putative protein of unknown function; has sequence or structural similarity to lipases" * 122805-Holinger-03_itms_14.09230.09230.2 2.337 0.133 95.0 1555.8016 1556.6843 7761.9 174 4.036 42.3 1 N.IHPPCGGDNFTKNV.L Reverse_YLR146C 1 1 4.3% 300 34091 5.1 U SPE4 SGDID:S000004136, Chr XII from 433726-432824, reverse complement, Verified ORF, "Spermine synthase, required for the biosynthesis of spermine and also involved in biosynthesis of pantothenic acid" * 122805-Holinger-03_itms_11.07491.07491.3 2.8916 0.1317 98.8 1580.9143 1583.7849 3788.8 30 4.33 37.5 1 G.QEQESIKRQPINL.P YFL045C 1 2 4.3% 254 29063 5.2 U SEC53 SGDID:S000001849, Chr VI from 44392-43628, reverse complement, Verified ORF, "Phosphomannomutase, involved in synthesis of GDP-mannose and dolichol-phosphate-mannose; required for folding and glycosylation of secretory proteins in the ER lumen" * 122805-Holinger-04_itms_12.08669.08669.2 2.7681 0.2412 99.7 1344.7098 1345.5377 7856.0 2 5.191 70.0 2 L.KKEFPDYGLTF.S Reverse_YMR255W 1 1 4.3% 188 21571 9.8 U GFD1 SGDID:S000004868, Chr XIII from 778000-778566, Verified ORF, "Coiled-coiled protein of unknown function, identified as a high-copy suppressor of a dbp5 mutation" * 122805-Holinger-04_itms_8.06469.06469.2 1.9464 0.1469 96.9 889.49805 890.0269 4064.1 2 4.22 85.7 1 K.QSFPNIAL.S YKR095W 10 11 4.2% 1875 218454 5.2 U MLP1 SGDID:S000001803, Chr XI from 619447-625074, Verified ORF, "Myosin-like protein associated with the nuclear envelope, connects the nuclear pore complex with the nuclear interior; involved with Tel1p in telomere length control; involved with Pml1p and Pml39p in nuclear retention of unspliced mRNAs" * 122805-Holinger-03_itms_10.07142.07142.2 2.6307 0.1754 93.2 1385.7988 1386.5913 4325.3 1 3.924 77.3 1 Q.LNAVKEELNSIR.E * 122805-Holinger-05_itms_4.04414.04414.2 2.488 0.1459 95.5 1416.7721 1417.562 5337.7 1 4.092 58.3 1 N.SVSNDSKGPLRKE.E * 122805-Holinger-05_itms_7.06586.06586.2 2.736 0.1925 99.8 1350.5931 1348.6285 7225.5 12 5.296 65.0 1 Q.KVVTERLVEFK.N * 122805-Holinger-03_itms_6.05118.05118.2 3.0284 0.2494 99.4 1583.8052 1584.686 5163.7 1 4.965 70.8 1 S.HISDDERDKLRAE.I * 122805-Holinger-05_itms_10.08023.08023.2 3.2098 0.1689 96.6 1523.7198 1521.7599 8893.2 8 4.186 57.7 1 K.SVNNVQNPLLGLPR.K * 122805-Holinger-05_itms_10.07817.07817.2 3.4318 0.3564 100.0 1334.7777 1335.5491 9096.9 3 6.242 72.7 1 V.NNVQNPLLGLPR.K * 122805-Holinger-05_itms_10.07900.07900.2 3.0082 0.2424 99.5 1220.7363 1221.4453 9129.2 1 4.994 75.0 1 N.NVQNPLLGLPR.K * 122805-Holinger-05_itms_7.06515.06515.2 3.2654 0.2361 99.4 1585.8849 1586.7855 7057.0 1 4.915 69.2 1 Q.TKSNKRPIDEVGEL.K * 122805-Holinger-03_itms_10.07033.07033.2 2.6585 0.2257 98.6 1356.7339 1357.5065 5922.2 5 4.472 63.6 2 K.SNKRPIDEVGEL.K * 122805-Holinger-04_itms_7.06131.06131.2 2.8232 0.1484 98.6 1484.8329 1485.6805 7598.6 122 4.487 50.0 1 K.SNKRPIDEVGELK.N YGL062W 3 3 4.2% 1178 130099 6.2 U PYC1 SGDID:S000003030, Chr VII from 385199-388735, Verified ORF, "Pyruvate carboxylase isoform, cytoplasmic enzyme that converts pyruvate to oxaloacetate; highly similar to isoform Pyc2p but differentially regulated; mutations in the human homolog are associated with lactic acidosis" 122805-Holinger-05_itms_5.04992.04992.2 2.4255 0.1452 92.2 1206.7052 1207.4154 7730.5 7 3.853 66.7 1 F.LDKPKHIEVQ.L * 122805-Holinger-02_itms_3.03460.03460.2 1.4868 0.1585 94.0 1131.6318 1131.2797 4618.3 143 3.956 44.4 1 K.GPAEFARQVR.Q 122805-Holinger-03_itms_20.12853.12853.2 1.1018 0.2233 91.8 2932.612 2933.2573 7817.5 26 3.829 17.9 1 N.SMSGLTSQPSINALLASLEGNIDTGINVE.H YGL202W 2 3 4.2% 500 56178 6.0 U ARO8 SGDID:S000003170, Chr VII from 116063-117565, Verified ORF, "Aromatic aminotransferase, expression is regulated by general control of amino acid biosynthesis" * 122805-Holinger-03_itms_16.10549.10549.2 3.6235 0.252 99.4 2194.2651 2194.5762 5586.4 1 4.978 45.0 1 E.AQGVITFPVPIDADGIIPEKL.A * 122805-Holinger-04_itms_15.10418.10418.2 3.7023 0.203 99.3 1994.1605 1995.3666 5846.0 1 4.745 55.6 2 Q.GVITFPVPIDADGIIPEKL.A YPL171C 1 1 4.2% 400 44921 5.6 U OYE3 SGDID:S000006092, Chr XVI from 227370-226168, reverse complement, Verified ORF, "Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye2p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism" * 122805-Holinger-06_itms_19.14772.14772.2 1.0498 0.1613 98.5 1844.4521 1844.2285 4181.5 36 4.436 21.9 1 E.PIKIGNTQLAHRAVMPP.L Reverse_YHR075C 1 1 4.2% 400 44888 7.1 U PPE1 SGDID:S000001117, Chr VIII from 249643-248441, reverse complement, Verified ORF, "Protein with carboxyl methyl esterase activity that may have a role in demethylation of the phosphoprotein phosphatase catalytic subunit; also identified as a small subunit mitochondrial ribosomal protein" * 122805-Holinger-04_itms_18.12263.12263.2 1.5778 0.0867 93.8 1982.9722 1981.3481 6907.7 30 3.95 31.2 1 D.WFPSFTKLNTIRVVKGS.K YMR318C 1 1 4.2% 360 39618 6.7 U ADH6 SGDID:S000004937, Chr XIII from 912141-911059, reverse complement, Verified ORF, "NADPH-dependent cinnamyl alcohol dehydrogenase family member with broad substrate specificity; may be involved in fusel alcohol synthesis or in aldehyde tolerance" * 122805-Holinger-04_itms_13.09029.09029.2 3.2775 0.2634 100.0 1727.9481 1728.9884 4968.8 4 5.743 50.0 1 H.EHFVVPIPENIPSHL.A YGR060W 1 1 4.2% 309 36479 8.1 U ERG25 SGDID:S000003292, Chr VII from 610568-611497, Verified ORF, "C-4 methyl sterol oxidase, catalyzes the first of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; mutants accumulate the sterol intermediate 4,4-dimethylzymosterol" * 122805-Holinger-04_itms_15.10345.10345.2 2.8059 0.1763 97.9 1554.8524 1554.8903 4737.5 41 4.356 54.2 1 F.LVEAIPIWTFHPM.C Reverse_YDL236W 1 1 4.2% 312 34625 6.4 U PHO13 SGDID:S000002395, Chr IV from 32296-33234, Verified ORF, "Alkaline phosphatase specific for p-nitrophenyl phosphate, involved in dephosphorylation of histone II-A and casein" * 122805-Holinger-04_itms_9.06835.06835.2 1.9675 0.0435 96.7 1444.7247 1445.5713 3543.1 21 4.195 50.0 1 A.GPFTYGKQPFTSD.V YNL159C 1 1 4.2% 289 32986 9.5 U ASI2 SGDID:S000005103, Chr XIV from 339349-338480, reverse complement, Verified ORF, "Predicted membrane protein; genetic interactions suggest a role in negative regulation of amino acid uptake" * 122805-Holinger-05_itms_22.15252.15252.2 1.8126 0.1454 94.9 1211.8691 1214.4069 3364.5 5 4.021 54.5 1 W.KFAKIFGSGGTT.L YDR410C 1 1 4.2% 239 27888 7.9 U STE14 SGDID:S000002818, Chr IV from 1293081-1292362, reverse complement, Verified ORF, "Farnesyl cysteine-carboxyl methyltransferase, mediates the carboxyl methylation step during C-terminal CAAX motif processing of a-factor and RAS proteins in the endoplasmic reticulum, localizes to the ER membrane " * 122805-Holinger-05_itms_12.08979.08979.2 2.3303 0.1455 99.3 1043.6454 1044.2822 6549.0 2 4.71 77.8 1 K.NKVGVGIPFI.- YMR150C 1 1 4.2% 190 21433 7.5 U IMP1 SGDID:S000004758, Chr XIII from 562527-561955, reverse complement, Verified ORF, "Catalytic subunit of the mitochondrial inner membrane peptidase complex, required for maturation of mitochondrial proteins of the intermembrane space; complex contains Imp1p and Imp2p (both catalytic subunits), and Som1p" * 122805-Holinger-04_itms_9.07032.07032.2 1.7054 0.1228 95.3 799.9249 801.9763 4952.4 93 4.049 71.4 1 T.GMPGDLVL.V YLR227W-B 5 6 4.1% 1755 198404 7.9 U YLR227W-B SGDID:S000007376, Chr XII from 593440-594744,594746-598708, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-02_itms_13.09399.09399.2 2.5867 0.0504 96.8 1373.7311 1376.4631 5304.8 85 4.198 45.8 1 H.TNQDPLDVSASKT.E 122805-Holinger-04_itms_9.07233.07233.2 3.0446 0.2882 100.0 1584.7695 1585.6732 7625.1 3 6.077 57.7 2 N.HTNHSDDELPGHLL.L 122805-Holinger-04_itms_8.06586.06586.2 3.7131 0.2921 100.0 1837.9965 1839.0557 5923.1 1 6.505 62.5 1 N.SSHNIVPIKTPTTVSEQ.N 122805-Holinger-02_itms_12.08959.08959.2 2.5234 0.1062 90.5 1574.7917 1576.7435 6435.7 54 3.768 50.0 1 T.ELSDSFKELPPINS.R 122805-Holinger-05_itms_5.05029.05029.2 3.9988 0.1193 99.8 1676.9154 1677.8522 5999.9 2 5.378 61.5 1 N.SKKRSLEDNETEIK.V YDR052C 2 2 4.1% 704 80690 9.3 U DBF4 SGDID:S000002459, Chr IV from 560622-558508, reverse complement, Verified ORF, "Regulatory subunit of Cdc7p-Dbf4p kinase complex, required for Cdc7p kinase activity and initiation of DNA replication; phosphorylates the Mcm2-7 family of proteins; cell cycle regulated" * 122805-Holinger-03_itms_6.04888.04888.2 1.984 0.0571 91.9 1027.571 1028.2057 4234.1 3 3.84 64.3 1 K.RARIERAR.S * 122805-Holinger-05_itms_15.10915.10915.3 2.4276 0.0189 92.5 2149.6064 2152.2847 8441.8 13 3.955 32.5 1 Q.AFEIKASGAHQSNDVATSFGN.G YLR303W 1 1 4.1% 444 48672 6.4 U MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" * 122805-Holinger-03_itms_11.07557.07557.2 3.7277 0.3747 100.0 1974.0537 1975.2059 5021.8 1 5.891 64.7 1 F.GVKDLPNADKETDPFKLS.G YMR180C 1 1 4.1% 320 36974 9.7 U CTL1 SGDID:S000004792, Chr XIII from 623212-622250, reverse complement, Verified ORF, "RNA 5'-triphosphatase, localizes to both the nucleus and cytoplasm" * 122805-Holinger-06_itms_6.06475.06475.2 1.3483 0.0647 96.6 1636.8278 1635.9303 3322.0 316 4.185 37.5 1 R.THRRMTPHNKPFI.V Reverse_YOR358W 1 1 4.1% 242 27676 4.6 U HAP5 SGDID:S000005885, Chr XV from 1010157-1010885, Verified ORF, "Subunit of the heme-activated, glucose-repressed Hap2/3/4/5 CCAAT-binding complex, a transcriptional activator and global regulator of respiratory gene expression; required for assembly and DNA binding activity of the complex" * 122805-Holinger-02_itms_4.03971.03971.2 2.6676 0.0707 98.5 1032.495 1034.0275 6046.4 248 4.442 66.7 1 N.GNDEGELSGR.G Reverse_YFR008W 1 1 4.1% 221 25915 6.1 U FAR7 SGDID:S000001904, Chr VI from 160529-161194, Verified ORF, "Protein involved in G1 cell cycle arrest in response to pheromone, in a pathway different from the Far1p-dependent pathway; interacts with Far3p, Far8p, Far9p, Far10p, and Far11p" * 122805-Holinger-04_itms_7.05773.05773.2 1.7538 0.0073 90.2 1075.5768 1074.182 4238.1 421 3.74 50.0 1 I.KAKEAQNER.L Reverse_YGR143W 1 1 4.0% 771 86241 4.8 U SKN1 SGDID:S000003375, Chr VII from 775198-777513, Verified ORF, "Protein involved in sphingolipid biosynthesis; type II membrane protein with similarity to Kre6p" * 122805-Holinger-04_itms_20.13120.13120.3 2.3141 0.2598 97.1 3378.4885 3375.7686 9447.5 5 4.252 20.0 1 Q.SQAASIHRTGVLPYRDFPPPSKILSNNSFSS.M YPR074C 5 5 4.0% 680 73806 7.0 U TKL1 SGDID:S000006278, Chr XVI from 694835-692793, reverse complement, Verified ORF, "Transketolase, similar to Tkl2p; catalyzes conversion of xylulose-5-phosphate and ribose-5-phosphate to sedoheptulose-7-phosphate and glyceraldehyde-3-phosphate in the pentose phosphate pathway; needed for synthesis of aromatic amino acids" * 122805-Holinger-05_itms_9.07622.07622.2 3.1184 0.3588 100.0 1708.8615 1709.8558 6684.6 7 6.236 50.0 1 L.GSRTPGHPEFELPGVE.V * 122805-Holinger-05_itms_10.07992.07992.2 3.0926 0.325 100.0 1908.985 1910.0935 6198.9 11 5.772 44.1 1 L.GSRTPGHPEFELPGVEVT.T * 122805-Holinger-05_itms_10.08106.08106.2 2.4088 0.3115 99.2 1764.925 1765.9634 6459.8 16 4.676 43.3 1 S.RTPGHPEFELPGVEVT.T * 122805-Holinger-03_itms_13.08806.08806.2 2.0759 0.145 93.1 1608.8209 1609.7759 5430.3 174 3.917 42.9 1 R.TPGHPEFELPGVEVT.T * 122805-Holinger-03_itms_12.08179.08179.2 2.2914 0.1008 95.8 1061.5804 1059.1663 7252.1 8 4.114 68.8 1 K.FGFNPDKSF.V YKL212W 3 3 4.0% 623 71125 7.7 U SAC1 SGDID:S000001695, Chr XI from 34544-36415, Verified ORF, "Lipid phosphoinositide phosphatase of the ER and Golgi, involved in protein trafficking and secretion" * 122805-Holinger-05_itms_14.10565.10565.2 1.5747 0.0111 91.9 1776.8522 1775.2897 5325.4 1 3.837 43.3 1 E.VVKIASLMGFIKLKLN.R * 122805-Holinger-04_itms_11.07909.07909.2 2.2574 0.029 92.8 989.3499 988.2151 6049.6 21 3.895 68.8 1 W.PKLVDVGFL.V * 122805-Holinger-05_itms_12.09272.09272.2 2.0305 0.0813 90.7 889.2505 891.0984 3304.8 220 3.779 71.4 1 P.KLVDVGFL.V YLR276C 2 2 4.0% 594 68060 9.2 U DBP9 SGDID:S000004266, Chr XII from 696832-695048, reverse complement, Verified ORF, "ATP-dependent RNA helicase of the DEAD-box family involved in biogenesis of the 60S ribosomal subunit" * 122805-Holinger-05_itms_11.08618.08618.2 3.5225 0.2685 99.8 1605.9325 1606.9054 8358.8 2 5.246 57.7 1 Q.AIKNIGFQYPTLIQ.S * 122805-Holinger-03_itms_12.08062.08062.2 2.2287 0.1335 95.8 1147.6578 1148.3446 4990.9 14 4.118 66.7 1 Q.SKLGLELQPY.K Reverse_YPL179W 2 2 4.0% 549 61421 9.3 U PPQ1 SGDID:S000006100, Chr XVI from 208156-209805, Verified ORF, "Putative protein serine/threonine phosphatase; null mutation enhances efficiency of translational suppressors" * 122805-Holinger-02_itms_21.13752.13752.2 2.0346 0.0134 92.6 1121.7709 1120.115 4625.6 51 3.874 54.5 1 L.FSSTSSSASTAS.S * 122805-Holinger-06_itms_19.14269.14269.2 1.7216 0.1381 94.4 1078.8042 1079.0648 7102.1 16 3.983 55.6 1 F.SYSSPSSYNS.E YBR166C 2 2 4.0% 452 50923 6.6 U TYR1 SGDID:S000000370, Chr II from 571195-569837, reverse complement, Verified ORF, "Prephenate dehydrogenase involved in tyrosine biosynthesis, expression is dependent on phenylalanine levels" * 122805-Holinger-04_itms_12.08763.08763.2 2.4732 0.1178 90.5 812.5758 813.0715 4663.7 3 3.769 85.7 1 T.KVIGIIGL.G * 122805-Holinger-03_itms_15.10053.10053.2 2.558 0.2972 99.8 1192.7219 1193.4717 7381.0 7 5.338 66.7 1 S.EYLFLKPGLL.E YEL002C 1 1 4.0% 430 49392 5.9 U WBP1 SGDID:S000000728, Chr V from 150013-148721, reverse complement, Verified ORF, "Beta subunit of the oligosaccharyl transferase (OST) glycoprotein complex; required for N-linked glycosylation of proteins in the endoplasmic reticulum" * 122805-Holinger-04_itms_10.07272.07272.2 2.7224 0.1601 91.6 1824.9341 1822.0336 6715.2 13 3.814 43.8 1 S.GSQGFLVVGFQNLNNAR.L Reverse_YBL069W 1 1 4.0% 429 48349 8.3 U AST1 SGDID:S000000165, Chr II from 90739-92028, Verified ORF, "Peripheral membrane protein that interacts with the plasma membrane ATPase Pma1p and has a role in its targeting to the plasma membrane, possibly by influencing its incorporation into lipid rafts" * 122805-Holinger-05_itms_9.07296.07296.3 2.7889 0.0999 92.5 1730.053 1726.9243 6409.2 43 3.963 37.5 1 L.SGAAEEASVSEPRLLIP.D YER003C 1 1 4.0% 429 48189 6.0 U PMI40 SGDID:S000000805, Chr V from 159117-159087,158993-157735, reverse complement, Verified ORF, "Mannose-6-phosphate isomerase, catalyzes the interconversion of fructose-6-P and mannose-6-P; required for early steps in protein mannosylation" * 122805-Holinger-03_itms_15.09888.09888.2 2.8055 0.1811 97.9 1912.9681 1914.1217 8575.1 2 4.357 46.9 1 F.FIAPHLPVDLEAEDEAF.T YEL056W 1 1 4.0% 401 45060 4.8 U HAT2 SGDID:S000000782, Chr V from 47168-48373, Verified ORF, "Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing" * 122805-Holinger-03_itms_15.09854.09854.2 2.6703 0.1691 98.5 1827.9983 1829.1057 4998.0 26 4.441 40.0 1 Q.WLPTPVQELDGGFIKQ.E YCL028W 1 1 4.0% 405 42580 6.6 U RNQ1 SGDID:S000000533, Chr III from 70150-71367, Verified ORF, "[PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate" * 122805-Holinger-04_itms_6.05088.05088.2 2.565 0.0379 90.9 1649.7936 1650.705 6182.8 7 3.786 46.7 1 M.THSSNKGSSNRGFDVG.T YOR315W 1 1 4.0% 346 39021 8.1 U SFG1 SGDID:S000005842, Chr XV from 904755-905795, Verified ORF, "Nuclear protein, putative transcription factor required for growth of superficial pseudohyphae (which do not invade the agar substrate) but not for invasive pseudohyphal growth; may act together with Phd1p; potential Cdc28p substrate" * 122805-Holinger-05_itms_16.11681.11681.2 1.5048 0.061 90.4 1569.9098 1569.7081 6633.5 275 3.749 38.5 1 V.EKIDSLDPFGVDSF.V YNL007C 1 1 4.0% 352 37590 9.0 U SIS1 SGDID:S000004952, Chr XIV from 619567-618509, reverse complement, Verified ORF, "Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; not functionally redundant with Ydj1p due to due to substrate specificity; shares similarity with bacterial DnaJ proteins" * 122805-Holinger-04_itms_16.10827.10827.2 2.4336 0.2013 97.4 1531.3846 1530.8046 6719.3 33 4.302 46.2 1 Q.VNLPVSLEDLFVGK.K YOR007C 1 1 4.0% 346 37218 4.8 U SGT2 SGDID:S000005533, Chr XV from 339978-338938, reverse complement, Verified ORF, "Glutamine-rich cytoplasmic protein of unknown function, contains tetratricopeptide (TPR) repeats, which often mediate protein-protein interactions; conserved in human and C. elegans" * 122805-Holinger-05_itms_6.05712.05712.2 1.8115 0.1645 93.3 1338.6664 1341.5682 3237.1 136 3.926 46.2 1 S.LLGGGLGGLMNNPQ.L Reverse_YNL284C 1 1 4.0% 322 36347 10.4 U MRPL10 SGDID:S000005228, Chr XIV from 104102-103134, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit; appears as two protein spots (YmL10 and YmL18) on two-dimensional SDS gels" * 122805-Holinger-04_itms_6.05488.05488.2 2.6434 0.1651 91.1 1539.771 1541.7466 3784.7 1 3.79 58.3 1 L.KYIPTQGGEFWSK.V YKL120W 1 1 4.0% 324 35153 9.6 U OAC1 SGDID:S000001603, Chr XI from 216988-217962, Verified ORF, "Mitochondrial inner membrane transporter, transports oxaloacetate, sulfate, and thiosulfate; member of the mitochondrial carrier family" * 122805-Holinger-05_itms_11.08710.08710.2 2.1392 0.1447 90.9 1495.9473 1496.8339 6801.4 128 3.784 45.8 1 A.VTVTNPIELIKIR.M YDR087C 1 1 4.0% 278 33203 5.3 U RRP1 SGDID:S000002494, Chr IV from 618301-617465, reverse complement, Verified ORF, "Essential evolutionarily conserved nucleolar protein necessary for biogenesis of 60S ribosomal subunits and processing of pre-rRNAs to mature rRNAs, associated with several distinct 66S pre-ribosomal particles" * 122805-Holinger-04_itms_14.09904.09904.2 2.4203 0.1715 99.0 1190.7385 1191.4563 6325.5 10 4.622 70.0 1 Y.TGIPIHIVDIL.L YDR186C 2 2 3.9% 877 98331 5.4 U YDR186C SGDID:S000002594, Chr IV from 835487-832854, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_9.07272.07272.2 3.0366 0.1986 97.0 1744.8099 1744.9884 4515.6 1 4.222 56.7 1 F.LNSPIPQHTQQASPLL.M * 122805-Holinger-05_itms_18.12687.12687.2 1.5988 0.1366 90.2 1895.0984 1895.0283 8072.3 75 3.739 32.4 1 Y.GEDDMDNMGGWVLGGNAR.- Reverse_YML115C 1 1 3.9% 535 61092 5.4 U VAN1 SGDID:S000004583, Chr XIII from 41794-40187, reverse complement, Verified ORF, "Component of the mannan polymerase I; forms a complex with Mnn9p, which is involved in in mannan synthesis; mutants are vanadate-resistant" * 122805-Holinger-03_itms_13.09116.09116.2 3.1913 0.1634 96.8 2309.18 2310.823 6130.4 44 4.195 35.0 1 L.YLSLVAIIILSTISVTLQFKS.P Reverse_YBR029C 1 1 3.9% 457 51823 8.6 U CDS1 SGDID:S000000233, Chr II from 297742-296369, reverse complement, Verified ORF, "Phosphatidate cytidylyltransferase (CDP-diglyceride synthetase); an enzyme that catalyzes that conversion of CTP + phosphate into diphosphate + CDP-diaclglyerol, a critical step in the synthesis of all major yeast phospholipids" * 122805-Holinger-04_itms_8.06299.06299.3 3.8866 0.1079 93.5 2189.963 2186.6865 5804.4 103 4.024 35.3 1 G.KKSLFRILIDILEIIQKD.N YOR279C 1 1 3.9% 310 35195 9.1 U RFM1 SGDID:S000005805, Chr XV from 844627-843695, reverse complement, Verified ORF, "DNA-binding protein required for vegetative repression of middle sporulation genes; specificity factor that directs the Hst1p histone deacetylase to some of the promoters regulated by Sum1p" * 122805-Holinger-06_itms_7.07504.07504.2 1.4056 0.1819 91.9 1285.399 1286.3843 4190.9 3 3.839 50.0 1 Q.EVGEPIPRNTSS.S YLR222C 2 3 3.8% 817 91032 5.4 U UTP13 SGDID:S000004212, Chr XII from 581773-579320, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-03_itms_15.09927.09927.2 4.3837 0.2525 99.4 1924.0764 1925.1895 7460.9 4 4.977 47.1 2 L.ATPVLDEINIIDLTPGSR.K * 122805-Holinger-05_itms_8.07009.07009.2 2.3754 0.1475 94.8 1481.8395 1482.7227 6720.4 1 4.02 58.3 1 C.GFLKDGDGKRIIY.T YOR204W 3 3 3.8% 604 65553 7.8 U DED1 SGDID:S000005730, Chr XV from 722911-724725, Verified ORF, "ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase, required for translation initiation of all yeast mRNAs; mutations in human DEAD-box DBY are a frequent cause of male infertility" * 122805-Holinger-02_itms_10.07664.07664.2 2.4786 0.2349 99.4 1231.6416 1232.3757 6087.1 1 4.909 65.0 1 S.GKDVPEPITEF.T * 122805-Holinger-02_itms_12.08932.08932.1 1.975 0.1654 93.9 1046.5239 1047.1498 3532.6 1 4.914 75.0 1 K.DVPEPITEF.T * 122805-Holinger-04_itms_8.06210.06210.2 2.9429 0.1549 98.7 1326.6432 1326.3707 4760.5 86 4.504 63.6 1 R.SRDNSFRGGSGW.G YBL039C 2 3 3.8% 579 64710 6.0 U URA7 SGDID:S000000135, Chr II from 145731-143992, reverse complement, Verified ORF, "Major CTP synthase isozyme (see also URA8), catalyzes the ATP-dependent transfer of the amide nitrogen from glutamine to UTP, forming CTP, the final step in de novo biosynthesis of pyrimidines; involved in phospholipid biosynthesis" * 122805-Holinger-05_itms_4.04270.04270.2 2.3384 0.2056 99.3 1227.6895 1228.391 5050.6 2 4.725 65.0 1 T.LTKDHNITTGK.I * 122805-Holinger-03_itms_15.10039.10039.2 2.8728 0.1996 98.4 1185.7112 1186.4368 5180.2 1 4.416 80.0 2 K.VLDPSKPFLGL.V Reverse_YER086W 1 1 3.8% 576 63831 8.5 U ILV1 SGDID:S000000888, Chr V from 328473-330203, Verified ORF, "Threonine deaminase, catalyzes the first step in isoleucine biosynthesis; expression is under general amino acid control; ILV1 locus exhibits highly positioned nucleosomes whose organization is independent of known ILV1 regulation" * 122805-Holinger-05_itms_15.10894.10894.2 1.4182 0.2267 94.0 2428.7122 2425.851 9537.3 1 3.955 31.0 1 Q.RLIEMAVTGQGAIVYPHDFPPI.N YLR058C 2 2 3.8% 469 52219 7.4 U SHM2 SGDID:S000004048, Chr XII from 259402-257993, reverse complement, Verified ORF, "Cytosolic serine hydroxymethyltransferase, involved in one-carbon metabolism" * 122805-Holinger-05_itms_12.09123.09123.2 1.63 0.1224 92.2 1004.505 1005.1589 7455.3 4 3.857 68.8 1 A.LKQAATPEF.K * 122805-Holinger-03_itms_21.13482.13482.2 1.2547 0.2417 98.6 950.62213 947.99524 3323.7 199 4.487 56.2 1 L.VSNGTDSHM.V Reverse_YOR197W 1 1 3.8% 453 50648 6.0 U MCA1 SGDID:S000005723, Chr XV from 717023-718384, Verified ORF, "Putative cysteine protease similar to mammalian caspases, involved in regulation of apoptosis upon hydrogen peroxide treatment" * 122805-Holinger-04_itms_5.04437.04437.3 2.5171 0.0771 92.0 1762.9912 1763.8762 4693.9 24 3.927 35.9 1 K.IFAHSMAGTNQGDEVAD.A YDR113C 1 1 3.8% 373 41838 5.0 U PDS1 SGDID:S000002520, Chr IV from 681612-680491, reverse complement, Verified ORF, "Securin that inhibits anaphase by binding separin Esp1p, also blocks cyclin destruction and mitotic exit, essential for cell cycle arrest in mitosis in the presence of DNA damage or aberrant mitotic spindles; also present in meiotic nuclei" * 122805-Holinger-04_itms_16.11196.11196.2 2.2252 0.0697 91.8 1641.0675 1638.679 6699.6 31 3.834 46.2 1 V.YSEEGLDPEELEDL.V YGR240C 3 3 3.7% 987 107970 6.4 U PFK1 SGDID:S000003472, Chr VII from 973739-970776, reverse complement, Verified ORF, "Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" * 122805-Holinger-04_itms_10.07357.07357.3 2.8881 0.2157 99.5 1330.7986 1331.598 5817.9 1 4.559 50.0 1 T.DLNKIVEKFPK.Q * 122805-Holinger-03_itms_12.08274.08274.2 2.6417 0.0201 94.6 1456.7837 1457.672 6557.3 1 4.008 68.2 1 A.DYIFIPERAVPH.G * 122805-Holinger-02_itms_16.11086.11086.1 2.7985 0.2195 96.9 1513.8441 1514.7588 6000.1 3 5.06 50.0 1 L.EFTPETPSPLIGIL.E YOR335C 3 3 3.7% 958 107277 5.5 U ALA1 SGDID:S000005862, Chr XV from 949104-946228, reverse complement, Verified ORF, "Cytoplasmic alanyl-tRNA synthetase, required for protein synthesis; point mutation (cdc64-1 allele) causes cell cycle arrest at G1; lethality of null mutation is functionally complemented by human homolog" * 122805-Holinger-04_itms_8.06304.06304.2 2.42 0.1673 96.1 1571.8455 1572.7611 6078.1 5 4.152 53.8 1 Q.FNREQDGSLKPLPA.K * 122805-Holinger-03_itms_14.09202.09202.2 2.7708 0.1147 97.9 1021.5901 1022.2322 5577.1 7 4.357 81.2 1 E.LAKDPAFLF.E * 122805-Holinger-05_itms_6.05609.05609.2 2.3854 0.292 99.0 1425.7642 1426.6122 7949.2 28 4.621 59.1 1 A.KVPKTNDEFKYG.S YIL108W 2 2 3.7% 696 77414 7.5 U YIL108W SGDID:S000001370, Chr IX from 160884-162974, Uncharacterized ORF, "Putative metalloprotease" * 122805-Holinger-02_itms_10.07672.07672.2 2.7812 0.1417 93.4 1219.68 1221.3989 5562.3 1 3.932 88.9 1 G.SKDIDLFNLR.E * 122805-Holinger-02_itms_14.10116.10116.2 2.573 0.1579 96.5 1793.9258 1794.9989 7505.6 50 4.175 43.3 1 L.SVNAPETEFDKFPSLL.D YJR121W 1 1 3.7% 511 54794 5.7 U ATP2 SGDID:S000003882, Chr X from 647522-649057, Verified ORF, "Beta subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" * 122805-Holinger-05_itms_11.08597.08597.3 3.2627 0.316 100.0 1937.1227 1938.2345 5474.2 29 6.008 31.9 1 L.DTGGPISVPVGRETLGRII.N YPL139C 2 2 3.7% 460 51022 5.3 U UME1 SGDID:S000006060, Chr XVI from 291050-289668, reverse complement, Verified ORF, "Negative regulator of meiosis, required for repression of a subset of meiotic genes during vegetative growth, binding of histone deacetylase Rpd3p required for activity, contains a NEE box and a WD repeat motif; homologous with Wtm1p, Wtm2p" * 122805-Holinger-04_itms_5.04992.04992.2 2.472 0.1308 95.5 1206.6624 1207.4148 4432.4 1 4.085 87.5 1 K.IKNEEFKIW.K * 122805-Holinger-05_itms_6.05497.05497.2 1.7803 0.0242 94.2 893.55884 895.0898 4456.6 142 3.963 71.4 1 Q.HISSLKPI.F Reverse_YBR287W 1 1 3.7% 427 47506 4.9 U YBR287W SGDID:S000000491, Chr II from 776567-777850, Uncharacterized ORF, "Protein of unknown function; mutation results in a zinc sensitive phenotype" * 122805-Holinger-03_itms_16.10476.10476.2 2.8589 0.1637 91.0 1934.9445 1934.1304 10934.7 1 3.787 53.3 1 A.EAFTNNIFGDEMFLER.Q YOL022C 1 1 3.7% 408 45994 4.9 U YOL022C SGDID:S000005382, Chr XV from 281498-280272, reverse complement, Uncharacterized ORF, "Protein required for cell viability" * 122805-Holinger-04_itms_16.11173.11173.2 2.3005 0.1953 98.5 1531.3945 1528.5438 6084.9 27 4.432 42.9 1 K.CNAFSSNPFGGANAN.P YKR092C 1 1 3.7% 406 41015 4.3 U SRP40 SGDID:S000001800, Chr XI from 613527-612307, reverse complement, Verified ORF, "Nucleolar, serine-rich protein with a role in preribosome assembly or transport; may function as a chaperone of small nucleolar ribonucleoprotein particles (snoRNPs); immunologically and structurally to rat Nopp140" * 122805-Holinger-03_itms_7.05237.05237.2 2.8302 0.3005 99.7 1655.8995 1656.8363 4035.6 1 5.171 67.9 1 L.NIPAGTDEIKEGQRK.H Reverse_YHR143W 1 1 3.7% 325 33417 4.5 U DSE2 SGDID:S000001186, Chr VIII from 385513-386490, Verified ORF, "Daughter cell-specific secreted protein with similarity to glucanases, degrades cell wall from the daughter side causing daughter to separate from mother; expression is repressed by cAMP" * 122805-Holinger-03_itms_5.04184.04184.2 1.3046 0.1045 90.2 1254.6196 1257.3582 2794.1 238 3.739 45.5 1 P.MSTTARSTTDVS.S Reverse_YGR280C 1 1 3.7% 271 31312 9.9 U PXR1 SGDID:S000003512, Chr VII from 1051731-1050916, reverse complement, Verified ORF, "Essential protein involved in rRNA and snoRNA maturation; competes with TLC1 RNA for binding to Est2p, suggesting a role in regulation of telomerase; human homolog inhibits telomerase; contains a G-patch RNA interacting domain" * 122805-Holinger-03_itms_10.07462.07462.2 1.7924 0.1262 90.6 1012.61957 1015.1979 6146.9 4 3.774 72.2 1 R.KLKAGLGVND.D YHR128W 1 1 3.7% 216 24594 5.7 U FUR1 SGDID:S000001170, Chr VIII from 362118-362768, Verified ORF, "Uracil phosphoribosyltransferase, synthesizes UMP from uracil; involved in the pyrimidine salvage pathway" * 122805-Holinger-04_itms_7.05786.05786.2 2.0917 0.1861 99.2 926.50037 927.05066 4354.4 2 4.676 71.4 1 Y.HAAFPEVR.I YPL106C 3 3 3.6% 693 77367 5.2 U SSE1 SGDID:S000006027, Chr XVI from 352272-350191, reverse complement, Verified ORF, "ATPase that is a component of the heat shock protein Hsp90 chaperone complex; binds unfolded proteins; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm" 122805-Holinger-04_itms_10.07391.07391.2 2.3522 0.2437 99.3 867.5571 868.06714 3651.5 61 4.696 71.4 1 A.GLNPVRIV.N 122805-Holinger-04_itms_9.06844.06844.2 2.1832 0.2625 99.9 981.6004 982.17096 4640.3 6 5.488 62.5 1 A.GLNPVRIVN.D * 122805-Holinger-03_itms_10.07204.07204.2 3.6995 0.292 100.0 1693.9812 1694.9689 5152.9 1 6.175 60.0 1 T.GVQLPEGQDSVPVKLK.L YJL105W 1 1 3.6% 560 63856 8.7 U SET4 SGDID:S000003641, Chr X from 224972-226654, Verified ORF, "Protein of unknown function, contains a SET domain" * 122805-Holinger-03_itms_20.12657.12657.3 2.6683 0.1774 94.5 2031.6908 2028.1489 3002.8 105 4.054 27.6 1 F.NHHSSSGSSKTASTNKRGIA.A YKL081W 2 3 3.6% 412 46520 7.8 U TEF4 SGDID:S000001564, Chr XI from 282535-282739,283066-284099, Verified ORF, "Translation elongation factor EF-1 gamma" * 122805-Holinger-05_itms_9.07214.07214.2 3.5943 0.2635 100.0 1556.9332 1557.8735 7872.9 1 6.202 64.3 1 T.VAASPIVKTPFAEVK.L * 122805-Holinger-05_itms_8.07059.07059.2 3.3104 0.336 100.0 1457.8605 1458.741 6102.0 1 6.674 65.4 2 V.AASPIVKTPFAEVK.L YCR095C 1 1 3.6% 362 41647 8.5 U YCR095C SGDID:S000000691, Chr III from 289254-288166, reverse complement, Uncharacterized ORF, "Cytoplasmic protein required for replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts" * 122805-Holinger-04_itms_16.11155.11155.2 2.5229 0.1024 92.8 1504.9679 1503.6525 8140.4 1 3.903 62.5 1 E.QEKDNKTIVDNKA.K YBR221C 1 1 3.6% 366 40054 5.3 U PDB1 SGDID:S000000425, Chr II from 666248-665148, reverse complement, Verified ORF, "E1 beta subunit of the pyruvate dehydrogenase (PDH) complex, which is an evolutionarily-conserved multi-protein complex found in mitochondria" * 122805-Holinger-05_itms_12.09210.09210.2 2.1064 0.1938 98.8 1405.8358 1406.708 6662.1 4 4.539 58.3 1 W.YGSIPGLKVLVPY.S Reverse_YFR025C 1 1 3.6% 335 38582 5.9 U HIS2 SGDID:S000001921, Chr VI from 204738-203731, reverse complement, Verified ORF, "Histidinolphosphatase, catalyzes the eighth step in histidine biosynthesis; mutations cause histidine auxotrophy and sensitivity to Cu, Co, and Ni salts; transcription is regulated by general amino acid control" * 122805-Holinger-02_itms_4.03850.03850.2 2.4124 0.0536 92.7 1343.6812 1341.5907 5640.8 2 3.877 63.6 1 E.LKTIVEEPNKGL.S Reverse_YJL213W 1 1 3.6% 331 35905 7.0 U YJL213W SGDID:S000003749, Chr X from 32163-33158, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_19.12036.12036.2 2.247 0.0662 94.2 1276.3542 1275.4625 4725.0 172 3.968 50.0 1 K.IQGLKDGLGNME.A Reverse_YDR123C 1 1 3.6% 304 34234 6.2 U INO2 SGDID:S000002530, Chr IV from 699463-698549, reverse complement, Verified ORF, "Component of the heteromeric Ino2p/Ino4p basic helix-loop-helix transcription activator that binds inositol/choline-responsive elements (ICREs), required for derepression of phospholipid biosynthetic genes in response to inositol depletion" * 122805-Holinger-04_itms_10.07682.07682.2 1.994 0.0667 91.7 1124.6664 1126.3385 8373.2 14 3.817 60.0 1 Q.VTAVNPIIGLE.H Reverse_YER116C 1 1 3.6% 274 30764 4.8 U SLX8 SGDID:S000000918, Chr V from 396168-395344, reverse complement, Verified ORF, "Protein containing a RING finger domain that forms a complex with Hex3p; mutant phenotypes and genetic interactions suggest a possible role in resolving recombination intermediates during DNA replication or repair" * 122805-Holinger-05_itms_14.10051.10051.2 1.77 0.0392 91.9 1168.7621 1170.1808 5811.1 6 3.837 61.1 1 A.EPSDHRNDTV.I YDR050C 1 1 3.6% 248 26795 6.0 U TPI1 SGDID:S000002457, Chr IV from 556469-555723, reverse complement, Verified ORF, "Triose phosphate isomerase, abundant glycolytic enzyme; mRNA half-life is regulated by iron availability; transcription is controlled by activators Reb1p, Gcr1p, and Rap1p through binding sites in the 5' non-coding region" * 122805-Holinger-03_itms_13.08706.08706.2 2.47 0.1521 94.6 1086.6711 1087.3048 4894.2 10 3.992 87.5 1 Q.SIKEIVERL.N YGL013C 1 1 3.5% 1068 121793 6.9 U PDR1 SGDID:S000002981, Chr VII from 472303-469097, reverse complement, Verified ORF, "Zinc cluster protein that is a master regulator involved in recruiting other zinc cluster proteins to pleiotropic drug response elements (PDREs) to fine tune the regulation of multidrug resistance genes" * 122805-Holinger-04_itms_18.12215.12215.3 1.8041 0.1969 92.6 4250.6104 4254.8574 10855.6 95 3.955 15.3 1 T.EMKYDAIKEQTGKLFDIAFSKDSTELKVSREDKIMAS.K Reverse_YML031W 2 2 3.5% 655 74134 8.3 U NDC1 SGDID:S000004493, Chr XIII from 214189-216156, Verified ORF, "Nuclear envelope protein with multiple putative transmembrane domains, required for nuclear pore complex assembly and spindle pole body duplication; required for meiosis II" * 122805-Holinger-05_itms_6.05784.05784.2 2.4778 0.1399 92.8 1269.6454 1271.5431 5477.3 114 3.881 50.0 1 T.KLIDGVSAIIGGK.P * 122805-Holinger-02_itms_14.10113.10113.2 2.405 0.1434 95.9 1205.6239 1206.4773 7180.9 8 4.123 72.2 1 I.FIICSIILLN.T YMR278W 1 1 3.5% 622 71069 6.3 U YMR278W SGDID:S000004891, Chr XIII from 822762-824630, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-06_itms_12.10156.10156.3 2.1274 0.0728 93.0 2316.6536 2316.616 6720.2 170 3.98 26.2 1 P.SFPTVGFPNPEEKGALDIGINL.A YJL008C 1 1 3.5% 568 61662 5.7 U CCT8 SGDID:S000003545, Chr X from 421578-419872, reverse complement, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" * 122805-Holinger-05_itms_11.08841.08841.2 4.6046 0.3158 100.0 2017.1392 2018.3177 4397.5 1 6.529 57.9 1 C.GATPLPRLGAPTPEELGLVE.T Reverse_YOR231W 1 1 3.5% 508 56720 8.3 U MKK1 SGDID:S000005757, Chr XV from 772601-774127, Verified ORF, "Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p" * 122805-Holinger-03_itms_19.12084.12084.2 1.2474 0.0019 97.3 2161.091 2158.4624 2035.3 117 4.284 29.4 1 S.TLYINNEDVQNNRLLPLK.L YLR378C 3 3 3.5% 480 52937 9.4 U SEC61 SGDID:S000004370, Chr XII from 877177-875735, reverse complement, Verified ORF, "Essential subunit of Sec61 complex (Sec61p, Sbh1p, and Sss1p); forms a channel for SRP-dependent protein import and retrograde transport of misfolded proteins out of the ER; with Sec63 complex allows SRP-independent protein import into ER" * 122805-Holinger-03_itms_15.10151.10151.2 2.9634 0.0428 97.5 980.591 979.20715 4591.8 2 4.311 85.7 1 R.VLDLFKPF.E * 122805-Holinger-04_itms_13.08993.08993.2 2.4247 0.136 98.7 916.60504 917.1796 6955.8 2 4.528 85.7 1 Q.IGIYPIKL.F * 122805-Holinger-05_itms_13.09707.09707.2 2.7329 0.2604 100.0 1063.676 1064.3562 6120.5 2 5.7 81.2 1 Q.IGIYPIKLF.Y YCL048W 1 1 3.5% 463 52008 6.3 U SPS22 SGDID:S000000553, Chr III from 42165-43556, Verified ORF, "Protein of unknown function, redundant with Sps2p for the organization of the beta-glucan layer of the spore wall" * 122805-Holinger-03_itms_10.07380.07380.2 2.1466 0.0767 95.9 1683.8702 1682.9608 6194.6 65 4.122 43.3 1 L.NLNNLQKIGGTLGIIN.N Reverse_YOR266W 1 1 3.5% 423 48934 9.5 U PNT1 SGDID:S000005792, Chr XV from 821020-822291, Verified ORF, "Mitochondrial inner membrane protein involved in export of proteins from the mitochondrial matrix; overexpression of PNT1 confers resistance to the anti-Pneumocystis carinii drug pentamidine, and deletion confers increased sensitivity" * 122805-Holinger-04_itms_21.13565.13565.2 2.0991 0.1441 91.4 1708.5413 1705.9108 6449.6 50 3.806 42.9 1 V.GWKESFTHKGNLSIT.D Reverse_YOR009W 1 3 3.5% 487 47849 4.1 U TIR4 SGDID:S000005535, Chr XV from 344334-345797, Verified ORF, "Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins; expressed under anaerobic conditions and required for anaerobic growth; transcription is also induced by cold shock" 122805-Holinger-05_itms_20.13638.13638.2 2.0881 0.1885 96.4 1599.2424 1599.6459 4688.0 189 4.172 34.4 3 S.AVESSSSAVSSSVVESS.S Reverse_YGL196W 1 1 3.5% 428 47828 7.6 U YGL196W SGDID:S000003164, Chr VII from 129888-131174, Uncharacterized ORF, "Putative protein of unknown function; deletion mutant is viable and has no detectable phenotype" * 122805-Holinger-05_itms_21.14602.14602.2 2.1591 0.0037 93.1 1580.1263 1582.5803 6850.7 235 3.913 35.7 1 L.NQTDNISTSSYSHGA.H YKL181W 1 1 3.5% 427 47048 5.7 U PRS1 SGDID:S000001664, Chr XI from 107321-108604, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, involved in nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes" * 122805-Holinger-03_itms_12.08524.08524.2 3.0301 0.2233 99.4 1600.8031 1599.7832 9618.5 1 4.87 57.1 1 Q.GFFTKPVDNLYGGPS.L YHR052W 1 1 3.5% 376 42530 8.8 U CIC1 SGDID:S000001094, Chr VIII from 210842-211972, Verified ORF, "Essential protein that interacts with proteasome components and has a potential role in proteasome substrate specificity; also copurifies with 66S pre-ribosomal particles" * 122805-Holinger-03_itms_12.08070.08070.2 2.5512 0.0809 95.5 1590.9312 1589.7368 7968.9 16 4.093 62.5 1 N.LLEDDEEELKKDL.Q Reverse_YGL040C 1 1 3.5% 342 37740 6.1 U HEM2 SGDID:S000003008, Chr VII from 420561-419533, reverse complement, Verified ORF, "Delta-aminolevulinate dehydratase, a homo-octameric enzyme, catalyzes the conversion of delta-aminolevulinic acid to porphobilinogen, the second step in the heme biosynthetic pathway; localizes to both the cytoplasm and nucleus" * 122805-Holinger-04_itms_9.06761.06761.2 2.2706 0.0947 90.2 1105.5938 1106.267 6546.1 85 3.74 54.5 1 H.AGAKAYNVAVAA.L Reverse_YKL019W 1 1 3.5% 316 37508 5.1 U RAM2 SGDID:S000001502, Chr XI from 402211-403161, Verified ORF, "Alpha subunit of both the farnesyltransferase and type I geranylgeranyltransferase that catalyze prenylation of proteins containing a CAAX consensus motif; essential protein required for membrane localization of Ras proteins and a-factor" * 122805-Holinger-05_itms_16.11401.11401.2 1.9673 0.2179 99.1 1128.1863 1127.2799 5158.9 365 4.661 50.0 1 D.EPSGIPLSLVD.G YMR206W 1 1 3.5% 313 35018 8.8 U YMR206W SGDID:S000004819, Chr XIII from 675895-676836, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_5.04989.04989.2 2.2276 0.1449 94.2 1141.6154 1143.2015 3396.3 24 3.964 65.0 1 L.SSSSNRPISAH.L YBL030C 1 1 3.5% 318 34426 9.8 U PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene" * 122805-Holinger-05_itms_6.05686.05686.2 2.4257 0.2411 99.4 1303.6915 1304.4882 4809.6 77 4.935 55.0 1 M.FGFKKEEGYAK.W YOR036W 1 1 3.5% 288 33006 4.9 U PEP12 SGDID:S000005562, Chr XV from 400347-401213, Verified ORF, "Target membrane receptor (t-SNARE) for vesicular intermediates traveling between the Golgi apparatus and the vacuole; controls entry of biosynthetic, endocytic, and retrograde traffic into the prevacuolar compartment; syntaxin" * 122805-Holinger-03_itms_10.07300.07300.2 1.7971 0.1576 91.2 1179.6926 1177.3641 6085.0 134 3.792 55.6 1 L.ASDELRKAMR.Y YJR077C 3 3 3.5% 311 32812 9.3 U MIR1 SGDID:S000003838, Chr X from 578104-577169, reverse complement, Verified ORF, "Mitochondrial phosphate carrier, imports inorganic phosphate into mitochondria; functionally redundant with Pic2p but more abundant than Pic2 under normal conditions" * 122805-Holinger-04_itms_14.09680.09680.2 2.7523 0.2747 99.3 1319.7288 1320.5737 5838.7 1 4.783 75.0 1 S.FYSGFTPILFK.Q * 122805-Holinger-03_itms_14.09266.09266.2 2.9444 0.3445 100.0 1172.6559 1173.3971 5967.0 1 7.268 83.3 1 F.YSGFTPILFK.Q * 122805-Holinger-04_itms_12.08770.08770.2 2.3027 0.2217 99.8 1009.58997 1010.2212 4141.1 3 5.213 75.0 1 Y.SGFTPILFK.Q Reverse_YEL005C 1 1 3.5% 282 31365 6.2 U VAB2 SGDID:S000000731, Chr V from 146754-145906, reverse complement, Verified ORF, "Protein with a potential role in vacuolar function, as suggested by its ability to bind Vac8p; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-04_itms_16.11231.11231.2 1.5711 0.1146 91.2 1052.8883 1052.1722 3886.9 4 3.793 66.7 1 E.ISPGSTTNFK.P YEL051W 1 1 3.5% 256 29194 5.9 U VMA8 SGDID:S000000777, Chr V from 58378-59148, Verified ORF, "Subunit D of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; plays a role in the coupling of proton transport and ATP hydrolysis" * 122805-Holinger-05_itms_7.06312.06312.2 2.7963 0.1517 98.7 1047.6495 1048.2736 6708.1 3 4.493 81.2 1 N.AIEHVIIPR.T YOR142W-B 3 3 3.4% 1755 198535 8.5 U YOR142W-B SGDID:S000007352, Chr XV from 595112-596416,596418-600380, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-05_itms_11.08573.08573.2 2.6805 0.229 98.5 1700.954 1701.9603 5487.2 63 4.437 42.9 1 N.GKPVRPITDDELTFL.Y 122805-Holinger-04_itms_8.06586.06586.2 3.7131 0.2921 100.0 1837.9965 1839.0557 5923.1 1 6.505 62.5 1 N.SSHNIVPIKTPTTVSEQ.N 122805-Holinger-05_itms_14.10111.10111.3 3.1329 0.1026 96.3 3158.6765 3159.5627 5166.6 5 4.133 25.0 1 A.DLPLPDLPPESPTEFPDPFKELPPINSR.Q YOR361C 2 2 3.4% 763 88130 6.0 U PRT1 SGDID:S000005888, Chr XV from 1017648-1015357, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" * 122805-Holinger-03_itms_15.10266.10266.2 3.7327 0.2856 100.0 2091.0413 2092.261 4505.8 1 5.77 52.9 1 F.EDIKLEDIPVDDIDFSDL.E * 122805-Holinger-05_itms_12.08943.08943.2 1.8524 0.0111 94.4 1004.5009 1004.2169 8320.5 432 3.98 64.3 1 K.SPYLKWPL.V YLL018C 2 3 3.4% 557 63516 6.6 U DPS1 SGDID:S000003941, Chr XII from 111574-109901, reverse complement, Verified ORF, "Cytoplasmic aspartyl-tRNA synthetase, homodimeric enzyme that catalyzes the specific aspartylation of tRNA(Asp); class II aminoacyl tRNA synthetase; binding to its own mRNA may confer autoregulation" * 122805-Holinger-04_itms_8.06685.06685.2 1.902 0.2038 98.7 1195.6309 1196.3483 6159.3 2 4.529 68.8 1 V.RKQYPVEEF.K * 122805-Holinger-04_itms_13.08988.08988.2 2.6911 0.1563 96.2 1261.7173 1262.4943 4030.0 3 4.156 72.2 2 L.DKFPLEIRPF.Y YGL176C 1 1 3.4% 554 63276 8.4 U YGL176C SGDID:S000003144, Chr VII from 173085-171421, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; deletion mutant is viable and has no detectable phenotype" * 122805-Holinger-03_itms_18.11572.11572.3 2.478 0.0552 94.6 2165.5417 2169.358 5284.7 16 4.085 30.6 1 G.RYFIYGSTSARDGKGDFEV.F YBR006W 1 1 3.4% 497 54189 6.6 U UGA2 SGDID:S000000210, Chr II from 247012-248505, Verified ORF, "Succinate semialdehyde dehydrogenase involved in the utilization of gamma-aminobutyrate (GABA) as a nitrogen source; part of the 4-aminobutyrate and glutamate degradation pathways; localized to the cytoplasm" * 122805-Holinger-04_itms_12.08549.08549.2 2.5065 0.1085 90.7 1800.9598 1801.9723 3906.3 43 3.776 46.9 1 T.VSEALETGMVSCNTGVF.S YNL280C 1 1 3.4% 438 50616 8.8 U ERG24 SGDID:S000005224, Chr XIV from 110411-109095, reverse complement, Verified ORF, "C-14 sterol reductase, acts in ergosterol biosynthesis; mutants accumulate the abnormal sterol ignosterol (ergosta-8,14 dienol), and are viable under anaerobic growth conditions but inviable on rich medium under aerobic conditions" * 122805-Holinger-03_itms_6.04967.04967.2 2.8404 0.1921 98.1 1606.6809 1608.8345 5921.4 370 4.383 42.9 1 N.PRTTEFEFGGLIGAL.G Reverse_YPR106W 1 1 3.4% 443 49736 6.9 U ISR1 SGDID:S000006310, Chr XVI from 740059-741390, Verified ORF, "Predicted protein kinase, overexpression causes sensitivity to staurosporine, which is a potent inhibitor of protein kinase C" * 122805-Holinger-01_itms_13.09622.09622.2 2.3008 0.1986 94.9 1753.0986 1753.0952 5505.9 6 4.032 39.3 1 I.TILNELPLRDVLIRS.L YJL125C 1 1 3.4% 383 43920 7.6 U GCD14 SGDID:S000003661, Chr X from 186598-185447, reverse complement, Verified ORF, "Subunit of tRNA (1-methyladenosine) methyltransferase, with Gcd10p, required for the modification of the adenine at position 58 in tRNAs, especially tRNAi-Met; first identified as a negative regulator of GCN4 expression" * 122805-Holinger-04_itms_15.10482.10482.2 2.6377 0.0434 97.4 1492.7972 1492.7172 6015.3 20 4.3 54.2 1 V.FLDLPAPWDAIPH.L YGL209W 1 1 3.4% 382 42048 9.7 U MIG2 SGDID:S000003177, Chr VII from 95862-97010, Verified ORF, "Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter" * 122805-Holinger-04_itms_10.07555.07555.2 2.7157 0.0518 98.1 1455.7964 1456.6134 5298.7 421 4.384 45.8 1 N.SDVSSIFSNMNVR.V Reverse_YKR092C 1 1 3.4% 406 41015 4.3 U SRP40 SGDID:S000001800, Chr XI from 613527-612307, reverse complement, Verified ORF, "Nucleolar, serine-rich protein with a role in preribosome assembly or transport; may function as a chaperone of small nucleolar ribonucleoprotein particles (snoRNPs); immunologically and structurally to rat Nopp140" * 122805-Holinger-04_itms_10.07576.07576.3 2.1081 0.0995 97.4 1465.8887 1467.5731 4652.1 51 4.273 34.6 1 E.SSSSSEPETKAKKT.E YOR340C 1 1 3.4% 326 36224 4.9 U RPA43 SGDID:S000005867, Chr XV from 960177-959197, reverse complement, Verified ORF, "RNA polymerase I subunit A43" * 122805-Holinger-05_itms_7.06432.06432.2 2.0364 0.0939 93.6 1190.7114 1191.416 5592.6 152 3.941 55.0 1 M.KYNNKVGGVVL.G Reverse_YBR265W 1 1 3.4% 320 35987 6.3 U TSC10 SGDID:S000000469, Chr II from 738577-739539, Verified ORF, "3-ketosphinganine reductase, catalyzes the second step in phytosphingosine synthesis, essential for growth in the absence of exogenous dihydrosphingosine or phytosphingosine, member of short chain dehydrogenase/reductase protein family" * 122805-Holinger-02_itms_15.10268.10268.2 2.1169 0.0543 91.8 1151.7633 1150.437 5663.7 199 3.835 60.0 1 K.KATLGLDMGMI.M Reverse_YAR031W 1 1 3.4% 298 35073 8.0 U PRM9 SGDID:S000000078, Chr I from 186830-187726, Verified ORF, "Pheromone-regulated protein with 3 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; member of DUP240 gene family" Reverse_YGL053W 1 1 4.2% 237 27250 5.1 U PRM8 SGDID:S000003021, Chr VII from 402592-403305, Verified ORF, "Pheromone-regulated protein with 2 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; forms a complex with Prp9p in the ER; member of DUP240 gene family" 122805-Holinger-05_itms_9.07310.07310.2 2.1333 0.0366 90.9 1003.6109 1004.983 4678.1 87 3.783 61.1 1 A.AENPTGATED.N YOL077C 1 1 3.4% 291 33577 9.2 U BRX1 SGDID:S000005437, Chr XV from 186722-185847, reverse complement, Verified ORF, "Nucleolar protein, constituent of 66S pre-ribosomal particles; depletion leads to defects in rRNA processing and a block in the assembly of large ribosomal subunits; possesses a sigma(70)-like RNA-binding motif" * 122805-Holinger-03_itms_11.07692.07692.2 2.1869 0.1691 99.5 1230.7039 1231.4374 8467.6 5 5.116 77.8 1 F.SIVDDKIWVR.T YOR115C 1 1 3.4% 268 30749 6.4 U TRS33 SGDID:S000005641, Chr XV from 539465-538659, reverse complement, Verified ORF, "One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion; involved in endoplasmic reticulum (ER) to Golgi membrane traffic" * 122805-Holinger-03_itms_13.08823.08823.2 2.5809 0.1785 94.5 1009.65845 1010.2651 3799.6 263 3.988 75.0 1 F.LEIPVGIIR.G YKL104C 2 2 3.3% 717 80047 6.4 U GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis" * 122805-Holinger-02_itms_12.08920.08920.2 2.2236 0.1382 95.9 1350.6447 1351.4552 5652.5 169 4.12 60.0 1 L.FLEDDDLAHIY.D * 122805-Holinger-03_itms_12.08198.08198.2 3.5636 0.392 100.0 1486.8263 1487.6989 4410.8 1 6.694 70.8 1 A.VNKGIDVDFPRNL.A Reverse_YBR169C 1 1 3.3% 693 77621 5.6 U SSE2 SGDID:S000000373, Chr II from 575991-573910, reverse complement, Verified ORF, "Member of the heat shock protein 70 (HSP70) family; may be involved in protein folding; localized to the cytoplasm; highly homologous to the heat shock protein Sse1p" * 122805-Holinger-04_itms_21.13709.13709.2 1.4869 0.2278 92.5 2374.869 2377.6562 9012.8 166 3.87 27.3 1 E.EPGPLDNKFVGYSVAAATVDNVI.R YDR388W 1 1 3.3% 482 52774 6.0 U RVS167 SGDID:S000002796, Chr IV from 1250176-1251624, Verified ORF, "Actin-associated protein, subunit of a complex (Rvs161p-Rvs167p) involved in regulation of actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; homolog of mammalian amphiphysin" * 122805-Holinger-01_itms_12.09307.09307.2 1.9215 0.1143 91.8 1414.8616 1416.4869 4499.1 20 3.822 40.0 1 G.SPVSGASSGVGYGAGY.D YHL002W 1 1 3.3% 452 51161 6.4 U HSE1 SGDID:S000000994, Chr VIII from 102607-103965, Verified ORF, "Subunit of the endosomal Vps27p-Hse1p complex required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes" * 122805-Holinger-04_itms_15.10364.10364.2 2.9721 0.1504 93.0 1737.905 1737.8608 5012.8 3 3.91 50.0 1 V.RALYDLTTNEPDELS.F Reverse_YBR118W 1 1 3.3% 458 50033 9.0 U TEF2 SGDID:S000000322, Chr II from 477665-479041, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF1; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" Reverse_YPR080W 1 1 3.3% 458 50033 9.0 U TEF1 SGDID:S000006284, Chr XVI from 700592-701968, Verified ORF, "Translational elongation factor EF-1 alpha; also encoded by TEF2; functions in the binding reaction of aminoacyl-tRNA (AA-tRNA) to ribosomes" 122805-Holinger-04_itms_8.06201.06201.3 2.7094 0.0297 91.2 1730.027 1732.002 5463.9 52 3.923 35.7 1 E.ITRKDIGGCKYILHG.T Reverse_YPL112C 2 2 3.3% 394 44911 9.0 U PEX25 SGDID:S000006033, Chr XVI from 338619-337435, reverse complement, Verified ORF, "Peripheral peroxisomal membrane peroxin required for the regulation of peroxisome size and maintenance, recruits GTPase Rho1p to peroxisomes, induced by oleate, interacts with homologous protein Pex27p" * 122805-Holinger-02_itms_6.05368.05368.2 2.9655 0.0891 92.1 1313.6995 1314.4813 6906.5 1 3.847 80.0 1 A.NNQVKLQVELE.L * 122805-Holinger-03_itms_16.10347.10347.2 2.9963 0.0476 91.5 1554.8295 1555.7715 8687.6 8 3.808 54.2 1 A.NNQVKLQVELELQ.R YKL150W 1 1 3.3% 302 34138 8.7 U MCR1 SGDID:S000001633, Chr XI from 166549-167457, Verified ORF, "Mitochondrial NADH-cytochrome b5 reductase, involved in ergosterol biosynthesis" * 122805-Holinger-01_itms_23.15584.15584.2 1.2749 0.0413 91.7 911.60925 913.0617 2472.8 153 3.819 44.4 1 T.LLGAGTGINP.L Reverse_YEL038W 1 1 3.3% 241 26735 6.5 U UTR4 SGDID:S000000764, Chr V from 80420-81145, Verified ORF, "Protein of unknown function, found in both the cytoplasm and nucleus" * 122805-Holinger-04_itms_8.06633.06633.2 2.0545 0.095 91.5 966.5782 968.0574 5870.8 132 3.808 64.3 1 I.HAQLQEKN.D Reverse_YGR014W 2 2 3.2% 1306 133114 4.2 U MSB2 SGDID:S000003246, Chr VII from 516947-520867, Verified ORF, "Mucin family member at the head of the Cdc42p- and MAP kinase-dependent filamentous growth signaling pathway; also functions as an osmosensor in parallel to the Sho1p-mediated pathway; potential Cdc28p substrate" * 122805-Holinger-04_itms_18.12018.12018.3 2.0127 0.0246 92.3 3079.4644 3079.3855 9001.7 65 3.953 17.5 1 Q.VNTNTAVQSLSSTSPTLLLSSAKSSPTPTST.A * 122805-Holinger-03_itms_16.10697.10697.2 2.0779 0.0548 92.6 1268.698 1270.3813 4036.8 26 3.873 65.0 1 A.DYWTSPLSSIT.A YMR246W 1 1 3.2% 694 77267 6.6 U FAA4 SGDID:S000004860, Chr XIII from 759806-761890, Verified ORF, "Long chain fatty acyl-CoA synthetase, regulates protein modification during growth in the presence of ethanol, functions to incorporate palmitic acid into phospholipids and neutral lipids" * 122805-Holinger-04_itms_22.14350.14350.3 2.7118 0.1597 96.1 2342.3247 2346.642 5735.0 156 4.114 29.8 1 L.EPEHFDYGIAGDLVGTITAKLV.D Reverse_YKR058W 1 1 3.2% 616 69724 4.4 U GLG1 SGDID:S000001766, Chr XI from 552412-554262, Verified ORF, "Self-glucosylating initiator of glycogen synthesis, also glucosylates n-dodecyl-beta-D-maltoside; similar to mammalian glycogenin" * 122805-Holinger-05_itms_17.11912.11912.3 2.2474 0.1787 93.8 2124.5505 2123.963 5690.8 240 4.03 31.6 1 L.HSEEGSNSANDTTSDEEEAN.Q YHR202W 1 1 3.2% 602 68998 6.2 U YHR202W SGDID:S000001245, Chr VIII from 502388-504196, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_20.12792.12792.2 1.7327 0.2059 92.8 2023.4054 2025.3158 6863.8 109 3.894 30.6 1 L.GHDSNVPVSTKKGKTISRL.V Reverse_YJL016W 1 1 3.2% 561 63207 7.7 U YJL016W SGDID:S000003553, Chr X from 405504-407189, Uncharacterized ORF, "Cytoplasmic protein of unknown function" * 122805-Holinger-04_itms_26.16880.16880.3 1.7066 0.2188 91.5 1933.585 1934.119 5506.5 398 3.924 26.5 1 S.RSSVPHSSLNISTASRSF.K YAR002W 1 1 3.2% 539 59039 9.3 U NUP60 SGDID:S000000063, Chr I from 152259-153878, Verified ORF, "Subunit of the nuclear pore complex (NPC), functions to anchor Nup2p to the NPC in a dynamic process that is controlled by the nucleoplasmic concentration of Gsp1p-GTP; potential Cdc28p substrate" * 122805-Holinger-06_itms_10.09196.09196.2 2.0614 0.0597 91.6 2000.095 2000.2769 6447.5 68 3.815 43.8 1 V.KPLFQNVPEQGEEPMKQ.L Reverse_YLR116W 1 1 3.2% 476 53034 9.7 U MSL5 SGDID:S000004106, Chr XII from 380823-382253, Verified ORF, "Component of the commitment complex, which defines the first step in the splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA" * 122805-Holinger-04_itms_7.05667.05667.2 2.2489 0.3797 99.7 1637.824 1640.8077 2433.3 96 5.199 39.3 1 C.HLPDEFNMAGPPLDS.A YPR124W 2 2 3.2% 406 44442 6.2 U CTR1 SGDID:S000006328, Chr XVI from 786204-787424, Verified ORF, "High-affinity copper transporter of the plasma membrane, mediates nearly all copper uptake under low copper conditions; transcriptionally induced at low copper levels and degraded at high copper levels" * 122805-Holinger-04_itms_13.09417.09417.2 2.7281 0.1469 94.3 1618.8828 1619.9005 8677.7 1 3.977 66.7 1 Y.YLTPTYKNYPVLF.H * 122805-Holinger-03_itms_13.08757.08757.2 2.4533 0.125 97.4 1043.576 1044.2383 4368.4 13 4.294 78.6 1 T.YKNYPVLF.H YNL307C 1 1 3.2% 375 43136 8.6 U MCK1 SGDID:S000005251, Chr XIV from 57573-56446, reverse complement, Verified ORF, "Protein serine/threonine/tyrosine (dual-specificity) kinase involved in control of chromosome segregation and in regulating entry into meiosis; related to mammalian glycogen synthase kinases of the GSK-3 family" * 122805-Holinger-04_itms_15.10101.10101.2 2.2914 0.1399 98.8 1375.7897 1376.6384 7583.4 4 4.531 59.1 1 R.GFTEPIKLPNLF.D Reverse_YEL004W 1 1 3.2% 342 39266 9.4 U YEA4 SGDID:S000000730, Chr V from 146950-147978, Verified ORF, "Uridine diphosphate-N-acetylglucosamine (UDP-GlcNAc) transporter required for cell wall chitin synthesis; localized to the ER" * 122805-Holinger-03_itms_26.16035.16035.1 1.0673 0.304 93.0 1282.3705 1283.4264 4574.1 13 4.91 30.0 1 P.QHVDLFEPLGQ.C Reverse_YMR315W 1 1 3.2% 349 38216 6.6 U YMR315W SGDID:S000004932, Chr XIII from 902799-903848, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_23.14769.14769.1 1.567 0.1808 91.1 1082.63 1083.27 5231.9 1 4.781 60.0 1 A.VGVPLPTSEAI.K YNL290W 1 2 3.2% 340 38204 6.4 U RFC3 SGDID:S000005234, Chr XIV from 86218-87240, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" * 122805-Holinger-05_itms_15.10651.10651.2 3.3347 0.2152 100.0 1183.7523 1184.4619 6203.7 1 5.592 80.0 2 L.ALIDLIEGIVK.I YER133W 1 1 3.2% 312 35907 5.5 U GLC7 SGDID:S000000935, Chr V from 432491-432667,433193-433954, Verified ORF, "Catalytic subunit of type 1 serine/threonine protein phosphatase, involved in many processes including glycogen metabolism, sporulation, and mitosis; interacts with multiple regulatory subunits; predominantly isolated with Sds22p" * 122805-Holinger-03_itms_12.08184.08184.2 1.9079 0.0992 93.3 1154.6996 1152.295 5812.6 81 3.932 61.1 1 F.TFGPDVVNRF.L YML087C 1 1 3.2% 312 35764 8.6 U YML087C SGDID:S000004552, Chr XIII from 95369-94431, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_10.07796.07796.2 2.5256 0.0221 95.5 1172.7009 1174.3855 5149.1 9 4.093 66.7 1 L.ELVVKTYKHG.V Reverse_YHR142W 1 1 3.2% 316 34898 5.8 U CHS7 SGDID:S000001184, Chr VIII from 383541-384491, Verified ORF, "Protein of unknown function, involved in chitin biosynthesis by regulating Chs3p export from the ER" * 122805-Holinger-01_itms_11.08540.08540.2 1.7566 0.0806 99.0 1109.7168 1110.2183 2725.0 33 4.657 55.6 1 L.PTKSCIAAFD.S Reverse_YDL222C 1 1 3.2% 309 34135 9.4 U FMP45 SGDID:S000002381, Chr IV from 61802-60873, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria; cell cortex protein; not required for growth on nonfermentable carbon sources; required for viability in stationary phase" * 122805-Holinger-04_itms_20.13272.13272.1 1.5321 0.3209 96.8 1273.0072 1272.4956 4774.3 6 5.094 55.6 1 F.FALWSLVCYL.V YLR209C 1 1 3.2% 311 33755 7.3 U PNP1 SGDID:S000004199, Chr XII from 561734-560799, reverse complement, Verified ORF, "Purine nucleoside phosphorylase, specifically metabolizes inosine and guanosine nucleosides" * 122805-Holinger-03_itms_14.09603.09603.2 3.0788 0.2565 100.0 1222.7078 1223.4575 5758.3 1 5.905 77.8 1 L.FETTFPIRVL.N YNR016C 6 6 3.1% 2233 250351 6.3 U ACC1 SGDID:S000005299, Chr XIV from 661376-654675, reverse complement, Verified ORF, "Acetyl-CoA carboxylase, biotin containing enzyme that catalyzes the carboxylation of acetyl-CoA to form malonyl-CoA; required for de novo biosynthesis of long-chain fatty acids" * 122805-Holinger-04_itms_11.07897.07897.2 2.4049 0.3033 99.8 1302.6753 1303.4669 7192.2 188 5.353 50.0 1 Q.SAKVPCIPWSGT.G * 122805-Holinger-04_itms_13.09309.09309.2 2.7554 0.1031 93.1 1197.6488 1198.3641 7236.3 1 3.913 83.3 1 T.GWLDDLITHK.M * 122805-Holinger-05_itms_7.06313.06313.2 2.8349 0.1548 96.1 1126.7035 1127.3696 6358.2 28 4.146 65.0 1 Q.LLKQPGSTIVA.G * 122805-Holinger-03_itms_13.08666.08666.2 3.775 0.2623 100.0 1322.6998 1323.4912 9867.9 3 5.658 75.0 1 S.NFNIKPIFTDN.R * 122805-Holinger-03_itms_14.09360.09360.2 2.1838 0.2317 99.5 972.51294 973.11914 6401.0 1 5.031 85.7 1 A.FGGFLERF.G * 122805-Holinger-04_itms_12.08892.08892.2 2.9829 0.2051 99.3 2115.2266 2116.5083 6286.6 1 4.754 47.1 1 L.VDYKQPIIIYIPPTGELR.G YMR229C 5 6 3.1% 1729 193133 6.2 U RRP5 SGDID:S000004842, Chr XIII from 731122-725933, reverse complement, Verified ORF, "Protein required for the synthesis of both 18S and 5.8S rRNA; C-terminal region is crucial for the formation of 18S rRNA and N-terminal region is required for the 5.8S rRNA; component of small ribosomal subunit (SSU) processosome" * 122805-Holinger-03_itms_11.07908.07908.2 4.4685 0.2956 99.9 1669.9749 1670.9469 5031.5 1 5.468 75.0 1 Q.KDTIENIVPGRTIIT.V * 122805-Holinger-05_itms_11.08752.08752.2 3.2253 0.2782 99.8 1424.8416 1425.711 6929.1 1 5.215 70.8 1 Y.IKSISDKGLFVAF.N * 122805-Holinger-03_itms_11.07812.07812.2 2.5965 0.1576 96.4 1397.6376 1397.658 7474.6 1 4.165 62.5 2 S.TIKVGDELPGRVL.K * 122805-Holinger-03_itms_11.07926.07926.2 3.5898 0.2728 99.8 1490.7843 1491.6439 5071.8 1 5.387 66.7 1 N.TRAPESVADFERL.L * 122805-Holinger-03_itms_11.07936.07936.3 3.2626 0.1584 93.8 1490.7863 1491.6439 4384.5 4 4.03 50.0 1 N.TRAPESVADFERL.L YOL063C 3 3 3.1% 957 109715 5.7 U YOL063C SGDID:S000005424, Chr XV from 210264-207391, reverse complement, Uncharacterized ORF, "Protein required for normal hydroxyurea resistance; not related to the HUS1 checkpoint protein identified in human and fission yeast" * 122805-Holinger-03_itms_11.07807.07807.2 3.8592 0.2813 99.8 1655.8328 1656.7924 4522.9 2 5.39 65.4 1 M.PPQIPNENDDLFTR.W * 122805-Holinger-04_itms_13.09275.09275.2 3.4738 0.2495 99.8 1841.9181 1843.0055 5595.1 1 5.374 60.7 1 M.PPQIPNENDDLFTRW.L * 122805-Holinger-03_itms_14.09619.09619.2 2.648 0.1194 95.7 1749.9794 1751.0325 6547.0 2 4.107 50.0 1 K.YKDIINTFPQLITPS.G YNL270C 1 1 3.1% 573 64014 7.9 U ALP1 SGDID:S000005214, Chr XIV from 137662-135941, reverse complement, Verified ORF, "Basic amino acid transporter, involved in uptake of cationic amino acids" * 122805-Holinger-05_itms_17.11950.11950.2 1.2547 0.118 91.2 1945.0005 1946.266 7949.4 41 3.803 29.4 1 M.GTVIYSVTQSLGEMVTFI.P YER086W 1 1 3.1% 576 63831 8.5 U ILV1 SGDID:S000000888, Chr V from 328473-330203, Verified ORF, "Threonine deaminase, catalyzes the first step in isoleucine biosynthesis; expression is under general amino acid control; ILV1 locus exhibits highly positioned nucleosomes whose organization is independent of known ILV1 regulation" * 122805-Holinger-03_itms_13.09016.09016.2 2.5485 0.1099 92.8 2068.0886 2069.3245 7531.7 280 3.895 32.4 1 A.EERGLTNIPPFDHPYVIA.G YDR479C 1 1 3.1% 554 63543 6.2 U PEX29 SGDID:S000002887, Chr IV from 1416864-1415200, reverse complement, Verified ORF, "Peroxisomal integral membrane protein, involved in regulation of peroxisome size and number; genetic interactions suggest that Pex28p and Pex29p act at steps upstream of those mediated by Pex30p, Pex31p, and Pex32p" * 122805-Holinger-06_itms_14.11586.11586.2 1.245 0.1391 91.6 1781.5468 1779.9016 4303.8 9 3.813 25.0 1 S.QAKKESISSGSRTSDPT.R Reverse_YPL258C 1 1 3.1% 551 61334 5.9 U THI21 SGDID:S000006179, Chr XVI from 55153-53498, reverse complement, Verified ORF, "Hydroxymethylpyrimidine phosphate kinase, involved in the last steps in thiamine biosynthesis; member of a gene family with THI20 and THI22; functionally redundant with Thi20p" * 122805-Holinger-05_itms_12.09311.09311.3 2.4966 0.186 90.1 1933.5913 1929.2507 7363.2 10 3.883 35.9 1 L.AHVYGMLCPNLAIVLEQ.W Reverse_YJR015W 1 1 3.1% 510 58117 7.1 U YJR015W SGDID:S000003776, Chr X from 462635-464167, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_4.04215.04215.2 1.5343 0.2209 91.9 1960.8364 1959.2325 9854.2 14 3.841 40.0 1 K.STDYLAGWFLVFMTFC.I Reverse_YGL097W 1 1 3.1% 482 53014 6.1 U SRM1 SGDID:S000003065, Chr VII from 321785-323233, Verified ORF, "Nucleotide exchange factor for Gsp1p, localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; potentially phosphorylated by Cdc28p" * 122805-Holinger-04_itms_16.10757.10757.3 2.017 0.0512 90.8 1611.6743 1608.9218 3907.4 127 3.904 35.7 1 D.PLALRKPKTVLAGDE.V YLR231C 1 1 3.1% 453 51032 5.3 U BNA5 SGDID:S000004221, Chr XII from 607121-605760, reverse complement, Verified ORF, "Kynureninase, required for biosynthesis of nicotinic acid from tryptophan via kynurenine pathway" * 122805-Holinger-05_itms_10.07834.07834.2 1.7055 0.1404 92.6 1787.1272 1787.1241 6655.0 1 3.873 50.0 1 Y.KHPLRIEKLPCFFT.I YBR271W 1 1 3.1% 419 47977 5.0 U YBR271W SGDID:S000000475, Chr II from 744847-746106, Uncharacterized ORF, "Putative S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family" * 122805-Holinger-05_itms_11.08631.08631.2 2.4534 0.0505 90.7 1464.7549 1463.6763 7321.3 2 3.777 54.2 1 L.GWKTWGSSLILSQ.L Reverse_YOR196C 1 1 3.1% 414 46247 9.5 U LIP5 SGDID:S000005722, Chr XV from 716837-715593, reverse complement, Verified ORF, "Protein involved in biosynthesis of the coenzyme lipoic acid, has similarity to E. coli lipoic acid synthase" * 122805-Holinger-05_itms_9.07533.07533.2 2.4886 0.0135 91.6 1523.9177 1525.835 7788.3 4 3.811 58.3 1 T.EVLTNPAKQKIKR.V YPL057C 1 1 3.1% 382 44808 9.0 U SUR1 SGDID:S000005978, Chr XVI from 453054-451906, reverse complement, Verified ORF, "Probable catalytic subunit of a mannosylinositol phosphorylceramide (MIPC) synthase, forms a complex with probable regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p" * 122805-Holinger-05_itms_13.09764.09764.2 2.0086 0.0944 91.6 1358.6284 1361.4888 5809.4 351 3.813 50.0 1 D.DTVKDAILEEDL.N Reverse_YAL060W 1 1 3.1% 382 41538 6.7 U BDH1 SGDID:S000000056, Chr I from 35156-36304, Verified ORF, "NAD-dependent (2R,3R)-2,3-butanediol dehydrogenase, a zinc-containing medium-chain alcohol dehydrogenase, produces 2,3-butanediol from acetoin during fermentation and allows using 2,3-butanediol as a carbon source during aerobic growth" * 122805-Holinger-05_itms_23.15417.15417.2 1.894 0.2343 95.7 1201.8934 1202.4979 8275.2 77 4.109 45.5 1 T.VKPGVKSVIGSM.E YLR270W 1 1 3.1% 350 40770 6.3 U DCS1 SGDID:S000004260, Chr XII from 681188-682240, Verified ORF, "Non-essential hydrolase involved in mRNA decapping, may function in a feedback mechanism to regulate deadenylation, contains pyrophosphatase activity and a HIT (histidine triad) motif; interacts with neutral trehalase Nth1p" * 122805-Holinger-03_itms_23.14460.14460.2 1.7826 0.1732 94.4 1254.4594 1253.3971 4308.5 163 3.98 60.0 1 R.FQFVSVLDSNP.Q YNL037C 1 1 3.1% 360 39324 9.0 U IDH1 SGDID:S000004982, Chr XIV from 559003-557921, reverse complement, Verified ORF, "Subunit of mitochondrial NAD(+)-dependent isocitrate dehydrogenase, which catalyzes the oxidation of isocitrate to alpha-ketoglutarate in the TCA cycle" * 122805-Holinger-05_itms_11.08798.08798.2 3.3131 0.0838 99.3 1322.8417 1323.6218 7430.8 2 4.831 70.0 1 T.RIPDIDLIVIR.E YOL064C 1 1 3.1% 357 39149 6.2 U MET22 SGDID:S000005425, Chr XV from 207175-206102, reverse complement, Verified ORF, "Bisphosphate-3'-nucleotidase, involved in salt tolerance and methionine biogenesis; dephosphorylates 3'-phosphoadenosine-5'-phosphate and 3'-phosphoadenosine-5'-phosphosulfate, intermediates of the sulfate assimilation pathway" * 122805-Holinger-03_itms_22.13716.13716.2 1.5455 0.1236 91.0 1181.1127 1179.3153 2699.5 5 3.788 60.0 1 T.GDYAAQTIIIN.A YNL215W 1 1 3.1% 320 36154 4.7 U IES2 SGDID:S000005159, Chr XIV from 244469-245431, Verified ORF, "Protein that associates with the INO80 chromatin remodeling complex under low-salt conditions" * 122805-Holinger-03_itms_12.08244.08244.3 1.6437 0.0982 94.6 1279.6477 1281.4783 3295.0 441 4.082 33.3 1 K.RHLHTRSMDK.R YJR011C 1 1 3.1% 261 30473 6.4 U YJR011C SGDID:S000003772, Chr X from 459340-458555, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_6.05086.05086.2 2.4447 0.1469 94.8 1082.5104 1083.2322 5253.8 44 4.024 71.4 1 R.YIFQELNR.L YDL126C 2 2 3.0% 835 91996 4.9 U CDC48 SGDID:S000002284, Chr IV from 238664-236157, reverse complement, Verified ORF, "ATPase in ER, nuclear membrane and cytosol with homology to mammalian p97; in a complex with Npl4p and Ufd1p participates in retrotranslocation of ubiquitinated proteins from the ER into the cytosol for degradation by the proteasome" * 122805-Holinger-03_itms_11.07766.07766.2 2.2722 0.1537 91.8 1178.6375 1179.3182 5144.9 9 3.828 72.2 1 E.SNIRDIFDKA.R * 122805-Holinger-03_itms_16.10386.10386.2 2.9268 0.2364 99.0 1617.9083 1618.8676 6928.1 1 4.619 60.7 1 A.APTVVFLDELDSIAK.A YCR077C 2 2 3.0% 796 88495 7.7 U PAT1 SGDID:S000000673, Chr III from 252624-250234, reverse complement, Verified ORF, "Topoisomerase II-associated deadenylation-dependent mRNA-decapping factor; also required for faithful chromosome transmission, maintenance of rDNA locus stability, and protection of mRNA 3'-UTRs from trimming; functionally linked to Pab1p" * 122805-Holinger-04_itms_12.08512.08512.2 2.2934 0.209 97.7 1523.0507 1525.778 6252.8 8 4.333 43.3 1 P.PAMAPSPQSTMAPAPA.P * 122805-Holinger-06_itms_15.12100.12100.1 1.2041 0.2962 93.1 708.88416 709.82043 3774.7 20 4.904 50.0 1 T.PSPGPVVG.A YML017W 1 1 3.0% 593 65584 8.7 U PSP2 SGDID:S000004479, Chr XIII from 236588-236591,236954-238731, Verified ORF, "Asn rich cytoplasmic protein that contains RGG motifs; high-copy suppressor of group II intron-splicing defects of a mutation in MRS2 and of a conditional mutation in POL1 (DNA polymerase alpha); possible role in mitochondrial mRNA splicing" * 122805-Holinger-03_itms_16.10402.10402.3 2.6758 0.085 91.2 1857.6486 1856.9583 4470.7 57 3.912 32.4 1 G.FGRGAYNNRGSRGGRGSS.G Reverse_YBR180W 1 1 3.0% 572 63407 8.8 U DTR1 SGDID:S000000384, Chr II from 589736-591454, Verified ORF, "Multidrug resistance dityrosine transporter of the major facilitator superfamily, essential for spore wall synthesis, facilitates the translocation of bisformyl dityrosine through the prospore membrane" * 122805-Holinger-03_itms_14.09207.09207.2 3.1758 0.0228 94.6 1826.0143 1828.121 4623.7 17 3.991 46.9 1 R.FFSSVAVTGAARKPFLE.T Reverse_YER014W 1 1 3.0% 539 59703 9.3 U HEM14 SGDID:S000000816, Chr V from 182599-184218, Verified ORF, "Protoporphyrinogen oxidase, a mitochondrial enzyme that catalyzes the seventh step in the heme biosynthetic pathway, converting protoporphyrinogen IX to protoporphyrin IX" * 122805-Holinger-04_itms_16.10808.10808.2 1.5507 0.1016 93.9 1718.035 1719.9778 6986.9 149 3.951 40.0 1 V.GHENLMCGGIMATVKT.Y Reverse_YOR032C 1 1 3.0% 434 48871 6.5 U HMS1 SGDID:S000005558, Chr XV from 391074-389770, reverse complement, Verified ORF, "Basic helix-loop-helix (bHLH) protein with similarity to myc-family transcription factors; overexpression confers hyperfilamentous growth and suppresses the pseudohyphal filamentation defect of a diploid mep1 mep2 homozygous null mutant" * 122805-Holinger-06_itms_7.07352.07352.2 2.3261 0.0245 95.4 1536.641 1536.5975 7056.0 10 4.078 54.2 1 D.ETNYNPPPVNYNN.S Reverse_YMR323W 1 1 3.0% 437 47313 5.4 U ERR3 SGDID:S000004942, Chr XIII from 920086-921399, Verified ORF, "Protein of unknown function, has similarity to enolases" Reverse_YPL281C 1 1 3.0% 437 47328 5.3 U ERR2 SGDID:S000006202, Chr XVI from 10870-9557, reverse complement, Verified ORF, "Protein of unknown function, has similarity to enolases" Reverse_YOR393W 1 1 3.0% 437 47328 5.3 U ERR1 SGDID:S000005920, Chr XV from 1080272-1081585, Verified ORF, "Protein of unknown function, has similarity to enolases" 122805-Holinger-02_itms_17.11289.11289.2 2.1593 0.0775 91.8 1322.7607 1323.3153 3781.2 228 3.826 45.8 1 G.EDGVNGASPGYQE.K Reverse_YMR173W 1 2 3.0% 430 46233 4.5 U DDR48 SGDID:S000004784, Chr XIII from 608688-609980, Verified ORF, "DNA damage-responsive protein, expression is increased in response to heat-shock stress or treatments that produce DNA lesions; contains multiple repeats of the amino acid sequence NNNDSYGS" 122805-Holinger-05_itms_4.04112.04112.2 2.0961 0.0089 95.4 1378.6772 1379.4258 7652.8 5 4.083 54.2 2 S.SGYSSKNKNSSGY.S Reverse_YOL018C 1 1 3.0% 397 45875 5.3 U TLG2 SGDID:S000005378, Chr XV from 292074-290881, reverse complement, Verified ORF, "Syntaxin-like t-SNARE that forms a complex with Tlg1p and Vti1p and mediates fusion of endosome-derived vesicles with the late Golgi; binds Vps45p, which prevents Tlg2p degradation and also facilitates t-SNARE complex formation" * 122805-Holinger-03_itms_20.13076.13076.2 1.8422 0.2016 95.7 1141.1571 1138.188 4003.7 68 4.112 50.0 1 G.NNRGGSGGGHPK.L YHR179W 1 1 3.0% 400 45011 6.6 U OYE2 SGDID:S000001222, Chr VIII from 462502-463704, Verified ORF, "Widely conserved NADPH oxidoreductase containing flavin mononucleotide (FMN), homologous to Oye3p with slight differences in ligand binding and catalytic properties; may be involved in sterol metabolism" * 122805-Holinger-03_itms_14.09541.09541.2 2.4344 0.087 90.5 1437.7633 1436.6506 8264.3 13 3.767 59.1 1 R.FFISNPDLVDRL.E Reverse_YNL042W 1 1 3.0% 396 43749 9.7 U BOP3 SGDID:S000004987, Chr XIV from 548101-549291, Verified ORF, "Protein of unknown function, potential Cdc28p substrate; overproduction suppresses a pam1 slv3 double null mutation and confers resistance to methylmercury" * 122805-Holinger-02_itms_5.04213.04213.2 2.4249 0.2586 99.1 1147.7273 1145.2756 4179.2 1 4.669 68.2 1 P.QNGGAKMPSSAP.V YIL096C 1 1 3.0% 336 39402 9.7 U YIL096C SGDID:S000001358, Chr IX from 183124-182114, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_15.09844.09844.2 2.365 0.1072 93.6 1234.7072 1235.4686 6119.2 16 3.94 61.1 1 L.KDLNIPIFFQ.I YBR141C 1 1 3.0% 337 38540 9.7 U YBR141C SGDID:S000000345, Chr II from 528032-527019, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus; YBR141C is not an essential gene" * 122805-Holinger-04_itms_8.06466.06466.2 2.2964 0.1156 92.6 1193.613 1194.4344 3846.4 9 3.873 66.7 1 L.GYIMNQINKL.G Reverse_YPL132W 1 1 3.0% 300 34044 8.6 U COX11 SGDID:S000006053, Chr XVI from 301715-302617, Verified ORF, "Mitochondrial inner membrane protein required for delivery of copper to the Cox1p subunit of cytochrome c oxidase; association with mitochondrial ribosomes suggests that copper delivery may occur during translation of Cox1p" * 122805-Holinger-05_itms_15.10635.10635.2 1.5084 0.0702 92.1 1023.47363 1024.0806 4764.6 86 3.85 56.2 1 A.TGDGYHARF.F YLR348C 1 1 3.0% 298 32992 9.6 U DIC1 SGDID:S000004340, Chr XII from 827872-826976, reverse complement, Verified ORF, "Mitochondrial dicarboxylate carrier, integral membrane protein, catalyzes a dicarboxylate-phosphate exchange across the inner mitochondrial membrane, transports cytoplasmic dicarboxylates into the mitochondrial matrix" * 122805-Holinger-03_itms_12.08176.08176.2 1.9692 0.0938 92.8 1026.6367 1027.2238 5861.9 370 3.88 56.2 1 A.TMVTHPLDL.A YBR261C 1 1 3.0% 232 26068 5.3 U YBR261C SGDID:S000000465, Chr II from 735525-734827, reverse complement, Uncharacterized ORF, "Putative S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family" * 122805-Holinger-05_itms_3.04019.04019.2 1.9526 0.1209 92.8 879.4973 879.99445 3415.2 5 3.896 83.3 1 T.RSDAKFR.Q YKL182W 6 6 2.9% 2051 228689 5.9 U FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" * 122805-Holinger-04_itms_12.08574.08574.2 2.4124 0.1339 91.3 1102.6448 1103.3066 4234.8 2 3.8 77.8 1 K.LLGFTPGELR.S * 122805-Holinger-05_itms_5.05480.05480.2 1.8766 0.081 92.3 905.5373 906.07263 4807.7 28 3.857 75.0 1 C.ILHGPVAAQ.F * 122805-Holinger-05_itms_8.06657.06657.2 2.9833 0.2388 100.0 1210.7252 1211.4441 7582.8 1 5.936 80.0 1 F.GPIKVELPTKE.T * 122805-Holinger-05_itms_10.08253.08253.2 3.1663 0.3842 99.6 1710.0029 1711.0087 4905.7 4 5.13 53.3 1 F.GPIKVELPTKETVEIG.I * 122805-Holinger-02_itms_14.09909.09909.2 2.4312 0.0978 97.2 1676.9851 1677.9817 5845.5 154 4.274 50.0 1 L.EQKVNLENPIPIAVL.D * 122805-Holinger-05_itms_5.05358.05358.2 2.9772 0.1399 99.0 1157.6539 1158.3427 5379.2 1 4.624 87.5 1 E.KIFKEINEH.S YLR429W 1 1 2.9% 651 72553 5.9 U CRN1 SGDID:S000004421, Chr XII from 990773-992728, Verified ORF, "Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity" * 122805-Holinger-03_itms_13.09132.09132.3 2.6345 0.1816 93.3 2082.6177 2079.4473 4504.0 190 4.01 30.6 1 F.AVIPIEEVGKAPDQVPLFR.G Reverse_YNL117W 1 1 2.9% 554 62791 7.2 U MLS1 SGDID:S000005061, Chr XIV from 406360-408024, Verified ORF, "Malate synthase, enzyme of the glyoxylate cycle, involved in utilization of non-fermentable carbon sources; expression is subject to carbon catabolite repression; localizes in peroxisomes during growth in oleic acid medium" * 122805-Holinger-05_itms_9.07351.07351.3 2.7803 0.1074 94.4 1896.5944 1899.1713 6370.7 40 4.065 40.0 1 V.NEPIFYIQNPTGMNIF.V YOR374W 1 1 2.9% 519 56724 6.7 U ALD4 SGDID:S000005901, Chr XV from 1039836-1041395, Verified ORF, "Mitochondrial aldehyde dehydrogenase, required for growth on ethanol and conversion of acetaldehyde to acetate; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed" * 122805-Holinger-04_itms_11.08093.08093.3 2.3406 0.1929 96.8 1828.0112 1831.2291 2655.8 447 4.206 32.1 1 L.QLRYFSHLPMTVPIK.L Reverse_YER045C 1 1 2.9% 489 54592 8.1 U ACA1 SGDID:S000000847, Chr V from 241500-240031, reverse complement, Verified ORF, "Basic leucine zipper (bZIP) transcription factor of the ATF/CREB family, may regulate transcription of genes involved in utilization of non-optimal carbon sources" * 122805-Holinger-06_itms_18.13987.13987.2 1.5918 0.2385 92.5 1427.8851 1425.625 3034.7 10 3.871 46.2 1 Y.INKSGTQPAAEPIV.T Reverse_YDL161W 1 1 2.9% 454 52352 5.9 U ENT1 SGDID:S000002320, Chr IV from 167715-169079, Verified ORF, "Epsin-like protein involved in endocytosis and actin patch assembly and functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus" * 122805-Holinger-06_itms_12.10365.10365.2 1.7293 0.1174 90.5 1568.4463 1570.7203 7788.7 9 3.769 54.2 1 M.PQQLQQQGQQQQM.R YOL030W 1 1 2.9% 484 51870 4.6 U GAS5 SGDID:S000005390, Chr XV from 268187-269641, Verified ORF, "Putative 1,3-beta-glucanosyltransferase, has similarity to Gas1p; localizes to the cell wall" * 122805-Holinger-03_itms_12.08522.08522.2 2.8131 0.076 99.1 1428.8129 1429.7429 4193.8 18 4.66 57.7 1 K.SKGAAGIIEIPLIF.R YLR080W 1 1 2.9% 444 50947 9.2 U EMP46 SGDID:S000004070, Chr XII from 287917-289251, Verified ORF, "Integral membrane component of endoplasmic reticulum-derived COPII-coated vesicles, which function in ER to Golgi transport" * 122805-Holinger-06_itms_12.10210.10210.2 1.5727 0.1452 97.5 1586.6521 1588.831 5045.6 2 4.312 41.7 1 M.CVWMVHGKVTQKD.E YGR249W 1 1 2.9% 456 50735 9.5 U MGA1 SGDID:S000003481, Chr VII from 988054-989424, Verified ORF, "Protein similar to heat shock transcription factor; multicopy suppressor of pseudohyphal growth defects of ammonium permease mutants" * 122805-Holinger-05_itms_6.05792.05792.3 2.2405 0.0423 93.0 1573.8875 1577.7795 4187.3 264 3.977 31.2 1 K.ELVEWKFTHPSGF.F Reverse_YCL044C 1 2 2.9% 417 47156 9.3 U MGR1 SGDID:S000000549, Chr III from 48364-47111, reverse complement, Verified ORF, "Subunit, with Yme1p, of the mitochondrial inner membrane i-AAA protease complex, which is responsible for degradation of unfolded or misfolded mitochondrial gene products; required for growth of cells lacking the mitochondrial genome" * 122805-Holinger-05_itms_8.07160.07160.2 2.1311 0.0569 91.1 1268.6603 1269.4833 6037.3 95 3.792 59.1 2 T.YLGPLNDPAPVL.P Reverse_YDL193W 1 1 2.9% 375 42557 7.0 U YDL193W SGDID:S000002352, Chr IV from 114673-115800, Uncharacterized ORF, "Prenyltransferase, required for cell viability" * 122805-Holinger-03_itms_11.07959.07959.2 2.4771 0.0503 94.7 1208.6498 1210.2426 2688.1 17 4.016 60.0 1 P.PIHNSSEPVDD.R YLR332W 2 2 2.9% 376 39146 5.7 U MID2 SGDID:S000004324, Chr XII from 790676-791806, Verified ORF, "O-glycosylated plasma membrane protein that acts as a sensor for cell wall integrity signaling and activates the pathway; interacts with Rom2p, a guanine nucleotide exchange factor for Rho1p, and with cell integrity pathway protein Zeo1p" * 122805-Holinger-02_itms_22.14299.14299.2 1.6618 0.152 98.9 972.6603 974.0123 3213.7 380 4.607 66.7 1 S.SSFSISSTSA.T * 122805-Holinger-02_itms_21.13956.13956.2 1.4464 0.0171 96.1 1077.7415 1075.1174 3227.3 343 4.143 55.0 1 S.SSFSISSTSAT.S Reverse_YPL244C 1 1 2.9% 339 38075 9.7 U HUT1 SGDID:S000006165, Chr XVI from 88033-87014, reverse complement, Verified ORF, "Protein with a role in UDP-galactose transport to the Golgi lumen, has similarity to human UDP-galactose transporter UGTrel1, exhibits a genetic interaction with S. cerevisiae ERO1" * 122805-Holinger-01_itms_17.12035.12035.2 1.4616 0.0857 97.6 1209.3727 1211.5481 2216.4 97 4.33 44.4 1 L.IVFLNLTFML.H Reverse_YKL091C 1 1 2.9% 310 36073 7.8 U YKL091C SGDID:S000001574, Chr XI from 270294-269362, reverse complement, Verified ORF, "Putative homolog of Sec14p, which is a phosphatidylinositol/phosphatidylcholine transfer protein involved in lipid metabolism; localizes to the nucleus" * 122805-Holinger-02_itms_6.05083.05083.2 1.5625 0.1013 96.1 1014.5735 1016.22546 2656.5 192 4.152 68.8 1 V.TVPDLFPKV.M YDR368W 1 1 2.9% 312 34755 7.1 U YPR1 SGDID:S000002776, Chr IV from 1213894-1214832, Verified ORF, "2-methylbutyraldehyde reductase, may be involved in isoleucine catabolism" * 122805-Holinger-05_itms_12.09143.09143.2 2.1514 0.068 93.1 1109.5995 1110.3005 5914.2 6 3.917 75.0 1 M.KWGSFPIFQ.- YMR241W 1 1 2.9% 314 34185 9.9 U YHM2 SGDID:S000004854, Chr XIII from 751960-752904, Verified ORF, "Mitochondrial DNA-binding protein, component of the mitochondrial nucleoid structure, involved in mtDNA replication and segregation of mitochondrial genomes; member of the mitochondrial carrier protein family" * 122805-Holinger-04_itms_7.05883.05883.2 1.7257 0.0812 98.3 1046.6423 1047.2828 4487.3 7 4.409 75.0 1 N.VIEKKPVSF.S YOL088C 1 1 2.9% 277 32401 6.5 U MPD2 SGDID:S000005448, Chr XV from 154744-153911, reverse complement, Verified ORF, "Member of the protein disulfide isomerase (PDI) family, exhibits chaperone activity; overexpression suppresses the lethality of a pdi1 deletion but does not complement all Pdi1p functions; undergoes oxidation by Ero1p" * 122805-Holinger-03_itms_16.10537.10537.2 2.8183 0.0462 92.3 1011.6389 1012.32733 7690.4 6 3.859 85.7 1 E.KLKIIRLQ.L YAL035W 2 2 2.8% 1002 112268 5.8 U FUN12 SGDID:S000000033, Chr I from 76428-79436, Verified ORF, "GTPase, required for general translation initiation by promoting Met-tRNAiMet binding to ribosomes and ribosomal subunit joining; homolog of bacterial IF2" * 122805-Holinger-04_itms_5.04665.04665.2 2.9805 0.2032 99.5 1505.8337 1506.7019 4193.7 50 5.083 54.2 1 L.EINHQPVQEVKKG.Q * 122805-Holinger-04_itms_10.07333.07333.2 2.8308 0.0935 93.9 1737.9327 1738.9437 4145.0 20 3.951 53.6 1 A.VRLEDPSGQQPIWGR.H YLR409C 2 2 2.8% 939 104791 7.8 U UTP21 SGDID:S000004401, Chr XII from 937230-934411, reverse complement, Uncharacterized ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data" * 122805-Holinger-04_itms_8.06575.06575.2 2.7446 0.1546 98.3 1731.853 1732.8871 6667.2 1 4.404 61.5 1 Y.KKSDPQDKYPSEFY.T * 122805-Holinger-02_itms_17.11316.11316.2 2.245 0.1385 94.2 1221.7334 1222.4674 4232.5 149 3.969 54.5 1 T.AEPAPVLDIIAL.G Reverse_YHR056C 1 1 2.8% 883 101335 8.1 U RSC30 SGDID:S000001098, Chr VIII from 217836-215185, reverse complement, Verified ORF, "One of 15 subunits of the 'Remodel the Structure of Chromatin' (RSC) complex; non-essential gene required for regulation of ribosomal protein genes and the cell wall/stress response; highly similar to Rsc3p; null mutants are osmosensitive" * 122805-Holinger-04_itms_18.11916.11916.3 2.8212 0.1159 97.7 2492.3342 2493.7712 5278.4 19 4.284 25.0 1 G.QGNGHTSMGSASPVAVMKGPGDPYF.C YLL029W 2 2 2.8% 749 84924 6.9 U YLL029W SGDID:S000003952, Chr XII from 81460-83709, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_11.08427.08427.2 2.2088 0.0525 91.6 1558.9795 1557.7026 6921.8 129 3.81 45.5 1 L.KYEFHGEEFKDK.K * 122805-Holinger-04_itms_13.09161.09161.2 1.9173 3.0E-4 91.9 1007.66833 1009.1966 3863.5 111 3.842 56.2 1 E.IKNAHKAQV.K YAL054C 1 1 2.8% 713 79141 6.6 U ACS1 SGDID:S000000050, Chr I from 45023-42882, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform, expressed during growth on nonfermentable carbon sources and under aerobic conditions" * 122805-Holinger-02_itms_27.17483.17483.2 1.3061 0.0346 90.1 2296.8123 2295.4724 6224.8 305 3.734 18.4 1 T.HQEDVFFTAGDIGWITGHTY.V YKR093W 1 1 2.8% 601 68044 5.4 U PTR2 SGDID:S000001801, Chr XI from 615372-617177, Verified ORF, "Integral membrane peptide transporter, mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p" * 122805-Holinger-02_itms_12.08642.08642.2 5.4369 0.3657 100.0 2010.9163 2012.0906 7861.0 1 7.234 78.1 1 M.DYEEEDEFDLNPISAPK.A Reverse_YLR015W 1 1 2.8% 505 58347 6.1 U BRE2 SGDID:S000004005, Chr XII from 175226-176743, Verified ORF, "Subunit of the COMPASS (Set1C) complex, which methylates Rad6p ubiquitinated histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; has similarity to the trithorax-group protein ASH2L" * 122805-Holinger-04_itms_6.05387.05387.3 2.2264 0.1557 95.5 1626.7633 1629.8024 7030.5 460 4.103 36.5 1 E.SRDMVSMGSHDFPY.E YEL016C 1 1 2.8% 493 57355 5.7 U NPP2 SGDID:S000000742, Chr V from 126218-124737, reverse complement, Verified ORF, "Nucleotide pyrophosphatase/phosphodiesterase family member; mediates extracellular nucleotide phosphate hydrolysis along with Npp1p and Pho5p; activity and expression enhanced during conditions of phosphate starvation" * 122805-Holinger-04_itms_9.07079.07079.2 2.4963 0.1367 96.0 1487.7731 1485.7566 4215.6 12 4.133 53.8 1 V.KEMGDVPIGIMGTH.G Reverse_YKL082C 1 1 2.8% 434 50482 9.6 U RRP14 SGDID:S000001565, Chr XI from 281973-280669, reverse complement, Uncharacterized ORF, "Essential protein, constituent of 66S pre-ribosomal particles; interacts with proteins involved in ribosomal biogenesis and cell polarity; member of the SURF-6 family" * 122805-Holinger-03_itms_5.04465.04465.2 3.7928 0.1315 97.7 1404.7308 1402.5474 5187.8 1 4.341 72.7 1 L.KEDDRIKIGEAQ.L YKL172W 1 1 2.8% 427 49734 6.4 U EBP2 SGDID:S000001655, Chr XI from 125764-127047, Verified ORF, "Essential protein required for the maturation of 25S rRNA and 60S ribosomal subunit assembly, localizes to the nucleolus; constituent of 66S pre-ribosomal particles" * 122805-Holinger-02_itms_7.05675.05675.2 2.4711 0.1446 95.3 1403.6622 1401.6 4441.8 49 4.067 63.6 1 K.SQELKKEEPTIV.T YOR237W 1 1 2.8% 434 49505 7.2 U HES1 SGDID:S000005763, Chr XV from 781994-783298, Verified ORF, "Protein implicated in the regulation of ergosterol biosynthesis; one of a seven member gene family with a common essential function and non-essential unique functions; similar to human oxysterol binding protein (OSBP)" * 122805-Holinger-03_itms_27.16874.16874.2 2.2628 0.0189 98.2 1338.7523 1340.3428 6401.2 2 4.402 54.5 1 S.NDVEKASEDDAF.R YDL066W 1 1 2.8% 428 48190 8.8 U IDP1 SGDID:S000002224, Chr IV from 334835-336121, Verified ORF, "Mitochondrial NADP-specific isocitrate dehydrogenase, catalyzes the oxidation of isocitrate to alpha-ketoglutarate; not required for mitochondrial respiration and may function to divert alpha-ketoglutarate to biosynthetic processes" * 122805-Holinger-03_itms_9.06871.06871.2 2.4464 0.0889 93.9 1441.718 1441.6915 4150.0 17 3.954 54.5 1 M.SMLSRRLFSTSR.L YJL026W 1 1 2.8% 399 46147 5.2 U RNR2 SGDID:S000003563, Chr X from 392320-393519, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits" * 122805-Holinger-03_itms_12.08430.08430.2 2.572 0.123 92.3 1352.7334 1353.5579 6516.4 23 3.861 65.0 1 Y.IKDPKESEFLF.N YIL122W 1 1 2.8% 351 39498 8.9 U POG1 SGDID:S000001384, Chr IX from 130607-131662, Verified ORF, "Putative transcriptional activator that promotes recovery from pheromone induced arrest; inhibits both alpha-factor induced G1 arrest and repression of CLN1 and CLN2 via SCB/MCB promoter elements; potential Cdc28p substrate; SBF regulated" * 122805-Holinger-02_itms_22.14367.14367.2 2.4656 0.1422 94.4 1016.68555 1019.0562 3205.2 5 3.976 72.2 1 E.QHTSLSSGTT.V YBR145W 1 1 2.8% 351 37648 6.4 U ADH5 SGDID:S000000349, Chr II from 533756-534811, Verified ORF, "Alcohol dehydrogenase isoenzyme V; involved in ethanol production" * 122805-Holinger-03_itms_7.05526.05526.2 2.4738 0.1689 95.4 1111.6305 1109.2212 5933.2 5 4.075 72.2 1 D.FTEEKDIVGA.I YNL002C 1 1 2.8% 322 36559 9.5 U RLP7 SGDID:S000004947, Chr XIV from 627144-626176, reverse complement, Verified ORF, "Nucleolar protein with similarity to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs" * 122805-Holinger-02_itms_11.07902.07902.2 1.9552 0.0106 95.9 1039.5748 1039.1736 6895.1 338 4.126 68.8 1 C.VEDIIHEIA.T YBR183W 1 1 2.8% 316 36420 8.3 U YPC1 SGDID:S000000387, Chr II from 596110-597060, Verified ORF, "Alkaline ceramidase that also has reverse (CoA-independent) ceramide synthase activity, catalyzes both breakdown and synthesis of phytoceramide; overexpression confers fumonisin B1 resistance" * 122805-Holinger-05_itms_10.08243.08243.2 2.0922 0.0544 96.5 934.53406 935.0215 7252.6 29 4.177 68.8 1 N.YPESSVPGV.W YGL081W 1 1 2.8% 320 36390 5.1 U YGL081W SGDID:S000003049, Chr VII from 357380-358342, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_8.06642.06642.2 1.8897 0.1067 92.4 1091.631 1093.3184 4432.0 48 3.863 62.5 1 R.TKIKKTLTC.F Reverse_YOR040W 1 1 2.8% 285 32339 7.5 U GLO4 SGDID:S000005566, Chr XV from 407063-407920, Verified ORF, "Mitochondrial glyoxalase II, catalyzes the hydrolysis of S-D-lactoylglutathione into glutathione and D-lactate" * 122805-Holinger-04_itms_17.11695.11695.2 1.5446 0.1552 95.4 914.9869 916.02496 4055.9 338 4.082 57.1 1 V.ALRVARDD.L YPL231W 4 4 2.7% 1887 206945 5.4 U FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" * 122805-Holinger-05_itms_14.10418.10418.2 1.7483 0.1925 92.0 1480.0488 1478.824 5942.9 59 3.842 45.8 1 T.IPFLHLRKKTPAG.D * 122805-Holinger-02_itms_13.08995.08995.2 2.578 0.1275 91.7 1121.6036 1122.3062 6858.1 16 3.817 75.0 1 Q.LDFPELKPY.K * 122805-Holinger-03_itms_5.04453.04453.2 3.8143 0.2026 99.6 1902.0514 1903.1399 6472.0 1 5.163 56.2 1 W.VDSKTKEPVDDKDVKAK.Y * 122805-Holinger-03_itms_12.08346.08346.2 1.9583 0.0722 97.2 1231.6643 1232.3818 4342.7 21 4.264 54.5 1 L.GRSEGNPVIGVF.Q YJR137C 3 3 2.7% 1442 161218 5.5 U ECM17 SGDID:S000003898, Chr X from 683200-678872, reverse complement, Verified ORF, "Sulfite reductase beta subunit, involved in amino acid biosynthesis, transcription repressed by methionine" * 122805-Holinger-04_itms_14.09890.09890.2 2.3358 0.1274 97.5 1248.6858 1249.4521 5735.7 2 4.316 65.0 1 A.TSSLTPVFHFL.N * 122805-Holinger-05_itms_8.06766.06766.2 2.3442 0.1053 90.4 1706.9423 1708.909 7317.8 134 3.75 42.9 1 I.FQLLQSNQDSSTVLK.F * 122805-Holinger-05_itms_14.10602.10602.2 1.8112 0.0427 91.1 1511.1925 1509.6586 10008.9 1 3.793 58.3 1 L.KETKNAVESGYWP.L YGR264C 2 2 2.7% 751 85678 6.6 U MES1 SGDID:S000003496, Chr VII from 1021859-1019604, reverse complement, Verified ORF, "Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs" * 122805-Holinger-03_itms_15.09950.09950.2 2.8487 0.1682 97.0 1108.6251 1109.3104 5427.1 2 4.248 81.2 1 R.NTKEPFLLF.D * 122805-Holinger-05_itms_9.07449.07449.2 2.0784 0.1149 91.6 1120.6315 1121.2816 5598.7 228 3.814 55.0 1 N.NVPHLGNIIGS.V Reverse_YIL144W 1 1 2.7% 691 80487 8.7 U TID3 SGDID:S000001406, Chr IX from 78074-80149, Verified ORF, "Component of the evolutionarily conserved kinetochore-associated Ndc80 complex (Ndc80p-Nuf2p-Spc24p-Spc25p); conserved coiled-coil protein involved in chromosome segregation, spindle checkpoint activity, kinetochore assembly and clustering" * 122805-Holinger-06_itms_10.09231.09231.3 1.9198 0.2336 98.1 2370.551 2372.7417 5335.6 302 4.286 22.2 1 T.KIKQSIKMVEQYKEYLNDN.Q YGR128C 2 2 2.7% 713 80191 5.2 U UTP8 SGDID:S000003360, Chr VII from 750096-747955, reverse complement, Verified ORF, "Nucleolar protein required for export of tRNAs from the nucleus; also copurifies with the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-04_itms_12.08864.08864.2 3.2186 0.2647 99.4 1306.7648 1307.5754 7455.9 8 4.879 75.0 1 Q.YIINPTPKLTF.D * 122805-Holinger-03_itms_11.07515.07515.2 2.5033 0.131 98.4 856.5645 857.08124 5238.5 11 4.421 85.7 1 D.SSVILKPL.F Reverse_YKL220C 1 1 2.7% 711 80072 9.1 U FRE2 SGDID:S000001703, Chr XI from 11227-9092, reverse complement, Verified ORF, "Ferric reductase and cupric reductase, reduces siderophore-bound iron and oxidized copper prior to uptake by transporters; expression induced by low iron levels but not by low copper levels" * 122805-Holinger-04_itms_13.09213.09213.2 2.2729 0.1195 90.9 1821.7122 1820.1453 8129.9 237 3.782 33.3 1 S.QKGAAASTKGLKIAHAIPG.P YFR037C 1 1 2.7% 557 63168 5.4 U RSC8 SGDID:S000001933, Chr VI from 229173-227500, reverse complement, Verified ORF, "One of 15 subunits of the 'Remodel the Structure of Chromatin' (RSC) complex; essential for viability and mitotic growth; homolog of SWI/SNF subunit Swi3p, but unlike Swi3p, does not activate transcription of reporters" * 122805-Holinger-03_itms_14.09381.09381.2 3.1552 0.309 100.0 1652.9585 1653.9591 5691.0 1 5.955 67.9 1 Q.VVLDTPQGLKPFLPE.N Reverse_YKR072C 1 1 2.7% 562 62478 4.7 U SIS2 SGDID:S000001780, Chr XI from 577765-576077, reverse complement, Verified ORF, "Negative regulatory subunit of the protein phosphatase 1 Ppz1p; involved in ion homeostasis and cell cycle progression" * 122805-Holinger-06_itms_6.06864.06864.2 1.0984 0.2503 98.9 1566.6445 1564.8253 5881.0 203 4.607 21.4 1 A.PVRKLGPEPTNSVVA.G YPL179W 1 1 2.7% 549 61421 9.3 U PPQ1 SGDID:S000006100, Chr XVI from 208156-209805, Verified ORF, "Putative protein serine/threonine phosphatase; null mutation enhances efficiency of translational suppressors" * 122805-Holinger-04_itms_15.10266.10266.3 2.7629 0.0948 92.5 1534.714 1533.545 5537.1 347 3.961 39.3 1 S.YYSSATSASSSTSSF.L Reverse_YJL111W 1 1 2.7% 550 59736 5.5 U CCT7 SGDID:S000003647, Chr X from 207794-209446, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" * 122805-Holinger-05_itms_10.08193.08193.2 2.5624 0.1295 93.6 1736.0413 1735.9594 5410.1 169 3.941 39.3 1 L.DNRDLSLVADVCMKV.F YBL054W 1 1 2.7% 525 59226 9.3 U YBL054W SGDID:S000000150, Chr II from 117592-119169, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.08973.08973.2 3.1164 0.368 100.0 1642.9856 1643.967 6681.1 1 6.051 65.4 1 N.DYENIGLVPKIIIR.S YPR034W 1 1 2.7% 477 53810 5.5 U ARP7 SGDID:S000006238, Chr XVI from 639522-640955, Verified ORF, "Actin-related protein involved in transcriptional regulation; subunit of the chromatin remodeling Snf/Swi complex" * 122805-Holinger-03_itms_14.09271.09271.2 3.1065 0.2142 99.0 1437.8837 1438.7478 6509.6 1 4.657 70.8 1 Q.LKVSPEELPLVIT.M YMR208W 1 1 2.7% 443 48460 5.6 U ERG12 SGDID:S000004821, Chr XIII from 684466-685797, Verified ORF, "Mevalonate kinase, acts in the biosynthesis of isoprenoids and sterols, including ergosterol, from mevalonate" * 122805-Holinger-03_itms_28.17338.17338.2 1.4608 0.1051 94.5 1500.7914 1500.6952 5521.8 209 3.989 36.4 1 T.LLRRDITQEQID.S YNL248C 1 1 2.7% 415 46651 9.5 U RPA49 SGDID:S000005192, Chr XIV from 182609-181362, reverse complement, Verified ORF, "RNA polymerase I subunit A49" * 122805-Holinger-02_itms_10.07561.07561.2 2.1649 0.1765 97.9 1159.5349 1160.3127 5067.9 1 4.358 75.0 1 S.AIDIVDSVRTA.S Reverse_YGL048C 1 1 2.7% 405 45272 9.0 U RPT6 SGDID:S000003016, Chr VII from 411289-410072, reverse complement, Verified ORF, "One of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle" * 122805-Holinger-06_itms_14.11254.11254.2 1.5582 0.156 92.1 1301.0472 1301.423 7216.9 32 3.851 50.0 1 R.ERLAYMGAETC.V Reverse_YOR388C 1 1 2.7% 376 41714 6.5 U FDH1 SGDID:S000005915, Chr XV from 1072919-1071789, reverse complement, Verified ORF, "NAD(+)-dependent formate dehydrogenase, may protect cells from exogenous formate" * 122805-Holinger-04_itms_5.04423.04423.2 2.1241 0.1266 95.1 1065.5875 1066.2017 4006.5 37 4.037 61.1 1 D.WVDGGYGALK.G YOL010W 1 1 2.7% 367 40171 8.8 U RCL1 SGDID:S000005370, Chr XV from 307938-309041, Verified ORF, "RNA terminal phosphate cyclase-like protein involved in rRNA processing at sites A0, A1, and A2; does not possess detectable RNA cyclase activity" * 122805-Holinger-04_itms_12.08616.08616.2 2.5408 0.1385 97.1 1015.57574 1016.1851 7899.1 75 4.26 66.7 1 S.GKSPGWGITL.V YIL094C 1 1 2.7% 371 40069 8.0 U LYS12 SGDID:S000001356, Chr IX from 187629-186514, reverse complement, Verified ORF, "Homo-isocitrate dehydrogenase, an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine, in which homo-isocitrate is oxidatively decarboxylated to alpha-ketoadipate" * 122805-Holinger-02_itms_22.14555.14555.1 1.6715 0.2652 90.0 1162.8339 1162.3774 5880.6 59 4.724 44.4 1 G.YSSPIVALRR.E YPR061C 1 1 2.7% 301 35028 9.0 U JID1 SGDID:S000006265, Chr XVI from 676879-675974, reverse complement, Verified ORF, "Probable Hsp40p co-chaperone, has a DnaJ-like domain and appears to be involved in ER-associated degradation of misfolded proteins containing a tightly folded cytoplasmic domain; inhibits replication of Brome mosaic virus in S. cerevisiae" * 122805-Holinger-01_itms_24.16239.16239.1 1.4174 0.1598 97.5 728.45746 727.79535 2825.3 45 5.214 57.1 1 I.PKAGSGNP.K Reverse_YML112W 1 1 2.7% 296 34809 6.3 U CTK3 SGDID:S000004580, Chr XIII from 45063-45953, Verified ORF, "Gamma subunit of C-terminal domain kinase I (CTDK-I), which phosphorylates the C-terminal repeated domain of the RNA polymerase II large subunit (Rpo21p) to affect both transcription and pre-mRNA 3' end processing" * 122805-Holinger-01_itms_15.10982.10982.1 1.6666 0.1873 91.3 849.4291 847.9408 3144.9 26 4.824 64.3 1 D.ILTTDSPT.H YLR146C 1 1 2.7% 300 34091 5.1 U SPE4 SGDID:S000004136, Chr XII from 433726-432824, reverse complement, Verified ORF, "Spermine synthase, required for the biosynthesis of spermine and also involved in biosynthesis of pantothenic acid" * 122805-Holinger-03_itms_10.07168.07168.2 1.2726 0.0527 98.8 826.51807 826.9279 1852.7 126 4.531 71.4 1 D.IGASDVHK.K Reverse_YJL098W 1 1 2.6% 1058 121402 4.4 U SAP185 SGDID:S000003634, Chr X from 241999-245175, Verified ORF, "Protein that forms a complex with the Sit4p protein phosphatase and is required for its function; member of a family of similar proteins including Sap4p, Sap155p, and Sap190p" * 122805-Holinger-04_itms_15.10370.10370.2 1.0936 0.1599 98.0 2934.0322 2932.543 5048.2 22 4.373 17.3 1 L.EIIIGVGNNLSNGGKLMIDMLQKMMNP.S Reverse_YOL063C 1 1 2.6% 957 109715 5.7 U YOL063C SGDID:S000005424, Chr XV from 210264-207391, reverse complement, Uncharacterized ORF, "Protein required for normal hydroxyurea resistance; not related to the HUS1 checkpoint protein identified in human and fission yeast" * 122805-Holinger-04_itms_23.14714.14714.2 1.3632 0.1243 94.7 2768.5056 2767.0708 5442.5 198 4.014 18.8 1 R.GSTNQYQSTKNRGSPTILQPFTNII.D YPL180W 1 1 2.6% 799 88845 8.1 U TCO89 SGDID:S000006101, Chr XVI from 205247-207646, Verified ORF, "Subunit of TORC1 (Tor1p or Tor2p-Kog1p-Lst8p-Tco89p), a complex that regulates growth in response to nutrient availability; cooperates with Ssd1p in the maintenance of cellular integrity; deletion strains are hypersensitive to rapamycin" * 122805-Holinger-05_itms_24.16035.16035.3 2.5321 0.127 90.1 2296.5896 2296.5918 10066.2 125 3.842 27.5 1 H.KKGNQNLLLRSNDLNKNSAAP.A YJL206C 1 1 2.6% 758 86663 8.0 U YJL206C SGDID:S000003741, Chr X from 49935-47659, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-06_itms_8.08143.08143.3 1.7644 0.1027 94.3 2170.2676 2169.523 5970.5 302 4.039 19.7 1 P.LIYSVLAVGALFSKEDLSKD.S YOR254C 1 1 2.6% 663 75345 5.3 U SEC63 SGDID:S000005780, Chr XV from 807022-805031, reverse complement, Verified ORF, "Essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and Lhs1p forms a channel competent for SRP-dependent and post-translational SRP-independent protein targeting and import into the ER" * 122805-Holinger-04_itms_12.08779.08779.2 4.1077 0.3056 100.0 1782.998 1784.0624 7555.4 1 6.069 65.6 1 G.TIKIPLGQPAPETVGDF.F YFR023W 1 1 2.6% 611 70842 9.5 U PES4 SGDID:S000001919, Chr VI from 199862-201697, Verified ORF, "Poly(A) binding protein, suppressor of DNA polymerase epsilon mutation, similar to Mip6p" * 122805-Holinger-02_itms_19.12676.12676.3 2.3067 0.13 91.2 1798.6836 1795.9896 4393.6 215 3.912 26.7 1 D.SVTKKSLGHGYLNFED.K YGR171C 1 1 2.6% 575 66735 8.8 U MSM1 SGDID:S000003403, Chr VII from 842556-840829, reverse complement, Verified ORF, "Mitochondrial methionyl-tRNA synthetase (MetRS), functions as a monomer in mitochondrial protein synthesis; functions similarly to cytoplasmic MetRS although the cytoplasmic form contains a zinc-binding domain not found in Msm1p" * 122805-Holinger-02_itms_10.07589.07589.3 2.3192 0.1017 93.1 1625.0753 1623.8497 5482.1 212 4.002 35.7 1 G.IPSILSNATEVVSRH.Y YGR055W 1 1 2.6% 574 63221 7.7 U MUP1 SGDID:S000003287, Chr VII from 599421-601145, Verified ORF, "High affinity methionine permease, integral membrane protein with 13 putative membrane-spanning regions; also involved in cysteine uptake" * 122805-Holinger-05_itms_12.08988.08988.2 2.464 0.0198 92.8 1703.9437 1705.9542 6716.0 13 3.882 50.0 1 I.IQQLGREGVLPFSNF.F Reverse_YMR290C 1 1 2.6% 505 56718 9.3 U HAS1 SGDID:S000004903, Chr XIII from 851590-850073, reverse complement, Verified ORF, "ATP-dependent RNA helicase; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles" * 122805-Holinger-04_itms_21.13990.13990.2 1.8685 0.0988 92.8 1281.0056 1281.5411 3839.2 227 3.891 50.0 1 T.KAAGLVDRGALLP.P Reverse_YCL040W 1 1 2.6% 500 55377 6.2 U GLK1 SGDID:S000000545, Chr III from 50838-52340, Verified ORF, "Glucokinase, catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources" * 122805-Holinger-04_itms_26.16426.16426.2 1.7512 0.164 93.7 1385.9922 1386.3839 6335.4 4 3.946 54.2 1 P.ESIEGSTMSDTND.S YML126C 1 1 2.6% 491 55014 8.2 U ERG13 SGDID:S000004595, Chr XIII from 20536-19061, reverse complement, Verified ORF, "3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase, catalyzes the formation of HMG-CoA from acetyl-CoA and acetoacetyl-CoA; involved in the second step in mevalonate biosynthesis" * 122805-Holinger-05_itms_7.06612.06612.2 2.842 0.0232 95.3 1417.8903 1418.7172 7867.9 115 4.046 54.2 1 E.TLIDKSKSVKSVL.M Reverse_YPR152C 1 1 2.6% 465 54139 4.7 U YPR152C SGDID:S000006356, Chr XVI from 833454-832057, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_5.04242.04242.2 1.2498 0.0536 92.3 1422.6113 1425.4889 1801.5 25 3.859 40.9 1 H.YKTPELVESDDE.S YPR157W 1 1 2.6% 467 53809 7.5 U YPR157W SGDID:S000006361, Chr XVI from 841262-842665, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_26.16607.16607.2 2.0492 0.1238 94.3 1299.8777 1297.3331 6492.6 431 3.972 50.0 1 G.LDSESTDLMGDN.C Reverse_YNL016W 1 1 2.6% 453 50763 5.1 U PUB1 SGDID:S000004961, Chr XIV from 602908-604269, Verified ORF, "Poly(A)+ RNA-binding protein, abundant mRNP-component protein hypothesized to bind a pool of non-translatable mRNAs; not reported to associate with polyribosomes" * 122805-Holinger-04_itms_17.11426.11426.2 2.0173 0.1218 98.2 1113.0447 1112.1815 5077.1 1 4.403 63.6 1 S.PDASAPAEVASP.T Reverse_YNL230C 1 1 2.6% 379 43981 10.0 U ELA1 SGDID:S000005174, Chr XIV from 218663-217524, reverse complement, Verified ORF, "Elongin A, F-box protein that forms a heterodimer with Elc1p and participates in transcription elongation" * 122805-Holinger-05_itms_9.07598.07598.2 2.1098 0.0077 90.6 1229.6313 1231.394 7246.7 13 3.775 61.1 1 S.KLLDQNSHYL.E YIR029W 1 1 2.6% 343 38714 6.4 U DAL2 SGDID:S000001468, Chr IX from 410804-411835, Verified ORF, "Allantoicase, converts allantoate to urea and ureidoglycolate in the second step of allantoin degradation; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation" * 122805-Holinger-05_itms_11.08591.08591.2 2.1297 0.1145 93.6 1004.4913 1005.02936 6828.0 132 3.94 62.5 1 E.GNIVEDDSR.W Reverse_YPR127W 1 1 2.6% 345 38601 6.0 U YPR127W SGDID:S000006331, Chr XVI from 790079-791116, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_8.06651.06651.2 1.7632 0.0568 93.5 844.50793 844.9835 4540.4 51 3.938 62.5 1 S.IGGIVGESI.M YGR283C 1 1 2.6% 341 38546 9.3 U YGR283C SGDID:S000003515, Chr VII from 1060046-1059021, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; deletion mutant is resistant to fluconazole; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus" * 122805-Holinger-03_itms_14.09670.09670.2 1.7562 0.1277 90.5 1018.99066 1019.2321 3786.7 173 3.765 62.5 1 Y.QIARTAVLF.N Reverse_YGR104C 1 1 2.6% 307 34289 5.0 U SRB5 SGDID:S000003336, Chr VII from 698372-697449, reverse complement, Verified ORF, "Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; essential for transcriptional regulation" * 122805-Holinger-02_itms_6.05108.05108.2 2.0475 0.0384 93.2 947.4881 948.03864 4592.1 182 3.924 71.4 1 S.DMSQRDPV.S YCL019W 4 4 2.5% 1770 202095 8.2 U YCL019W SGDID:S000000524, Chr III from 85101-86390,86392-90414, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" YGR161W-B 4 4 2.5% 1770 202038 8.0 U YGR161W-B SGDID:S000007370, Chr VII from 811743-813035,813037-817056, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" YFL002W-A 4 4 2.5% 1770 202038 8.0 U YFL002W-A SGDID:S000002962, Chr VI from 138199-139491,139493-143512, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-02_itms_5.04426.04426.2 3.366 0.2486 100.0 1367.6786 1368.4459 4740.7 1 5.74 68.2 1 Q.NQHSEVPQAETK.V 122805-Holinger-04_itms_14.09598.09598.2 2.7675 0.2627 99.8 1416.8059 1417.688 10218.8 1 5.21 63.6 1 N.SYGYIIYLPSLK.K 122805-Holinger-03_itms_15.10275.10275.2 3.1459 0.245 99.5 1448.7905 1449.6439 4096.5 1 5.07 66.7 1 D.SILDDLPLPDLTH.Q 122805-Holinger-04_itms_8.06426.06426.2 2.1728 0.0457 93.5 894.55786 895.0898 3703.7 26 3.936 78.6 1 K.LNVPLNPK.G YMR129W 3 3 2.5% 1337 151652 6.7 U POM152 SGDID:S000004736, Chr XIII from 527803-531816, Verified ORF, "Nuclear pore membrane glycoprotein; may be involved in duplication of nuclear pores and nuclear pore complexes during S-phase;" * 122805-Holinger-02_itms_14.09645.09645.2 2.2908 0.0716 97.2 1244.6738 1242.4167 7019.4 2 4.266 72.2 1 A.FNFFEPIKEA.K * 122805-Holinger-04_itms_10.07512.07512.2 2.7114 0.2412 99.7 1473.8208 1474.697 5732.9 3 5.175 58.3 1 L.KLPNQIPGEYITT.I * 122805-Holinger-05_itms_9.07377.07377.2 2.0477 0.0878 91.8 1177.6792 1178.3739 5910.1 20 3.823 65.0 1 L.SLNIHPIPSVT.V YER151C 2 2 2.5% 912 101917 7.8 U UBP3 SGDID:S000000953, Chr V from 472419-469681, reverse complement, Verified ORF, "Ubiquitin-specific protease that interacts with Bre5p to co-regulate anterograde and retrograde transport between endoplasmic reticulum and Golgi compartments; inhibitor of gene silencing; cleaves ubiquitin fusions but not polyubiquitin" * 122805-Holinger-03_itms_15.10196.10196.2 2.8088 0.2594 99.4 1429.8574 1430.7277 7105.2 1 4.868 66.7 1 R.TVEIVPSPISKLF.G * 122805-Holinger-03_itms_14.09387.09387.2 2.7443 0.1044 95.5 1173.7109 1174.4258 6532.7 6 4.084 77.8 1 Q.TFIDKLPQVL.L YLR045C 3 3 2.5% 888 100918 8.6 U STU2 SGDID:S000004035, Chr XII from 237704-235038, reverse complement, Verified ORF, "Microtubule-associated protein (MAP) of the XMAP215/Dis1 family; regulates microtubule dynamics during spindle orientation and metaphase chromosome alignment; interacts with spindle pole body component Spc72p" * 122805-Holinger-03_itms_16.10547.10547.2 4.046 0.3283 100.0 1491.7998 1492.669 7228.0 1 6.184 75.0 1 T.GNNSDLLEEILFK.K * 122805-Holinger-03_itms_16.10647.10647.2 2.9712 0.0785 99.0 1320.7328 1321.5132 5803.6 3 4.617 70.0 1 N.NSDLLEEILFK.K * 122805-Holinger-04_itms_7.05721.05721.2 2.5589 0.1588 94.2 1127.6737 1128.317 5269.0 1 3.963 87.5 1 K.LNEKNIQLR.S YOL006C 1 1 2.5% 769 89995 8.7 U TOP1 SGDID:S000005366, Chr XV from 315387-313078, reverse complement, Verified ORF, "Topoisomerase I, nuclear enzyme that relieves torsional strain in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled DNA; functions in replication, transcription, and recombination" * 122805-Holinger-03_itms_18.11948.11948.2 2.0028 0.15 90.4 2296.8147 2294.6646 11753.2 2 3.763 41.7 1 L.TIFKRPPKQPGHQLFDRLD.P YLR260W 1 1 2.5% 687 77566 6.9 U LCB5 SGDID:S000004250, Chr XII from 665846-667909, Verified ORF, "Minor sphingoid long-chain base kinase, paralog of Lcb4p responsible for few percent of the total activity, possibly involved in synthesis of long-chain base phosphates, which function as signaling molecules" * 122805-Holinger-06_itms_7.07357.07357.2 1.4958 0.1533 93.1 2107.8406 2110.4797 3155.8 56 3.916 28.1 1 P.SKRRKGRSRHSRKKQIT.S Reverse_YOL148C 1 1 2.5% 604 67797 9.6 U SPT20 SGDID:S000005508, Chr XV from 47572-45758, reverse complement, Verified ORF, "Subunit of the SAGA transcriptional regulatory complex, involved in maintaining the integrity of the complex" * 122805-Holinger-06_itms_20.14837.14837.2 1.5081 0.1486 97.6 1606.1111 1607.8278 6045.5 131 4.324 32.1 1 N.SNTRMVPHNVNAVAP.N YLR314C 1 1 2.5% 520 60039 5.5 U CDC3 SGDID:S000004306, Chr XII from 764137-762575, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM" * 122805-Holinger-03_itms_13.08785.08785.2 2.9969 0.1836 99.0 1521.8254 1522.7411 5669.2 32 4.626 50.0 1 Q.SNIELFKPPIYSN.D Reverse_YCL027W 1 1 2.5% 512 57779 9.0 U FUS1 SGDID:S000000532, Chr III from 71803-73341, Verified ORF, "Membrane protein localized to the shmoo tip, required for cell fusion; expression regulated by mating pheromone; proposed to coordinate signaling, fusion, and polarization events required for fusion; potential Cdc28p substrate" * 122805-Holinger-06_itms_8.07765.07765.2 1.629 0.1539 93.9 1692.4218 1690.0044 7774.3 217 3.952 37.5 1 S.VSNRKLYFYCLLI.L YPR036W 1 1 2.5% 478 54416 6.4 U VMA13 SGDID:S000006240, Chr XVI from 643833-645269, Verified ORF, "Subunit H of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase), an electrogenic proton pump found throughout the endomembrane system; serves as an activator or a structural stabilizer of the V-ATPase" * 122805-Holinger-04_itms_14.09589.09589.2 2.1718 0.1585 91.8 1232.9435 1232.3763 6821.3 418 3.824 54.5 1 I.DVLDKTGGKADI.M YKL219W 1 1 2.5% 407 48545 8.6 U COS9 SGDID:S000001702, Chr XI from 14485-15708, Verified ORF, "Protein of unknown function, member of a family of conserved, often subtelomerically-encoded proteins" * 122805-Holinger-06_itms_12.10129.10129.2 1.5464 0.0871 94.4 1292.5764 1290.5944 5455.3 6 3.98 50.0 1 F.TWVLKRIFNL.W Reverse_YBL013W 1 1 2.5% 401 44617 9.6 U FMT1 SGDID:S000000109, Chr II from 202059-203264, Verified ORF, "Methionyl-tRNA formyltransferase, catalyzes the formylation of initiator Met-tRNA in mitochondria; potential Cdc28p substrate" * 122805-Holinger-03_itms_18.11483.11483.2 1.9568 0.1857 92.9 1099.3867 1098.2871 3640.2 1 3.906 66.7 1 K.FAHLPGLTEL.K YBR211C 1 1 2.5% 324 37462 4.9 U AME1 SGDID:S000000415, Chr II from 647127-646153, reverse complement, Verified ORF, "Essential kinetochore protein associated with microtubules and spindle pole bodies, subunit of the COMA complex" * 122805-Holinger-05_itms_11.08468.08468.2 1.4586 0.1164 95.7 872.69196 870.0367 4605.8 6 4.108 78.6 1 V.QPILSSPK.L YHL011C 1 1 2.5% 320 35124 8.3 U PRS3 SGDID:S000001003, Chr VIII from 81612-80650, reverse complement, Verified ORF, "5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, involved in nucleotide, histidine, and tryptophan biosynthesis; one of a five related enzymes, which are active as heteromultimeric complexes" * 122805-Holinger-05_itms_6.05516.05516.2 2.046 0.158 96.1 923.30304 921.0873 4696.1 35 4.145 71.4 1 K.LLAPDVHR.G Reverse_YOL095C 1 1 2.4% 706 80576 8.6 U HMI1 SGDID:S000005455, Chr XV from 141346-139226, reverse complement, Verified ORF, "Mitochondrial inner membrane localized ATP-dependent DNA helicase, required for the maintenance of the mitochondrial genome; not required for mitochondrial transcription" * 122805-Holinger-03_itms_4.03663.03663.2 1.6114 0.1377 96.5 1914.5138 1916.1534 8552.6 4 4.181 37.5 1 E.NEVVIRNALGHVTYCGI.Q Reverse_YGR178C 1 1 2.4% 722 78781 6.9 U PBP1 SGDID:S000003410, Chr VII from 853220-851052, reverse complement, Verified ORF, "Protein interacting with poly(A)-binding protein Pab1p; likely involved in control of the extent of mRNA polyadenylation; also interacts with Mkt1p to form a complex that may regulate translation of the HO mRNA" * 122805-Holinger-04_itms_12.08802.08802.2 2.6694 0.1509 93.7 1668.8994 1670.837 7111.6 162 3.942 43.8 1 A.AMFGAPVHPSINGGGEE.A YDR295C 1 1 2.4% 674 77059 8.7 U HDA2 SGDID:S000002703, Chr IV from 1054641-1052617, reverse complement, Verified ORF, "Subunit of a possibly tetrameric trichostatin A-sensitive class II histone deacetylase complex that contains an Hda1p homodimer and an Hda2p-Hda3p heterodimer; required for the activity of the complex; has similarity to Hda3p; Ploidy-related" * 122805-Holinger-05_itms_20.14009.14009.3 2.4488 0.174 94.6 1918.5289 1919.1941 4681.3 1 4.085 43.3 1 F.RTKRLSGTSLYNEKHK.F Reverse_YOR389W 1 1 2.4% 624 70221 5.1 U YOR389W SGDID:S000005916, Chr XV from 1074209-1076083, Uncharacterized ORF, "Hypothetical protein" Reverse_YPL277C 1 1 3.1% 487 54538 5.7 U YPL277C SGDID:S000006198, Chr XVI from 16868-15405, reverse complement, Uncharacterized ORF, "Hypothetical protein" 122805-Holinger-06_itms_13.10672.10672.2 1.9461 0.0927 97.2 1745.9653 1747.0137 9002.7 1 4.275 50.0 1 G.VELAKELDDVMDLQK.E YGR124W 2 2 2.4% 572 64593 5.9 U ASN2 SGDID:S000003356, Chr VII from 739949-741667, Verified ORF, "Asparagine synthetase, isozyme of Asn1p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" * 122805-Holinger-05_itms_13.09637.09637.2 3.3791 0.1492 99.4 1690.9479 1691.9677 7906.9 16 4.982 53.8 1 L.EARVPFLDKDFLQL.C * 122805-Holinger-03_itms_14.09277.09277.2 2.2242 0.1815 97.7 1221.6735 1222.4265 7332.6 19 4.334 72.2 1 R.VPFLDKDFLQ.L Reverse_YBR200W 1 1 2.4% 551 61605 8.6 U BEM1 SGDID:S000000404, Chr II from 620867-622522, Verified ORF, "Protein containing SH3-domains, involved in establishing cell polarity and morphogenesis; functions as a scaffold protein for complexes that include Cdc24p, Ste5p, Ste20p, and Rsr1p" * 122805-Holinger-05_itms_11.08537.08537.2 2.0781 0.1393 98.1 1358.3033 1357.3733 7561.1 2 4.381 54.2 1 S.TQSATAFTATDNE.Q YKR016W 1 1 2.4% 540 61082 6.6 U YKR016W SGDID:S000001724, Chr XI from 469360-470982, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" * 122805-Holinger-01_itms_14.10359.10359.2 1.8881 0.0955 94.6 1614.9467 1617.8942 5696.9 304 4.008 37.5 1 S.KKASHKFRNTLWT.I YMR297W 1 1 2.4% 532 59802 4.7 U PRC1 SGDID:S000004912, Chr XIII from 861921-863519, Verified ORF, "Vacuolar carboxypeptidase Y (proteinase C), involved in protein degradation in the vacuole and required for full protein degradation during sporulation" * 122805-Holinger-03_itms_11.07902.07902.2 2.4545 0.242 96.6 1370.7544 1371.576 5777.8 25 4.185 54.2 1 S.SIGPDLKPIGNPY.S YBL099W 1 1 2.4% 545 58618 9.0 U ATP1 SGDID:S000000195, Chr II from 37050-38687, Verified ORF, "Alpha subunit of the F1 sector of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis" * 122805-Holinger-05_itms_7.06610.06610.2 3.5004 0.2731 99.7 1323.7993 1324.5662 5089.8 1 5.176 66.7 1 L.KAVDALVPIGRGQ.R Reverse_YLR227C 1 1 2.4% 493 57833 6.3 U ADY4 SGDID:S000004217, Chr XII from 592045-590564, reverse complement, Verified ORF, "Structural component of the meiotic outer plaque, which is a membrane-organizing center that assembles on the cytoplasmic face of the spindle pole body during meiosis II and triggers the formation of the prospore membrane" * 122805-Holinger-04_itms_8.06162.06162.2 1.2498 0.0317 90.5 1409.8267 1409.6683 2691.0 55 3.77 50.0 1 P.IYLALFDRILDG.N YFL021W 1 1 2.4% 510 56328 8.6 U GAT1 SGDID:S000001873, Chr VI from 95964-97496, Verified ORF, "Transcriptional activator of genes involved in nitrogen catabolite repression, member of the GATA family of DNA binding proteins; activity and localization regulated by nitrogen limitation and Ure2p" * 122805-Holinger-03_itms_11.08017.08017.2 3.1768 0.2036 98.6 1379.7512 1380.5437 4337.5 189 4.484 59.1 1 N.RVPNLDPDLNLN.K YEL041W 1 1 2.4% 495 55874 5.8 U YEL041W SGDID:S000000767, Chr V from 75944-77431, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_8.06583.06583.2 2.5769 0.0623 90.3 1408.6547 1409.6837 7607.2 152 3.743 59.1 1 N.DISTVFLMREVV.E Reverse_YPR157W 1 1 2.4% 467 53809 7.5 U YPR157W SGDID:S000006361, Chr XVI from 841262-842665, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_4.03815.03815.2 1.7262 0.0637 93.3 1182.5844 1184.1737 4218.8 144 3.926 45.0 1 C.NDGMLDTSESD.L YNL142W 1 1 2.4% 499 53401 6.7 U MEP2 SGDID:S000005086, Chr XIV from 357455-358954, Verified ORF, "Ammonium permease involved in regulation of pseudohyphal growth; belongs to a ubiquitous family of cytoplasmic membrane proteins that transport only ammonium (NH4+); expression is under the nitrogen catabolite repression regulation" * 122805-Holinger-04_itms_8.06524.06524.2 2.1336 0.1027 92.9 1049.5834 1049.0392 4876.8 282 3.892 50.0 1 F.TGTPTGEGTGGN.S YML005W 1 1 2.4% 462 52727 7.8 U TRM12 SGDID:S000004464, Chr XIII from 260221-261609, Verified ORF, "S-adenosylmethionine-dependent methyltransferase of the seven beta-strand family; required for wybutosine formation in phenylalanine-accepting tRNA" * 122805-Holinger-06_itms_7.07401.07401.2 1.4366 0.2287 96.1 1214.6302 1217.3237 2757.1 2 4.143 40.0 1 K.SFLKDHGLAND.K YGL111W 1 1 2.4% 463 51907 7.8 U NSA1 SGDID:S000003079, Chr VII from 299981-301372, Verified ORF, "Constituent of 66S pre-ribosomal particles, involved in 60S ribosomal subunit biogenesis" * 122805-Holinger-04_itms_13.09390.09390.2 2.3589 0.1165 98.6 1173.7083 1174.4258 7857.0 12 4.48 65.0 1 A.SLGLKAPVEFL.Q Reverse_YER027C 1 1 2.4% 417 46648 4.9 U GAL83 SGDID:S000000829, Chr V from 210231-208978, reverse complement, Verified ORF, "One of three possible beta-subunits of the Snf1 kinase complex, allows nuclear localization of the Snf1 kinase complex in the presence of a nonfermentable carbon source; contains glycogen-binding domain" * 122805-Holinger-05_itms_8.06857.06857.2 2.1496 0.186 97.7 1107.6635 1109.2242 4730.1 171 4.338 55.6 1 T.QANSYSNLIV.N YPR078C 1 1 2.4% 372 42594 5.5 U YPR078C SGDID:S000006282, Chr XVI from 698262-697144, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_13.09295.09295.2 2.0293 0.0403 93.3 1000.58344 999.2419 3856.0 143 3.93 62.5 1 R.KNKSKLALP.S YGR173W 1 1 2.4% 368 41006 8.6 U RBG2 SGDID:S000003405, Chr VII from 843859-844965, Uncharacterized ORF, "Protein with similarity to mammalian developmentally regulated GTP-binding protein" * 122805-Holinger-02_itms_8.06406.06406.2 2.5613 0.1251 91.0 1128.522 1129.0883 5570.3 75 3.789 75.0 1 R.DDQCTIDDF.I YLL013C 2 2 2.3% 879 98068 7.2 U PUF3 SGDID:S000003936, Chr XII from 124713-122074, reverse complement, Verified ORF, "Protein that regulates degradation of specific mRNAs such as COX17, binds almost exclusively to cytoplasmic mRNAs encoding mitochondrial proteins, member of the PUF protein family that contains Pumilio homology domains" * 122805-Holinger-05_itms_12.08931.08931.2 1.7273 0.098 90.5 1098.3098 1099.1887 5587.2 277 3.764 50.0 1 S.NNPAAVGATNVA.L * 122805-Holinger-03_itms_8.06290.06290.2 1.7262 0.2183 99.0 809.42804 809.99896 4662.2 146 4.654 64.3 1 F.MPPPPLSA.P YPR181C 1 1 2.3% 768 85385 5.7 U SEC23 SGDID:S000006385, Chr XVI from 899663-897357, reverse complement, Verified ORF, "GTPase-activating protein; component of the Sec23p-Sec24p heterodimeric complex of the COPII vesicle coat, involved in ER to Golgi transport and autophagy; stimulates the GDP-bound form of Sar1p" * 122805-Holinger-05_itms_15.10824.10824.2 2.6859 0.1183 99.3 2127.2034 2127.531 4053.3 13 4.728 44.1 1 T.TIEYITNKPVTVPPIFFF.V Reverse_YBL060W 1 1 2.3% 687 78768 6.4 U YBL060W SGDID:S000000156, Chr II from 107934-109997, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-06_itms_16.12573.12573.2 1.1271 0.119 94.8 1821.7156 1818.9751 3181.5 181 4.017 16.7 1 D.KFYDITASDTESSQII.D YOL011W 1 1 2.3% 686 75077 5.0 U PLB3 SGDID:S000005371, Chr XV from 305349-307409, Verified ORF, "Phospholipase B (lysophospholipase) involved in phospholipid metabolism; hydrolyzes phosphatidylinositol and phosphatidylserine and displays transacylase activity in vitro" * 122805-Holinger-06_itms_9.08504.08504.2 1.1344 0.0041 91.1 1891.9768 1890.0564 3914.6 96 3.789 23.3 1 S.PNPFKDTKFLDSDYTT.S YMR108W 1 1 2.3% 687 74937 8.5 U ILV2 SGDID:S000004714, Chr XIII from 484083-486146, Verified ORF, "Acetolactate synthase, catalyses the first common step in isoleucine and valine biosynthesis and is the target of several classes of inhibitors, localizes to the mitochondria; expression of the gene is under general amino acid control" * 122805-Holinger-03_itms_13.09025.09025.2 3.8057 0.3295 100.0 1656.8687 1657.8662 4497.1 6 6.3 63.3 1 F.GYPGGAILPVYDAIHN.S YER036C 1 1 2.3% 610 68377 6.5 U YER036C SGDID:S000000838, Chr V from 225198-223366, reverse complement, Uncharacterized ORF, "ATPase of the ATP-binding cassette (ABC) family involved in ribosome biogenesis, has similarity to Gcn20p" * 122805-Holinger-04_itms_14.09574.09574.2 2.7589 0.2284 99.3 1531.3972 1532.8229 7310.1 3 4.767 53.8 1 D.GLVQPVVPDKVFSF.R Reverse_YLR055C 1 1 2.3% 602 66190 4.4 U SPT8 SGDID:S000004045, Chr XII from 253081-251273, reverse complement, Verified ORF, "Subunit of the SAGA transcriptional regulatory complex but not present in SAGA-like complex SLIK/SALSA, required for SAGA-mediated inhibition at some promoters" * 122805-Holinger-05_itms_11.08493.08493.2 2.4069 0.1719 94.2 1492.8329 1493.6622 7508.8 158 3.969 42.3 1 P.DLYLNSIIGGHHGP.V YKR002W 1 1 2.3% 568 64552 7.9 U PAP1 SGDID:S000001710, Chr XI from 442875-444581, Verified ORF, "Poly(A) polymerase, one of three factors required for mRNA 3'-end polyadenylation, forms multiprotein complex with polyadenylation factor I (PF I), also required for mRNA nuclear export; may also polyadenylate rRNAs" * 122805-Holinger-04_itms_4.03743.03743.2 2.1951 0.0877 94.2 1489.7389 1486.7977 2505.0 5 3.958 58.3 1 K.WSGLVESKVRLLV.M Reverse_YJL219W 1 1 2.3% 567 62858 8.2 U HXT9 SGDID:S000003755, Chr X from 19497-21200, Verified ORF, "Putative hexose transporter that is nearly identical to Hxt11p, has similarity to major facilitator superfamily (MFS) transporters, expression of HXT9 is regulated by transcription factors Pdr1p and Pdr3p" Reverse_YOL156W 1 1 2.3% 567 62733 8.5 U HXT11 SGDID:S000005516, Chr XV from 25272-26975, Verified ORF, "Putative hexose transporter that is nearly identical to Hxt9p, has similarity to major facilitator superfamily (MFS) transporters and is involved in pleiotropic drug resistance" 122805-Holinger-03_itms_6.04658.04658.3 2.2154 0.0541 93.0 1378.9482 1382.6047 3864.0 139 4.009 33.3 1 E.PPVWSASKWAPVG.E YEL058W 1 1 2.3% 557 62067 5.9 U PCM1 SGDID:S000000784, Chr V from 43252-44925, Verified ORF, "Essential N-acetylglucosamine-phosphate mutase, a hexosephosphate mutase involved in the biosynthesis of chitin" * 122805-Holinger-03_itms_5.04348.04348.2 1.477 0.1743 91.1 1301.6141 1303.501 3327.3 336 3.793 41.7 1 V.PKLFIDTANGIGG.P Reverse_YHR207C 1 1 2.3% 526 60547 6.5 U SET5 SGDID:S000001250, Chr VIII from 516485-514905, reverse complement, Verified ORF, "Zinc-finger protein of unknown function, contains one canonical and two unusual fingers in unusual arrangements; deletion enhances replication of positive-strand RNA virus" * 122805-Holinger-05_itms_11.08738.08738.3 1.9745 0.1554 91.0 1282.323 1284.5103 6038.7 10 3.911 43.2 1 E.GTTDLLMSGYIL.G Reverse_YBL019W 1 1 2.3% 520 59445 9.1 U APN2 SGDID:S000000115, Chr II from 184356-185918, Verified ORF, "Class II abasic (AP) endonuclease involved in repair of DNA damage; homolog of human HAP1 and E. coli exoIII" * 122805-Holinger-06_itms_7.07494.07494.2 1.3077 0.0891 93.0 1384.8574 1384.5748 5461.9 139 3.911 40.9 1 L.SVLIFDIRSGYN.S YDR256C 1 1 2.3% 515 58555 7.4 U CTA1 SGDID:S000002664, Chr IV from 969674-968127, reverse complement, Verified ORF, "Catalase A, breaks down hydrogen peroxide in the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p) during fatty acid beta-oxidation" * 122805-Holinger-03_itms_22.14056.14056.2 2.0462 0.0919 92.8 1295.9347 1298.4595 5778.9 322 3.898 45.5 1 F.NPAIRDGPMNVN.G Reverse_YMR217W 1 1 2.3% 525 58482 6.5 U GUA1 SGDID:S000004830, Chr XIII from 701789-703366, Verified ORF, "GMP synthase, an enzyme that catalyzes the second step in the biosynthesis of GMP from inosine 5'-phosphate (IMP); transcription is not subject to regulation by guanine but is negatively regulated by nutrient starvation" * 122805-Holinger-06_itms_10.09331.09331.2 1.3089 0.1305 91.0 1527.2753 1527.6917 6861.3 177 3.788 50.0 1 E.TDIFNEMTWNQK.A Reverse_YER025W 1 1 2.3% 527 57866 6.8 U GCD11 SGDID:S000000827, Chr V from 205250-206833, Verified ORF, "Gamma subunit of the translation initiation factor eIF2, involved in the identification of the start codon; binds GTP when forming the ternary complex with GTP and tRNAi-Met" * 122805-Holinger-04_itms_7.05605.05605.2 2.3399 0.1458 90.6 1368.6787 1369.5168 5556.0 19 3.771 54.5 1 D.NQEAFLSVINSF.I YKL103C 1 1 2.3% 514 57093 5.8 U LAP4 SGDID:S000001586, Chr XI from 247326-245782, reverse complement, Verified ORF, "Vacuolar aminopeptidase, often used as a marker protein in studies of autophagy and cytosol to vacuole targeting (CVT) pathway" * 122805-Holinger-04_itms_13.09131.09131.2 3.0713 0.2599 99.8 1307.7333 1308.523 7211.9 1 5.266 63.6 1 K.NHFPVPNVGITL.S YOR119C 1 1 2.3% 484 56122 6.6 U RIO1 SGDID:S000005645, Chr XV from 550246-548792, reverse complement, Verified ORF, "Essential serine kinase involved in cell cycle progression and processing of the 20S pre-rRNA into mature 18S rRNA" * 122805-Holinger-03_itms_15.10264.10264.2 2.1326 0.2142 98.6 1277.7512 1278.537 6840.1 249 4.459 50.0 1 M.GISIFPERVIF.Q Reverse_YGL012W 1 1 2.3% 473 56040 8.6 U ERG4 SGDID:S000002980, Chr VII from 472860-474281, Verified ORF, "C-24(28) sterol reductase, catalyzes the final step in ergosterol biosynthesis; mutants are viable, but lack ergosterol" * 122805-Holinger-06_itms_8.08197.08197.2 1.0746 0.117 93.2 1388.6921 1387.6232 4672.0 348 3.926 30.0 1 F.VPFFWPFVSNF.G YFL016C 1 1 2.3% 511 55561 9.2 U MDJ1 SGDID:S000001878, Chr VI from 106230-104695, reverse complement, Verified ORF, "Protein involved in folding of mitochondrially synthesized proteins in the mitochondrial matrix; localizes to the mitochondrial inner membrane; member of the DnaJ family of molecular chaperones" * 122805-Holinger-05_itms_7.06327.06327.2 2.6696 0.155 96.5 1431.8229 1432.6627 4869.7 1 4.178 59.1 1 R.IRVDKDPNFSIK.N Reverse_YGR019W 1 1 2.3% 471 52946 6.8 U UGA1 SGDID:S000003251, Chr VII from 525233-526648, Verified ORF, "Gamma-aminobutyrate (GABA) transaminase (4-aminobutyrate aminotransferase) involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization" * 122805-Holinger-02_itms_27.17130.17130.2 1.866 0.1148 98.4 1159.6378 1157.2347 4281.2 6 4.415 60.0 1 S.CTTSGSAFLRG.H Reverse_YDR388W 1 1 2.3% 482 52774 6.0 U RVS167 SGDID:S000002796, Chr IV from 1250176-1251624, Verified ORF, "Actin-associated protein, subunit of a complex (Rvs161p-Rvs167p) involved in regulation of actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; homolog of mammalian amphiphysin" * 122805-Holinger-01_itms_12.09436.09436.2 1.5464 0.1691 94.4 987.61096 989.02936 3971.5 7 3.979 55.0 1 D.YGAGYGVGSSA.G Reverse_YBR003W 1 1 2.3% 473 52560 8.8 U COQ1 SGDID:S000000207, Chr II from 242811-244232, Verified ORF, "Hexaprenyl pyrophosphate synthetase, catalyzes the first step in ubiquinone (coenzyme Q) biosynthesis" * 122805-Holinger-05_itms_5.05252.05252.2 1.5746 0.086 93.1 1074.7852 1073.3208 4611.6 422 3.918 50.0 1 W.AFLVPATAIGL.K YNL071W 1 1 2.3% 482 51818 7.8 U LAT1 SGDID:S000005015, Chr XIV from 491524-492972, Verified ORF, "Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex, which catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA" * 122805-Holinger-02_itms_26.17056.17056.2 1.5464 0.0727 92.5 1129.8337 1131.434 5229.2 1 3.868 55.0 1 T.IIGMPALSPTM.T YHR190W 1 2 2.3% 444 51720 5.9 U ERG9 SGDID:S000001233, Chr VIII from 484845-486179, Verified ORF, "Farnesyl-diphosphate farnesyl transferase (squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene in the sterol biosynthesis pathway" * 122805-Holinger-03_itms_16.10473.10473.2 2.5116 0.1442 92.8 1249.6346 1250.3936 5361.7 9 3.882 66.7 2 T.DFESILIEFH.K Reverse_YLR360W 1 1 2.3% 439 50860 9.0 U VPS38 SGDID:S000004352, Chr XII from 846102-847421, Verified ORF, "Part of a Vps34p phosphatidylinositol 3-kinase complex that functions in carboxypeptidase Y (CPY) sorting; binds Vps30p and Vps34p to promote production of phosphatidylinositol 3-phosphate (PtdIns3P) which stimulates kinase activity" * 122805-Holinger-03_itms_7.05749.05749.2 2.2064 0.0084 92.0 1024.5968 1025.3201 4324.0 61 3.844 61.1 1 D.SPVLGVLKLV.I YMR005W 1 1 2.3% 388 42336 9.7 U TAF4 SGDID:S000004607, Chr XIII from 276045-277211, Verified ORF, "TFIID subunit (48 kDa), involved in RNA polymerase II transcription initiation; potential Cdc28p substrate" * 122805-Holinger-03_itms_16.10396.10396.2 1.9122 0.0017 93.4 944.56744 945.10986 3113.6 4 3.931 68.8 1 A.GLRAGSKKQ.Y YBL079W 3 3 2.2% 1502 169474 6.1 U NUP170 SGDID:S000000175, Chr II from 75256-79764, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p" * 122805-Holinger-04_itms_12.08601.08601.2 1.946 0.0971 91.8 1133.678 1134.3611 8413.4 17 3.828 55.0 1 T.KASTIISPGIF.F * 122805-Holinger-05_itms_10.07755.07755.2 2.1234 0.1705 98.1 1689.9614 1690.9829 3978.0 181 4.382 39.3 1 M.GIPGVVDIKPVYNRY.S * 122805-Holinger-06_itms_19.14336.14336.1 1.2021 0.0771 90.4 780.5 779.7356 4916.9 85 4.731 50.0 1 I.SISNDDE.V YDR359C 2 2 2.2% 982 112502 9.0 U VID21 SGDID:S000002767, Chr IV from 1194875-1191927, reverse complement, Verified ORF, "Component of the NuA4 histone acetyltransferase complex" * 122805-Holinger-05_itms_8.06795.06795.2 3.2264 0.1282 98.9 1523.9028 1523.7758 7535.5 4 4.601 58.3 1 K.LKDVNLINVPNQR.L * 122805-Holinger-02_itms_14.09629.09629.1 1.9958 0.2541 94.6 986.42737 987.0105 4674.0 19 4.967 56.2 1 K.SDFDFADGL.L Reverse_YNR047W 2 2 2.2% 893 100546 8.0 U YNR047W SGDID:S000005330, Chr XIV from 708525-711206, Uncharacterized ORF, "Putative protein kinase that, when overexpressed, interferes with pheromone-induced growth arrest; localizes to the cytoplasm; potential Cdc28p substrate" * 122805-Holinger-02_itms_14.10072.10072.3 2.9616 0.0665 90.5 1924.9524 1927.1216 4481.7 39 3.9 34.7 1 P.PPVSQGPIKDNINSSGSTK.R * 122805-Holinger-04_itms_13.09456.09456.2 1.7968 0.0708 91.1 1063.0452 1064.1436 5270.0 277 3.791 61.1 1 D.NINSSGSTKR.A YKL072W 1 1 2.2% 766 88836 8.6 U STB6 SGDID:S000001555, Chr XI from 299226-301526, Verified ORF, "Protein that binds Sin3p in a two-hybrid assay" * 122805-Holinger-04_itms_17.11631.11631.3 2.9763 0.1101 93.5 1925.1088 1926.1742 4053.0 2 4.02 42.2 1 L.TIDKLFEVSSKTSNKDI.F Reverse_YBR015C 1 1 2.2% 597 67774 6.3 U MNN2 SGDID:S000000219, Chr II from 269503-267710, reverse complement, Verified ORF, "Alpha-1,2-mannosyltransferase, responsible for addition of the first alpha-1,2-linked mannose to form the branches on the mannan backbone of oligosaccharides, localizes to an early Golgi compartment" * 122805-Holinger-05_itms_15.10818.10818.2 1.7688 0.112 92.8 1480.0413 1477.7471 6507.5 331 3.891 41.7 1 V.RKKKDVAIGAIDY.Y YOR073W 1 1 2.2% 590 66706 9.3 U SGO1 SGDID:S000005599, Chr XV from 464772-466544, Verified ORF, "Component of the spindle checkpoint, involved in sensing lack of tension on mitotic chromosomes; protects centromeric Rec8p at meiosis I; required for accurate chromosomal segregation at meiosis II and for mitotic chromosome stability" * 122805-Holinger-04_itms_17.11457.11457.2 1.7954 0.1154 96.1 1409.8384 1411.5542 6014.0 21 4.149 54.2 1 E.DDLAVFDLFGNGK.A YDL207W 1 1 2.2% 538 62073 8.9 U GLE1 SGDID:S000002366, Chr IV from 88249-89865, Verified ORF, "Cytoplasmic nucleoporin required for polyadenylated RNA export but not for protein import; component of Nup82p nuclear pore subcomplex; contains a nuclear export signal" * 122805-Holinger-03_itms_9.06633.06633.2 3.5213 0.156 98.7 1463.8018 1465.7361 5507.5 7 4.566 68.2 1 R.QLKKEHEAKLLQ.Q Reverse_YMR279C 1 1 2.2% 540 59562 8.2 U YMR279C SGDID:S000004892, Chr XIII from 826350-824728, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_12.08431.08431.2 2.3247 0.1956 97.3 1296.7417 1297.4717 6470.6 64 4.287 54.5 1 D.MSLGHINTPVNN.P YMR221C 1 1 2.2% 504 56178 7.1 U YMR221C SGDID:S000004834, Chr XIII from 715444-713930, reverse complement, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria" * 122805-Holinger-03_itms_14.09687.09687.2 2.9249 0.1298 96.8 1324.6218 1325.6769 5390.2 3 4.198 80.0 1 F.FTLYLIVPVFI.L Reverse_YBL098W 1 1 2.2% 460 52430 8.4 U BNA4 SGDID:S000000194, Chr II from 39142-40524, Verified ORF, "Kynurenine 3-mono oxygenase, required for biosynthesis of nicotinic acid from tryptophan via kynurenine pathway" * 122805-Holinger-04_itms_7.05737.05737.2 2.4714 0.1155 91.8 1182.7063 1183.4172 5697.9 103 3.831 61.1 1 Q.RGKLDHIMRG.K YDR190C 1 1 2.2% 463 50453 5.9 U RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" * 122805-Holinger-04_itms_9.06803.06803.2 1.9101 0.1186 90.3 1199.503 1202.4368 5807.7 309 3.745 55.6 1 L.KPKKTEITEK.L YAL062W 1 1 2.2% 457 49627 5.5 U GDH3 SGDID:S000000058, Chr I from 31568-32941, Verified ORF, "NADP(+)-dependent glutamate dehydrogenase, synthesizes glutamate from ammonia and alpha-ketoglutarate; rate of alpha-ketoglutarate utilization differs from Gdh1p; expression regulated by nitrogen and carbon sources" YOR375C 1 1 2.2% 454 49570 5.7 U GDH1 SGDID:S000005902, Chr XV from 1043038-1041674, reverse complement, Verified ORF, "NADP(+)-dependent glutamate dehydrogenase, synthesizes glutamate from ammonia and alpha-ketoglutarate; rate of alpha-ketoglutarate utilization differs from Gdh3p; expression regulated by nitrogen and carbon sources" 122805-Holinger-04_itms_10.07653.07653.2 1.8131 0.0633 90.7 1108.6925 1109.3542 4260.9 17 3.776 61.1 1 K.VLPIVSVPER.I YER043C 1 1 2.2% 449 49126 6.2 U SAH1 SGDID:S000000845, Chr V from 237118-235769, reverse complement, Verified ORF, "S-adenosyl-L-homocysteine hydrolase, catabolizes S-adenosyl-L-homocysteine which is formed after donation of the activated methyl group of S-adenosyl-L-methionine (AdoMet) to an acceptor" * 122805-Holinger-04_itms_9.07257.07257.2 1.632 0.0791 91.3 1101.6398 1103.1766 5828.3 6 3.804 61.1 1 M.EDASHIGQVF.V Reverse_YPL060W 1 1 2.2% 413 47083 8.7 U LPE10 SGDID:S000005981, Chr XVI from 434520-435761, Verified ORF, "Mitochondrial inner membrane magnesium transporter, involved in maintenance of magnesium concentrations inside mitochondria; indirectly affects splicing of group II introns; functionally and structurally related to Mrs2p" * 122805-Holinger-05_itms_7.06529.06529.2 1.9264 0.0845 95.6 930.5316 930.99023 5310.2 45 4.105 75.0 1 M.AATNDPDVK.P Reverse_YKR053C 1 1 2.2% 404 46488 7.7 U YSR3 SGDID:S000001761, Chr XI from 534923-533709, reverse complement, Verified ORF, "Dihydrosphingosine 1-phosphate phosphatase, membrane protein involved in sphingolipid metabolism; has similarity to Lcb3p" * 122805-Holinger-03_itms_8.05810.05810.2 2.4412 0.0221 90.0 859.6133 857.89856 3449.4 207 3.733 68.8 1 S.VATANASHS.S YHR115C 1 1 2.2% 416 46098 6.8 U DMA1 SGDID:S000001157, Chr VIII from 341362-340112, reverse complement, Verified ORF, "Protein involved in regulating spindle position and orientation, functionally redundant with Dma2p; homolog of S. pombe Dma1 and H. sapiens Chfr" * 122805-Holinger-03_itms_15.09869.09869.2 2.0147 0.0322 96.1 1077.6301 1078.2993 5925.4 4 4.149 75.0 1 Q.GLFFDPIIR.T YMR139W 1 1 2.2% 370 43005 6.5 U RIM11 SGDID:S000004747, Chr XIII from 546124-547236, Verified ORF, "Protein kinase required for signal transduction during entry into meiosis; promotes the formation of the Ime1p-Ume6p complex by phosphorylating Ime1p and Ume6p; shares similarity with mammalian glycogen synthase kinase 3-beta" * 122805-Holinger-04_itms_4.04404.04404.2 2.086 0.0609 91.3 952.5622 953.1698 3616.5 51 3.799 85.7 1 L.SSVKKKLY.P YCR105W 1 1 2.2% 361 39349 7.3 U ADH7 SGDID:S000000702, Chr III from 309066-310151, Verified ORF, "NADPH-dependent cinnamyl alcohol dehydrogenase family member with broad substrate specificity; may be involved in fusel alcohol synthesis" * 122805-Holinger-03_itms_9.06855.06855.2 2.4124 0.0074 92.9 897.5553 898.04706 5372.2 49 3.907 78.6 1 F.AIQIPENI.P YDL171C 3 3 2.1% 2145 238100 6.6 U GLT1 SGDID:S000002330, Chr IV from 155641-149204, reverse complement, Verified ORF, "NAD(+)-dependent glutamate synthase (GOGAT), synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source" * 122805-Holinger-03_itms_12.08555.08555.2 2.4072 0.2602 99.5 1356.7512 1357.5522 5167.3 7 5.022 63.6 1 L.GWRNVPVDSTIL.G * 122805-Holinger-05_itms_24.16210.16210.3 1.7123 0.0695 94.6 2310.3594 2306.7224 7144.5 59 4.083 20.8 1 C.IHHHLIRNKQRSQVALILE.T * 122805-Holinger-06_itms_5.06330.06330.2 1.0671 0.2053 94.4 1281.1863 1279.3916 2343.3 10 3.984 25.0 1 C.FYGATSGTAFISG.S YLR342W 4 4 2.1% 1876 214849 7.2 U FKS1 SGDID:S000004334, Chr XII from 809997-815627, Verified ORF, "Catalytic subunit of 1,3-beta-D-glucan synthase, functionally redundant with alternate catalytic subunit Gsc2p; binds to regulatory subunit Rho1p; involved in cell wall synthesis and maintenance; localizes to sites of cell wall remodeling" * 122805-Holinger-03_itms_15.09971.09971.2 2.5308 0.1268 98.6 1329.6693 1327.479 5384.2 1 4.467 65.0 1 L.GDVVWDDVFFK.T 122805-Holinger-05_itms_11.08337.08337.2 2.1161 0.1437 95.1 952.54376 953.1289 6187.2 18 4.039 78.6 1 R.TLRAPTFF.V 122805-Holinger-04_itms_13.09263.09263.2 2.0775 0.1026 92.8 1104.6637 1105.3225 6432.2 319 3.879 61.1 1 F.ATSRIPFSIL.Y * 122805-Holinger-05_itms_13.09535.09535.2 2.5063 0.2121 98.7 1262.8325 1263.6066 8152.9 1 4.49 75.0 1 C.QLPLIIIPKID.K YPR164W 4 5 2.1% 1407 161237 5.9 U MMS1 SGDID:S000006368, Chr XVI from 870699-874922, Verified ORF, "Protein likely involved in protection against replication-dependent DNA damage; mutants are sensitive to methyl methanesulfonate (MMS); implicated in regulation of Ty1 transposition" * 122805-Holinger-05_itms_10.08111.08111.2 2.8533 0.105 93.0 1379.8141 1380.6273 6661.9 63 3.909 62.5 1 L.KSISPLPSNPINL.D * 122805-Holinger-04_itms_11.08060.08060.2 3.2137 0.2641 99.9 1494.8452 1495.716 8287.8 4 5.465 61.5 1 L.KSISPLPSNPINLD.S * 122805-Holinger-04_itms_14.09646.09646.2 2.7026 0.2576 99.3 1443.8314 1444.7234 7594.8 1 4.768 68.2 2 W.ILLPDCVIRTPF.S * 122805-Holinger-04_itms_13.09302.09302.2 2.9182 0.1336 99.5 1280.633 1281.4198 6537.1 1 5.071 72.2 1 D.CVIRTPFSDW.I Reverse_YPR030W 2 2 2.1% 1121 124848 8.3 U CSR2 SGDID:S000006234, Chr XVI from 627877-631242, Verified ORF, "Nuclear protein with a potential regulatory role in utilization of galactose and nonfermentable carbon sources; overproduction suppresses the lethality at high temperature of a chs5 spa2 double null mutation; potential Cdc28p substrate" * 122805-Holinger-01_itms_13.09720.09720.2 1.6669 0.155 92.5 1153.7476 1153.2744 3597.7 163 3.866 45.0 1 K.TTPLFVSEAST.A * 122805-Holinger-01_itms_13.09700.09700.2 1.8634 0.1221 90.9 1345.849 1346.3934 3590.0 55 3.787 45.8 1 R.QLIDGEDGASVNQ.V YNL278W 2 2 2.1% 1060 118280 8.9 U CAF120 SGDID:S000005222, Chr XIV from 113271-116453, Verified ORF, "Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation" * 122805-Holinger-03_itms_20.12700.12700.2 1.9233 0.0687 92.6 1294.5416 1293.4437 4492.2 36 3.874 60.0 1 S.DNIVMECGKNL.T * 122805-Holinger-03_itms_27.16582.16582.1 1.1859 0.234 91.4 1171.153 1171.4282 6023.2 366 4.824 35.0 1 D.RTPLAKVPAAF.Q YJL019W 1 1 2.1% 682 79175 5.3 U MPS3 SGDID:S000003556, Chr X from 402813-404861, Verified ORF, "Essential integral membrane protein required for spindle pole body duplication and for nuclear fusion, localizes to the spindle pole body half bridge, interacts with DnaJ-like chaperone Jem1p and with centrin homolog Cdc31p" * 122805-Holinger-03_itms_7.05244.05244.2 2.3808 0.1825 98.8 1467.7561 1468.6036 5909.8 1 4.552 61.5 1 R.AIKKGIYTDGGETD.N YGL142C 1 2 2.1% 616 72566 8.4 U GPI10 SGDID:S000003110, Chr VII from 238124-236274, reverse complement, Verified ORF, "Integral membrane protein involved in glycosylphosphatidylinositol (GPI) anchor synthesis; putative alpha 1,2 mannosyltransferase required for addition of the third mannose onto the GPI core structure; human PIG-Bp is a functional homolog" * 122805-Holinger-03_itms_14.09206.09206.2 2.7152 0.1425 92.5 1611.8746 1612.8835 4147.9 1 3.868 66.7 2 T.YLVVFEHMENAFL.K YHL019C 1 2 2.1% 605 69990 6.9 U APM2 SGDID:S000001011, Chr VIII from 69545-67728, reverse complement, Verified ORF, "Protein of unknown function, homologous to the medium chain of mammalian clathrin-associated protein complex; involved in vesicular transport" * 122805-Holinger-04_itms_11.07986.07986.2 2.7717 0.184 95.3 1459.7931 1461.6146 8191.8 41 4.045 54.2 2 L.QAATDAREIEFIP.P YLR248W 1 1 2.1% 610 68062 5.5 U RCK2 SGDID:S000004238, Chr XII from 634254-636086, Verified ORF, "Protein kinase involved in the response to oxidative and osmotic stress; identified as suppressor of S. pombe cell cycle checkpoint mutations" * 122805-Holinger-01_itms_11.08921.08921.2 1.6722 0.1469 98.6 1493.9548 1491.7177 5349.3 1 4.482 41.7 1 W.GIGCVLYTMLCGF.P Reverse_YJL105W 1 1 2.1% 560 63856 8.7 U SET4 SGDID:S000003641, Chr X from 224972-226654, Verified ORF, "Protein of unknown function, contains a SET domain" * 122805-Holinger-03_itms_27.16961.16961.2 1.6652 0.1234 93.0 1085.3947 1085.292 6044.6 271 3.91 50.0 1 A.ATALAVAAAIGR.K Reverse_YHR170W 1 1 2.1% 518 59095 5.5 U NMD3 SGDID:S000001213, Chr VIII from 443829-445385, Verified ORF, "Protein involved in nuclear export of the large ribosomal subunit; acts as a Crm1p-dependent adapter protein for export of nascent ribosomal subunits through the nuclear pore complex" * 122805-Holinger-02_itms_12.08850.08850.2 2.2467 0.0368 90.7 1257.7805 1258.33 4869.8 130 3.778 60.0 1 F.LDSNYNSNAIF.Y YIL142W 1 1 2.1% 527 57203 6.1 U CCT2 SGDID:S000001404, Chr IX from 83302-84885, Verified ORF, "Subunit beta of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" * 122805-Holinger-04_itms_6.05499.05499.2 2.3036 0.1752 95.3 1153.6771 1154.3518 5206.0 114 4.066 55.0 1 L.KSIPLDNPAAK.V YLR175W 1 1 2.1% 483 54705 8.9 U CBF5 SGDID:S000004165, Chr XII from 506136-507587, Verified ORF, "Component of box H/ACA small nucleolar ribonucleoprotein particles (snoRNPs), probable rRNA pseudouridine synthase, binds to snoRNP Nop10p and also interacts with ribosomal biogenesis protein Nop53p" * 122805-Holinger-05_itms_14.10427.10427.2 1.7583 0.0953 95.3 1023.4783 1026.2675 6962.1 151 4.062 61.1 1 W.GLGPVAQKKK.Q YKL211C 1 1 2.1% 484 53489 6.9 U TRP3 SGDID:S000001694, Chr XI from 38154-36700, reverse complement, Verified ORF, "Bifunctional enzyme exhibiting both indole-3-glycerol-phosphate synthase and anthranilate synthase activities, forms multifunctional hetero-oligomeric anthranilate synthase:indole-3-glycerol phosphate synthase enzyme complex with Trp2p" * 122805-Holinger-04_itms_11.08304.08304.2 2.5156 0.2712 99.8 1091.6118 1092.2897 9226.2 1 5.434 77.8 1 F.TGKIPVFGIC.M YNL234W 1 1 2.1% 426 47823 8.5 U YNL234W SGDID:S000005178, Chr XIV from 210234-211514, Uncharacterized ORF, "Similar to globins and has a functional heme-binding domain; involved in glucose signaling or metabolism; regulated by Rgt1p" * 122805-Holinger-04_itms_5.04820.04820.2 2.087 0.224 98.7 1051.5549 1053.2097 3585.6 72 4.497 56.2 1 S.FCKVLDSAI.D YHR068W 1 1 2.1% 387 42892 5.8 U DYS1 SGDID:S000001110, Chr VIII from 232135-233298, Verified ORF, "Deoxyhypusine synthase, catalyzes formation of deoxyhypusine, the first step in hypusine biosynthesis; triggers posttranslational hypusination of translation elongation factor eIF-5A and regulates its intracellular levels; tetrameric" * 122805-Holinger-05_itms_9.07405.07405.2 1.7622 0.0069 90.3 961.5361 962.1431 7120.7 16 3.746 64.3 1 N.KIPIFCPS.L Reverse_YBL031W 1 1 2.1% 338 38015 10.4 U SHE1 SGDID:S000000127, Chr II from 161702-162718, Verified ORF, "Cytoskeletal protein of unknown function; overexpression causes growth arrest" * 122805-Holinger-04_itms_8.06704.06704.2 1.7819 0.1385 90.5 837.534 836.926 3899.2 4 3.767 83.3 1 S.RDQPIAH.Q YKL014C 3 3 2.0% 1764 203286 7.3 U URB1 SGDID:S000001497, Chr XI from 416556-411262, reverse complement, Verified ORF, "Nucleolar protein required for the normal accumulation of 25S and 5.8S rRNAs, associated with the 27SA2 pre-ribosomal particle; proposed to be involved in the biogenesis of the 60S ribosomal subunit" * 122805-Holinger-04_itms_14.09986.09986.2 2.7896 0.3645 100.0 1204.6958 1205.4423 3842.0 1 5.66 83.3 1 Y.FDFSLPILPR.L * 122805-Holinger-04_itms_10.07392.07392.2 1.8702 0.0397 95.1 1066.5879 1067.184 4667.1 36 4.039 55.6 1 D.VNAFLTSVSE.Y * 122805-Holinger-03_itms_14.09378.09378.2 2.8741 0.1836 92.8 1668.9229 1669.8754 5595.1 1 3.893 57.1 1 K.SRLPQDDILNNIGTL.R YIL156W 1 1 2.0% 1071 123134 7.9 U UBP7 SGDID:S000001418, Chr IX from 48091-51306, Verified ORF, "Ubiquitin-specific protease that cleaves ubiquitin-protein fusions" * 122805-Holinger-04_itms_19.12711.12711.2 1.6609 0.0582 90.6 2506.0564 2503.78 10934.9 14 3.772 30.0 1 S.LNPPFREITADRSVTHRKDSY.H Reverse_YJL157C 1 1 2.0% 830 94572 5.4 U FAR1 SGDID:S000003693, Chr X from 126245-123753, reverse complement, Verified ORF, "Cyclin-dependent kinase inhibitor that mediates cell cycle arrest in response to pheromone; also forms a complex with Cdc24p, Ste4p, and Ste18p that may specify the direction of polarized growth during mating; potential Cdc28p substrate" * 122805-Holinger-04_itms_16.10691.10691.2 2.1579 0.0541 91.7 1668.8673 1667.9028 8998.0 3 3.821 43.8 1 S.LQGTKSFGSAVSGATKK.L YKL054C 1 1 2.0% 738 83973 5.0 U DEF1 SGDID:S000001537, Chr XI from 338397-336181, reverse complement, Verified ORF, "RNAPII degradation factor, forms a complex with Rad26p in chromatin, enables ubiquitination and proteolysis of RNAPII" * 122805-Holinger-03_itms_11.07962.07962.2 3.4805 0.2334 99.3 1924.9194 1926.0947 7674.7 1 4.685 60.7 1 A.GQYPYQLPKNNYNYY.Q YHL032C 1 1 2.0% 709 79824 8.0 U GUT1 SGDID:S000001024, Chr VIII from 38506-36377, reverse complement, Verified ORF, "Glycerol kinase, converts glycerol to glycerol-3-phosphate; glucose repression of expression is mediated by Adr1p and Ino2p-Ino4p; derepression of expression on non-fermentable carbon sources is mediated by Opi1p and Rsf1p" * 122805-Holinger-04_itms_8.06550.06550.2 1.9664 0.1082 96.1 1482.7994 1481.6387 5673.5 35 4.14 50.0 1 L.AVDGGMSRSNEVMQ.I Reverse_YBR255W 1 1 2.0% 694 79028 9.7 U YBR255W SGDID:S000000459, Chr II from 724451-726535, Uncharacterized ORF, "Protein of unknown function, required for normal growth rate at 15 degrees C; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-04_itms_11.08166.08166.2 2.3129 0.0961 97.4 1512.8145 1514.6383 7160.9 70 4.291 50.0 1 T.LSQTNSHVSNATRV.R YPL093W 1 1 2.0% 647 74410 8.8 U NOG1 SGDID:S000006014, Chr XVI from 370975-372918, Verified ORF, "Putative GTPase that associates with free 60S ribosomal subunits in the nucleolus and is required for 60S ribosomal subunit biogenesis; constituent of 66S pre-ribosomal particles; member of the ODN family of nucleolar G-proteins" * 122805-Holinger-05_itms_7.06411.06411.2 2.7621 0.1391 94.0 1543.856 1544.7507 5515.6 209 3.955 54.2 1 Q.ARDDVKRTPFIPE.S YHR188C 1 1 2.0% 610 68771 5.3 U GPI16 SGDID:S000001231, Chr VIII from 483837-482005, reverse complement, Verified ORF, "Transmembrane protein subunit of the glycosylphosphatidylinositol transamidase complex that adds GPIs to newly synthesized proteins; human PIG-Tp homolog" * 122805-Holinger-05_itms_11.08581.08581.2 2.8053 0.1139 91.1 1348.845 1349.6567 6724.0 31 3.793 59.1 1 L.VLKPLPNNDLLL.S Reverse_YOR154W 1 1 2.0% 587 67452 5.5 U YOR154W SGDID:S000005680, Chr XV from 624729-626492, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_21.13729.13729.2 2.0458 0.0013 96.8 1244.9196 1243.3593 8200.6 18 4.207 63.6 1 R.LSGTSLPSSHEK.Q YOR071C 1 1 2.0% 598 67194 7.7 U YOR071C SGDID:S000005597, Chr XV from 461277-459481, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_14.10535.10535.2 1.9633 0.1311 91.1 1437.9681 1437.6538 6117.0 75 3.792 50.0 1 T.DEEARKKGMIPY.S YPR072W 1 1 2.0% 560 65855 5.3 U NOT5 SGDID:S000006276, Chr XVI from 690104-691786, Verified ORF, "Subunit of the CCR4-NOT complex, which is a global transcriptional regulator with roles in transcription initiation and elongation and in mRNA degradation" * 122805-Holinger-04_itms_14.09871.09871.2 2.3971 0.1325 97.9 1366.7427 1367.5901 6139.0 2 4.355 70.0 1 T.SIFFPNEPIRF.V YDR294C 1 1 2.0% 589 65566 8.0 U DPL1 SGDID:S000002702, Chr IV from 1052222-1050453, reverse complement, Verified ORF, "Dihydrosphingosine phosphate lyase, regulates intracellular levels of sphingolipid long-chain base phosphates (LCBPs), degrades phosphorylated long chain bases, prefers C16 dihydrosphingosine-l-phosphate as a substrate" * 122805-Holinger-03_itms_10.07416.07416.2 2.4497 0.1626 95.5 1366.6971 1367.504 5850.3 239 4.085 50.0 1 A.VYHGGDDLIHLQ.T YPR144C 1 1 2.0% 552 63637 6.1 U NOC4 SGDID:S000006348, Chr XVI from 821419-819761, reverse complement, Verified ORF, "Nucleolar protein, forms a complex with Nop14p that mediates maturation and nuclear export of 40S ribosomal subunits" * 122805-Holinger-04_itms_12.08689.08689.2 2.5536 0.1472 97.2 1256.6655 1257.4343 6484.8 2 4.268 75.0 1 M.LHNPAFISNPF.Q Reverse_YJR131W 1 1 2.0% 549 63057 5.7 U MNS1 SGDID:S000003892, Chr X from 667559-669208, Verified ORF, "Alpha-1,2-mannosidase involved in ER quality control; catalyzes the removal of one mannose residue from Man9GlcNAc to produce a single isomer of Man8GlcNAc in N-linked oligosaccharide biosynthesis; integral to ER membrane" * 122805-Holinger-02_itms_21.13785.13785.2 1.2314 0.1417 92.3 985.7166 987.95844 2547.4 185 3.86 45.0 1 E.ATSSAGGDAHN.K YLR023C 1 1 2.0% 543 62571 9.2 U IZH3 SGDID:S000004013, Chr XII from 187128-185497, reverse complement, Verified ORF, "Membrane protein involved in zinc metabolism, member of the four-protein IZH family, expression induced by zinc deficiency; deletion reduces sensitivity to elevated zinc and shortens lag phase, overexpression reduces Zap1p activity" * 122805-Holinger-03_itms_18.11749.11749.2 2.0596 0.1007 95.6 1339.6732 1340.4813 4894.1 221 4.103 50.0 1 S.EVWRNSQVPPQ.A YJR064W 1 1 2.0% 562 61914 5.5 U CCT5 SGDID:S000003825, Chr X from 555828-557516, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" * 122805-Holinger-05_itms_9.07646.07646.2 2.6244 0.095 93.4 1277.7488 1278.537 4272.0 7 3.932 75.0 1 L.FVVDPFIGKKQ.Q YNL189W 1 1 2.0% 542 60441 4.9 U SRP1 SGDID:S000005133, Chr XIV from 284261-285889, Verified ORF, "Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate import of nuclear proteins, binds the nuclear localization signal of the substrate during import; may also play a role in regulation of protein degradation" * 122805-Holinger-04_itms_9.07203.07203.2 2.5273 0.0828 91.2 1302.7394 1303.5039 6524.3 206 3.797 60.0 1 R.EHRPPIDVVIQ.A YPL026C 1 1 2.0% 502 57844 5.2 U SKS1 SGDID:S000005947, Chr XVI from 502181-500673, reverse complement, Verified ORF, "Putative serine/threonine protein kinase; involved in the adaptation to low concentrations of glucose independent of the SNF3 regulated pathway" * 122805-Holinger-03_itms_20.12825.12825.2 1.8327 0.0782 92.9 1136.7833 1135.3025 4403.1 1 3.897 72.2 1 S.QVPILSSEVY.M YPL097W 1 1 2.0% 492 55287 9.1 U MSY1 SGDID:S000006018, Chr XVI from 364949-366427, Verified ORF, "Mitochondrial tyrosyl-tRNA synthetase" * 122805-Holinger-06_itms_10.08844.08844.2 1.2422 0.1983 92.5 1250.7332 1248.3776 5105.3 1 3.868 50.0 1 E.FTYQVLQAYD.F Reverse_YBL082C 1 1 2.0% 458 52861 8.9 U ALG3 SGDID:S000000178, Chr II from 71124-69748, reverse complement, Verified ORF, "Dolichol-P-Man dependent alpha(1-3) mannosyltransferase, involved in the synthesis of dolichol-linked oligosaccharide donor for N-linked glycosylation of proteins" * 122805-Holinger-06_itms_9.08351.08351.2 1.1305 0.1111 95.2 1113.0344 1115.364 5277.5 274 4.043 37.5 1 D.PLIRPYRTV.F YOR059C 1 1 2.0% 450 51106 9.0 U YOR059C SGDID:S000005585, Chr XV from 440259-438907, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_8.06265.06265.2 1.821 0.0742 91.7 1116.551 1114.1688 6697.7 4 3.818 75.0 1 K.EDVNDDMIY.F YPR084W 1 1 2.0% 456 50835 7.1 U YPR084W SGDID:S000006288, Chr XVI from 706970-708340, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.09377.09377.2 2.0417 0.2044 97.5 1021.6106 1022.14545 3666.0 264 4.292 68.8 1 G.FSPDNVVPF.L YPL151C 1 1 2.0% 451 50700 7.2 U PRP46 SGDID:S000006072, Chr XVI from 267534-266179, reverse complement, Verified ORF, "Splicing factor that is found in the Cef1p subcomplex of the spliceosome" * 122805-Holinger-03_itms_8.06073.06073.2 1.647 0.0879 92.8 967.49146 968.22784 3465.4 123 3.895 68.8 1 T.RIPVITLVG.H Reverse_YHR004C 1 1 2.0% 446 50642 8.9 U NEM1 SGDID:S000001046, Chr VIII from 113089-111749, reverse complement, Verified ORF, "Protein of the nuclear envelope required for the spherical shape of the nucleus; required for normal sporulation" * 122805-Holinger-06_itms_5.06279.06279.2 1.439 0.1444 95.3 1005.2262 1006.05743 4400.8 71 4.07 50.0 1 N.KPNTKESSD.N YML038C 1 1 2.0% 442 49615 7.5 U YMD8 SGDID:S000004502, Chr XIII from 204103-202775, reverse complement, Verified ORF, "Putative nucleotide sugar transporter, has similarity to Vrg4p" * 122805-Holinger-02_itms_28.17706.17706.2 1.4712 0.2648 97.7 1019.44727 1022.18884 2320.5 17 4.334 56.2 1 V.EKPFPGIFS.S Reverse_YKL046C 1 1 2.0% 449 49565 4.7 U DCW1 SGDID:S000001529, Chr XI from 352268-350919, reverse complement, Verified ORF, "Putative mannosidase, GPI-anchored membrane protein required for cell wall biosynthesis in bud formation;homologous to Dfg5p" * 122805-Holinger-05_itms_7.06621.06621.2 2.0443 0.1192 98.2 1007.5452 1008.0447 4450.6 20 4.398 62.5 1 Q.WRLGGGCSD.A YER061C 1 1 2.0% 442 47640 8.3 U CEM1 SGDID:S000000863, Chr V from 279624-278296, reverse complement, Verified ORF, "Mitochondrial beta-keto-acyl synthase with possible role in fatty acid synthesis; required for mitochondrial respiration" * 122805-Holinger-04_itms_12.08917.08917.2 1.4463 0.1109 91.0 897.50195 894.9597 4067.0 136 3.787 56.2 1 C.HITSPPADG.N Reverse_YOL052C 1 1 2.0% 396 46232 5.6 U SPE2 SGDID:S000005412, Chr XV from 233634-232444, reverse complement, Verified ORF, "S-adenosylmethionine decarboxylase, required for the biosynthesis of spermidine and spermine; cells lacking Spe2p require spermine or spermidine for growth in the presence of oxygen but not when grown anaerobically" * 122805-Holinger-04_itms_11.08203.08203.2 1.7276 0.0124 90.3 923.302 925.07513 4066.3 101 3.745 85.7 1 K.FPKYKGGQ.T YGR234W 1 1 2.0% 399 44646 6.3 U YHB1 SGDID:S000003466, Chr VII from 959908-961107, Verified ORF, "Nitric oxide oxidoreductase, flavohemoglobin involved in nitric oxide detoxification; plays a role in the oxidative and nitrosative stress responses" * 122805-Holinger-03_itms_7.05596.05596.2 2.8046 0.3211 100.0 937.5627 938.1148 5223.4 1 6.359 92.9 1 A.NVDKIIVH.T Reverse_YML010W 1 1 1.9% 1063 115650 5.2 U SPT5 SGDID:S000004470, Chr XIII from 247677-250868, Verified ORF, "Protein that forms a complex with Spt4p and mediates both activation and inhibition of transcription elongation; Spt4p-Spt5p complex also plays a role in pre-mRNA processing" * 122805-Holinger-06_itms_11.09639.09639.2 1.7464 0.1372 97.2 1616.7443 1619.6499 5467.3 5 4.283 31.6 1 T.GQGGWASAGGGAGGWASAGG.N Reverse_YMR019W 2 2 1.9% 949 109825 7.3 U STB4 SGDID:S000004621, Chr XIII from 312155-315004, Verified ORF, "Protein that binds Sin3p in a two-hybrid assay; contains a Zn(II)2Cys6 zinc finger domain characteristic of DNA-binding proteins" * 122805-Holinger-04_itms_4.04208.04208.2 2.6716 0.0755 93.1 1195.6373 1198.3641 5544.9 1 3.921 72.2 1 V.FFLNSRTIEA.L * 122805-Holinger-03_itms_7.05309.05309.2 1.8458 0.2174 96.0 842.48724 844.9402 1830.8 145 4.137 78.6 1 M.ESAPLSLQ.Y YBR086C 4 4 1.9% 946 105854 9.0 U IST2 SGDID:S000000290, Chr II from 423035-420195, reverse complement, Verified ORF, "Plasma membrane protein that may be involved in osmotolerance, localizes to the mother cell in small-budded cells and to the bud in medium- and large-budded cells; mRNA is transported to the bud tip by an actomyosin-driven process" * 122805-Holinger-04_itms_12.08743.08743.2 3.1595 0.2361 99.4 1814.9327 1816.0631 7541.4 2 5.002 53.6 1 Y.SKPEYFPFPIYDKPS.S * 122805-Holinger-04_itms_12.08932.08932.3 3.1148 0.2256 97.4 2001.0356 2002.2738 8262.4 1 4.272 42.2 1 Y.SKPEYFPFPIYDKPSSV.S * 122805-Holinger-04_itms_12.08934.08934.2 2.9419 0.0652 96.5 2001.0397 2002.2738 7932.0 4 4.173 43.8 1 Y.SKPEYFPFPIYDKPSSV.S * 122805-Holinger-04_itms_12.08752.08752.2 3.7247 0.1763 99.0 2089.0774 2089.352 7910.2 1 4.639 55.9 1 Y.SKPEYFPFPIYDKPSSVS.N YHR131C 1 1 1.9% 850 96099 5.3 U YHR131C SGDID:S000001173, Chr VIII from 367895-365343, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_24.16387.16387.2 1.2722 0.2225 98.1 1632.9055 1633.7123 4065.5 43 4.379 30.0 1 G.LAPNGESATDLSQSSR.S YDL148C 1 1 1.9% 810 94302 7.4 U NOP14 SGDID:S000002307, Chr IV from 190587-188155, reverse complement, Verified ORF, "Nucleolar protein, forms a complex with Noc4p that mediates maturation and nuclear export of 40S ribosomal subunits; also present in the small subunit processome complex, which is required for processing of pre-18S rRNA" * 122805-Holinger-02_itms_15.10410.10410.2 2.7242 0.1817 98.1 1709.7715 1710.7455 6202.8 3 4.383 53.6 1 L.SLEDELANDEEDFLA.S Reverse_YPL180W 1 1 1.9% 799 88845 8.1 U TCO89 SGDID:S000006101, Chr XVI from 205247-207646, Verified ORF, "Subunit of TORC1 (Tor1p or Tor2p-Kog1p-Lst8p-Tco89p), a complex that regulates growth in response to nutrient availability; cooperates with Ssd1p in the maintenance of cellular integrity; deletion strains are hypersensitive to rapamycin" * 122805-Holinger-03_itms_16.10368.10368.2 3.3917 0.1227 97.9 1637.8827 1638.8328 6590.2 27 4.363 57.1 1 V.GTSQSLIMNPAYNEL.L Reverse_YLL029W 1 1 1.9% 749 84924 6.9 U YLL029W SGDID:S000003952, Chr XII from 81460-83709, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_4.04227.04227.2 1.7487 0.1002 90.1 1433.3922 1435.5767 4276.0 405 3.734 46.2 1 S.YHIIAANSGTSSIT.E YOR076C 1 1 1.9% 747 84779 7.8 U SKI7 SGDID:S000005602, Chr XV from 471621-469378, reverse complement, Verified ORF, "Antiviral adaptor protein that mediates interactions via its N-terminus between the exosome and Ski complex (Ski2p, Ski3p, Ski8p) which operate in the 3'-to-5' mRNA-decay pathway; cytoplasmic protein required for degrading nonstop mRNAs" * 122805-Holinger-03_itms_8.05921.05921.2 2.6276 0.1495 94.6 1716.8157 1717.876 5697.2 1 3.993 61.5 1 K.RKSPDDKLNLEESW.K YLR117C 1 1 1.9% 687 82445 5.6 U CLF1 SGDID:S000004107, Chr XII from 384535-382472, reverse complement, Verified ORF, "Essential splicesome assembly factor; contains multiple tetratricopeptide repeat (TPR) protein-binding motifs and interacts specifically with many spliceosome components, may serve as a scaffold during splicesome assembly" * 122805-Holinger-04_itms_17.11258.11258.2 2.1735 0.1157 91.6 1569.9098 1568.724 7227.0 20 3.809 50.0 1 G.DINSIEETISYKR.K YDR444W 1 1 1.9% 687 78108 8.3 U YDR444W SGDID:S000002852, Chr IV from 1350280-1352343, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_24.16335.16335.2 1.0617 0.2036 90.3 1440.9531 1442.482 5496.3 25 3.745 33.3 1 L.NENSRVGDTSLYS.W Reverse_YDR049W 1 1 1.9% 632 72733 8.9 U YDR049W SGDID:S000002456, Chr IV from 553251-555149, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_10.08009.08009.2 2.4392 0.1132 92.3 1284.7179 1284.5015 5192.5 79 3.857 59.1 1 P.INTLKKGPGREA.D Reverse_YNL020C 1 1 1.9% 638 71373 8.7 U ARK1 SGDID:S000004965, Chr XIV from 597540-595624, reverse complement, Verified ORF, "Serine/threonine protein kinase involved in regulation of the cortical actin cytoskeleton; involved in control of endocytosis" * 122805-Holinger-06_itms_11.09753.09753.2 1.5129 0.1541 91.3 1367.4247 1367.6316 5485.4 130 3.805 45.5 1 R.PDQVLIDRILGK.L YNR059W 1 1 1.9% 580 68082 8.5 U MNT4 SGDID:S000005342, Chr XIV from 736803-738545, Verified ORF, "Putative alpha-1,3-mannosyltransferase, not required for protein O-glycosylation" * 122805-Holinger-05_itms_5.05325.05325.2 2.4591 0.1691 98.7 1370.7345 1372.6067 6172.6 45 4.58 60.0 1 Y.PPQELWFLDVK.D YDR120C 1 1 1.9% 570 64052 9.1 U TRM1 SGDID:S000002527, Chr IV from 693256-691544, reverse complement, Verified ORF, "tRNA methyltransferase, localizes to both the nucleus and mitochondrion to produce the modified base N2,N2-dimethylguanosine in tRNAs in both compartments" * 122805-Holinger-03_itms_12.08578.08578.2 2.5031 0.1548 91.9 1231.7001 1230.4062 4664.8 4 3.836 65.0 1 N.KTFTKYSVAQG.P Reverse_YFR006W 1 1 1.9% 535 61754 6.2 U YFR006W SGDID:S000001902, Chr VI from 156139-157746, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_11.08347.08347.2 1.4474 0.1071 96.6 1071.3435 1072.2059 4618.9 337 4.185 50.0 1 S.APIDVGSLHY.F YBR184W 1 1 1.9% 523 60643 8.6 U YBR184W SGDID:S000000388, Chr II from 597358-598929, Uncharacterized ORF, "Putative protein of unknown function; YBR184W is not an essential gene" * 122805-Holinger-04_itms_20.13461.13461.2 2.3905 0.1745 99.8 1187.21 1185.3654 6135.0 1 5.243 77.8 1 F.TLLRDIYSGF.T YDR524C 1 1 1.9% 482 54494 9.5 U AGE1 SGDID:S000002932, Chr IV from 1488980-1487532, reverse complement, Verified ORF, "ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector, involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif" * 122805-Holinger-02_itms_7.05882.05882.2 2.6139 0.077 91.2 917.5441 917.9945 5339.1 146 3.792 75.0 1 N.VSNSNVNAI.Y Reverse_YDR190C 1 1 1.9% 463 50453 5.9 U RVB1 SGDID:S000002598, Chr IV from 841990-840599, reverse complement, Verified ORF, "Essential protein involved in transcription regulation; component of chromatin remodeling complexes; required for assembly and function of the INO80 complex; member of the RUVB-like protein family" * 122805-Holinger-03_itms_20.13010.13010.2 1.5007 0.2048 96.4 1044.6578 1047.2054 3491.2 95 4.165 56.2 1 P.CFPVKPGLE.Q YOL082W 1 1 1.9% 415 47599 4.8 U ATG19 SGDID:S000005442, Chr XV from 168726-169973, Verified ORF, "Protein involved in the cytoplasm-to-vacuole targeting pathway and in autophagy, recognizes cargo proteins and delivers them to the preautophagosomal structure for eventual engulfment by the autophagosome and degradation" * 122805-Holinger-04_itms_11.08030.08030.2 2.0488 0.0613 94.4 898.5794 899.0752 5304.3 88 3.983 78.6 1 F.QLIVPTLD.A YIR025W 1 1 1.9% 368 42826 4.8 U MND2 SGDID:S000001464, Chr IX from 403656-404762, Verified ORF, "Subunit of the anaphase-promoting complex (APC); needed for meiotic nuclear division" * 122805-Holinger-04_itms_12.08813.08813.2 1.5929 0.0854 90.4 834.54034 833.91693 3388.6 174 3.76 75.0 1 R.ERITSLD.E Reverse_YPR191W 1 1 1.9% 368 40478 8.0 U QCR2 SGDID:S000006395, Chr XVI from 919377-920483, Verified ORF, "Subunit 2 of the ubiquinol cytochrome-c reductase complex, which is a component of the mitochondrial inner membrane electron transport chain; transcription is regulated by Hap1p, Hap2p/Hap3p, and heme" * 122805-Holinger-04_itms_5.04917.04917.2 2.056 0.0922 92.3 813.47217 814.87054 2943.2 8 3.861 83.3 1 L.VSETLEH.P YHR099W 5 5 1.8% 3744 433182 6.5 U TRA1 SGDID:S000001141, Chr VIII from 302764-313998, Verified ORF, "Subunit of SAGA and NuA4 histone acetyltransferase complexes; interacts with acidic activators (e.g., Gal4p) which leads to transcription activation; similar to human TRRAP, which is a cofactor for c-Myc mediated oncogenic transformation" * 122805-Holinger-03_itms_14.09466.09466.2 2.3855 0.1379 98.9 1185.7201 1186.4398 3900.4 110 4.611 66.7 1 Y.VNFVPDLIIR.L * 122805-Holinger-02_itms_15.10156.10156.2 2.8334 0.1408 94.4 1201.6664 1202.4825 6605.4 323 3.986 60.0 1 Y.NLANGLLFVLK.D * 122805-Holinger-03_itms_16.10323.10323.2 3.8625 0.2629 99.8 1781.7891 1782.8573 8016.6 1 5.384 69.2 1 L.AEDFEKELDNFYDF.Y * 122805-Holinger-04_itms_20.12999.12999.2 1.9845 0.0715 92.9 2226.4324 2228.5474 5777.6 14 3.906 39.5 1 L.IYEVATSGSLKSYLVEDKKP.K * 122805-Holinger-04_itms_12.08755.08755.2 2.0208 0.0203 91.8 1289.678 1290.4613 7293.9 24 3.828 60.0 1 F.LISHPDLFFNS.R YBL100W-B 3 3 1.8% 1770 202214 7.7 U YBL100W-B SGDID:S000002149, Chr II from 29932-31224,31226-35245, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-04_itms_16.10875.10875.2 1.6588 0.1237 94.6 1108.6941 1109.1785 6094.4 106 4.008 55.0 1 Y.ASVTSKEVSSN.Q 122805-Holinger-04_itms_14.09598.09598.2 2.7675 0.2627 99.8 1416.8059 1417.688 10218.8 1 5.21 63.6 1 N.SYGYIIYLPSLK.K 122805-Holinger-04_itms_8.06426.06426.2 2.1728 0.0457 93.5 894.55786 895.0898 3703.7 26 3.936 78.6 1 K.LNVPLNPK.G YGL173C 2 2 1.8% 1528 175459 7.5 U KEM1 SGDID:S000003141, Chr VII from 180119-175533, reverse complement, Verified ORF, "5'-3' exonuclease involved in mRNA decay, evolutionarily conserved component of cytoplasmic processing (P) bodies, plays a role in microtubule-mediated processes, filamentous growth, and ribosomal RNA maturation" * 122805-Holinger-04_itms_13.09196.09196.2 2.8483 0.2235 96.2 1535.855 1536.771 7056.6 1 4.159 70.8 1 N.DFLPNLPDLHLNK.G * 122805-Holinger-03_itms_16.10295.10295.2 3.1695 0.1881 98.7 1798.8892 1799.9745 6985.7 2 4.569 53.6 1 L.DQDIEFDLSKPFTPF.Q Reverse_YPL058C 3 3 1.8% 1511 171064 6.8 U PDR12 SGDID:S000005979, Chr XVI from 450374-445839, reverse complement, Verified ORF, "Plasma membrane weak-acid-inducible ATP-binding cassette (ABC) transporter, required for weak organic acid resistance, strongly induced by sorbate and benzoate, regulated by War1p, mutants exhibit sorbate hypersensitivity" * 122805-Holinger-04_itms_4.03929.03929.2 1.9348 0.1735 96.9 850.4689 850.9469 3417.0 3 4.22 68.8 1 S.SFAEIAGGV.S * 122805-Holinger-04_itms_11.08172.08172.2 1.8043 0.0909 91.6 850.4342 849.09436 5246.5 4 3.811 78.6 1 G.MLATMKGP.K * 122805-Holinger-02_itms_22.14297.14297.2 1.6615 0.0926 95.6 1077.7383 1075.1199 3252.6 9 4.101 72.2 1 I.YSDGSVYLNG.K YNL163C 2 2 1.8% 1110 124464 5.1 U RIA1 SGDID:S000005107, Chr XIV from 330075-326743, reverse complement, Verified ORF, "Cytoplasmic GTPase involved in biogenesis of the 60S ribosome; has similarity to translation elongation factor 2 (Eft1p and Eft2p)" * 122805-Holinger-02_itms_4.03583.03583.2 1.7366 0.1007 95.4 944.4855 947.0075 3501.7 15 4.075 68.8 1 L.SASDMNPPQ.N * 122805-Holinger-02_itms_20.13134.13134.2 2.1602 0.1145 95.3 1209.8287 1210.4314 5336.8 428 4.043 45.0 1 I.KNILKTSTSSM.D YBR084W 1 1 1.8% 975 106217 8.7 U MIS1 SGDID:S000000288, Chr II from 411048-413975, Verified ORF, "Mitochondrial C1-tetrahydrofolate synthase, involved in interconversion between different oxidation states of tetrahydrofolate (THF); provides activities of formyl-THF synthetase, methenyl-THF cyclohydrolase, and methylene-THF dehydrogenase" * 122805-Holinger-04_itms_9.06709.06709.2 2.9891 0.3825 100.0 2067.0906 2068.294 6782.1 1 6.012 41.2 1 S.EKNPLNDKNIHEPGYVVT.E Reverse_YLL026W 1 2 1.8% 908 102035 5.4 U HSP104 SGDID:S000003949, Chr XII from 88622-91348, Verified ORF, "Heat shock protein that cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and reactivate previously denatured, aggregated proteins; responsive to stresses including: heat, ethanol, and sodium arsenite; involved in [PSI+] propagation" * 122805-Holinger-02_itms_20.13338.13338.2 2.6613 0.161 95.8 1701.0063 1702.9915 5761.1 23 4.119 40.0 2 K.QIKAADQLVKGLAYSP.T YJL041W 1 2 1.8% 823 86516 6.3 U NSP1 SGDID:S000003577, Chr X from 365700-365700,365819-368289, Verified ORF, "Essential component of the nuclear pore complex, which mediates nuclear import and export" 122805-Holinger-03_itms_13.08596.08596.2 2.2084 0.1512 95.3 1525.7922 1526.6891 5641.6 145 4.054 46.4 2 E.KKDGDASKPAFSFGA.K YKL112W 1 1 1.8% 731 81752 5.1 U ABF1 SGDID:S000001595, Chr XI from 226214-228409, Verified ORF, "DNA binding protein with possible chromatin-reorganizing activity involved in transcriptional activation, gene silencing, and DNA replication and repair" * 122805-Holinger-04_itms_13.09454.09454.2 2.7071 0.1529 96.4 1389.7804 1391.4398 6649.3 39 4.167 54.2 1 A.NNNTNPPGTPDHI.H YPL043W 1 1 1.8% 685 77825 9.1 U NOP4 SGDID:S000005964, Chr XVI from 469936-471993, Verified ORF, "Nucleolar protein, essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; constituent of 66S pre-ribosomal particles; contains four RNA recognition motifs (RRMs)" * 122805-Holinger-02_itms_12.08544.08544.2 3.0523 0.3253 100.0 1276.7373 1277.5034 5162.9 1 5.7 81.8 1 K.YALPVIDKSTGL.A YDR194C 2 2 1.8% 664 76269 9.0 U MSS116 SGDID:S000002602, Chr IV from 847941-845947, reverse complement, Verified ORF, "DEAD-box protein required for efficient splicing of mitochondrial Group I and II introns; presumed RNA helicase due to DEAD-box motif" * 122805-Holinger-05_itms_8.06729.06729.3 2.276 0.1947 98.4 1379.8246 1380.6304 5330.0 133 4.298 38.6 1 L.LNDPQLKIPVSR.R * 122805-Holinger-05_itms_8.06728.06728.2 3.2128 0.2232 99.4 1379.8252 1380.6304 5530.9 1 4.853 77.3 1 L.LNDPQLKIPVSR.R YLR413W 2 2 1.8% 675 72698 5.1 U YLR413W SGDID:S000004405, Chr XII from 951152-953179, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" * 122805-Holinger-05_itms_12.09431.09431.2 2.4653 0.2191 99.5 1437.8285 1438.7069 6483.6 1 5.005 59.1 1 E.EKTKLSPVFELF.A * 122805-Holinger-04_itms_15.10136.10136.2 2.5416 0.1632 99.3 1180.6823 1181.4174 7006.2 1 4.899 72.2 1 K.TKLSPVFELF.A Reverse_YLR369W 1 1 1.8% 657 72365 6.4 U SSQ1 SGDID:S000004361, Chr XII from 859551-861524, Verified ORF, "Mitochondrial hsp70-type molecular chaperone, required for assembly of iron/sulfur clusters into proteins at a step after cluster synthesis, and for maturation of Yfh1p, which is a homolog of human frataxin implicated in Friedreich's ataxia" * 122805-Holinger-04_itms_7.05759.05759.2 2.6087 0.1933 98.9 1214.696 1215.3922 5239.1 439 4.617 59.1 1 L.VNKIEGSLIGGQ.I Reverse_YAR007C 1 1 1.8% 621 70348 6.2 U RFA1 SGDID:S000000065, Chr I from 158621-156756, reverse complement, Verified ORF, "Subunit of heterotrimeric Replication Factor A (RF-A), which is a highly conserved single-stranded DNA binding protein involved in DNA replication, repair, and recombination" * 122805-Holinger-03_itms_20.12848.12848.2 1.6242 0.1447 97.1 1039.7806 1042.2206 3950.8 85 4.262 60.0 1 V.GKIAAVSGEPL.N Reverse_YOR023C 1 1 1.8% 566 63869 9.4 U AHC1 SGDID:S000005549, Chr XV from 377711-376011, reverse complement, Verified ORF, "Subunit of the Ada histone acetyltransferase complex, required for structural integrity of the complex" * 122805-Holinger-04_itms_11.08019.08019.2 1.6025 0.082 95.5 1114.6779 1112.3176 2862.6 183 4.099 55.6 1 H.PTNKVTKPAR.T Reverse_YGR276C 1 1 1.8% 553 62849 7.2 U RNH70 SGDID:S000003508, Chr VII from 1045486-1043825, reverse complement, Verified ORF, "3' exoribonuclease, required for 5S and tRNA-Arg3 maturation" * 122805-Holinger-02_itms_8.06620.06620.2 3.1396 0.0214 90.5 1277.6989 1279.4326 4485.3 1 3.767 83.3 1 R.EKKDQIFELE.T Reverse_YPL228W 1 1 1.8% 549 61850 5.6 U CET1 SGDID:S000006149, Chr XVI from 118382-120031, Verified ORF, "Beta (RNA 5'-triphosphatase) subunit of the mRNA capping enzyme, a heterodimer (the other subunit is CEG1, a guanylyltransferase) involved in adding the 5' cap to mRNA; the mammalian enzyme is a single bifunctional polypeptide" * 122805-Holinger-02_itms_7.05876.05876.2 1.9288 0.1404 98.4 1199.557 1200.2878 4463.6 2 4.428 77.8 1 N.IELEVEHTTE.S YPR088C 1 2 1.8% 541 59624 8.6 U SRP54 SGDID:S000006292, Chr XVI from 713026-711401, reverse complement, Verified ORF, "Signal recognition particle (SRP) subunit (homolog of mammalian SRP54); contains the signal sequence-binding activity of SRP, interacts with the SRP RNA, and mediates binding of SRP to signal receptor; contains GTPase domain" * 122805-Holinger-04_itms_8.06617.06617.2 1.6077 0.1784 98.7 900.54205 902.089 2959.7 118 4.507 61.1 2 N.MFGGGMGGGM.G Reverse_YML118W 1 1 1.8% 505 57742 7.5 U NGL3 SGDID:S000004587, Chr XIII from 32334-33851, Verified ORF, "Putative endonuclease, has a domain similar to a magnesium-dependent endonuclease motif in mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p" * 122805-Holinger-03_itms_9.06861.06861.2 1.8135 0.1819 94.3 940.82355 940.1307 2797.6 387 3.973 62.5 1 Y.LSVGKVHLS.N Reverse_YNL124W 1 1 1.8% 492 54950 4.8 U NAF1 SGDID:S000005068, Chr XIV from 392894-394372, Verified ORF, "Protein required for the assembly of box H/ACA snoRNPs and for pre-rRNA processing, forms a complex with Shq1p and interacts with H/ACA snoRNP components Nhp2p and Cbf5p; has similarity to Gar1p and other RNA-binding proteins" * 122805-Holinger-05_itms_9.07257.07257.2 2.42 0.1346 91.7 1012.6302 1014.2565 4551.9 27 3.817 75.0 1 F.AKEGLRVKL.E Reverse_YBR283C 1 1 1.8% 490 53312 8.1 U SSH1 SGDID:S000000487, Chr II from 770411-768939, reverse complement, Verified ORF, "Subunit of the Ssh1 translocon complex; Sec61p homolog involved in co-translational pathway of protein translocation; not essential" * 122805-Holinger-05_itms_11.08645.08645.2 2.0057 0.1119 92.2 930.619 931.0336 6312.7 106 3.855 68.8 1 N.ILAGQAETQ.D YNL016W 1 1 1.8% 453 50763 5.1 U PUB1 SGDID:S000004961, Chr XIV from 602908-604269, Verified ORF, "Poly(A)+ RNA-binding protein, abundant mRNP-component protein hypothesized to bind a pool of non-translatable mRNAs; not reported to associate with polyribosomes" * 122805-Holinger-03_itms_13.08798.08798.2 2.9152 0.1518 98.8 1016.5275 1017.1693 6015.1 1 4.554 92.9 1 A.FKDFPSYL.S YML085C 1 1 1.8% 447 49800 5.1 U TUB1 SGDID:S000004550, Chr XIII from 99400-99376,99259-97941, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules" YML124C 1 1 1.8% 445 49694 5.2 U TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p" 122805-Holinger-05_itms_6.05718.05718.2 2.3796 0.0758 95.5 926.5021 924.0904 4515.4 1 4.096 92.9 1 T.GYGKFVPR.A YOL059W 1 1 1.8% 440 49422 7.1 U GPD2 SGDID:S000005420, Chr XV from 217125-218447, Verified ORF, "NAD-dependent glycerol 3-phosphate dehydrogenase, homolog of Gpd1p, expression is controlled by an oxygen-independent signaling pathway required to regulate metabolism under anoxic conditions; located in cytosol and mitochondria" * 122805-Holinger-04_itms_10.07833.07833.2 1.9183 0.122 91.6 915.4525 916.0832 5835.3 2 3.81 85.7 1 K.MTAHTNIK.Q Reverse_YLR303W 1 1 1.8% 444 48672 6.4 U MET17 SGDID:S000004294, Chr XII from 732544-733878, Verified ORF, "O-acetyl homoserine-O-acetyl serine sulfhydrylase, required for sulfur amino acid synthesis" * 122805-Holinger-02_itms_4.03910.03910.2 2.267 0.045 93.3 907.0522 905.12524 3072.6 121 3.931 64.3 1 F.YPAIVLTK.A YPR163C 1 1 1.8% 436 48522 5.3 U TIF3 SGDID:S000006367, Chr XVI from 869951-868641, reverse complement, Verified ORF, "Translation initiation factor eIF-4B, has RNA annealing activity; contains an RNA recognition motif and binds to single-stranded RNA" * 122805-Holinger-03_itms_26.16392.16392.2 1.9401 0.1908 99.6 864.6373 863.0043 2807.7 85 5.163 57.1 1 V.YVSVAAPR.R YMR323W 1 1 1.8% 437 47313 5.4 U ERR3 SGDID:S000004942, Chr XIII from 920086-921399, Verified ORF, "Protein of unknown function, has similarity to enolases" YPL281C 1 1 1.8% 437 47328 5.3 U ERR2 SGDID:S000006202, Chr XVI from 10870-9557, reverse complement, Verified ORF, "Protein of unknown function, has similarity to enolases" YOR393W 1 1 1.8% 437 47328 5.3 U ERR1 SGDID:S000005920, Chr XV from 1080272-1081585, Verified ORF, "Protein of unknown function, has similarity to enolases" 122805-Holinger-02_itms_23.14686.14686.2 1.1171 0.1171 98.6 828.4655 828.0024 4555.9 27 4.47 42.9 1 S.RLGANAIL.G YGR274C 1 1 1.7% 1066 120696 7.5 U TAF1 SGDID:S000003506, Chr VII from 1043101-1039901, reverse complement, Verified ORF, "TFIID subunit (145 kDa), involved in RNA polymerase II transcription initiation, has histone acetyltransferase activity, involved in promoter binding and G1/S progression" * 122805-Holinger-02_itms_4.03888.03888.3 2.4625 0.2115 91.0 1991.8286 1987.3988 5354.1 30 3.904 32.4 1 N.FGSHIRPGTKIVFSKLKA.R Reverse_YNL132W 1 1 1.7% 1056 119347 7.8 U KRE33 SGDID:S000005076, Chr XIV from 375323-378493, Verified ORF, "Essential protein of unknown function; heterozygous mutant shows haploinsufficiency in K1 killer toxin resistance" * 122805-Holinger-02_itms_13.09210.09210.2 2.2164 0.2361 97.4 1941.064 1938.1975 5121.1 25 4.289 38.2 1 I.EGELAIQIVCLPDPIRGG.D YDL185W 3 3 1.7% 1071 118637 6.2 U TFP1 SGDID:S000002344, Chr IV from 126788-130003, Verified ORF, "Vacuolar ATPase V1 domain subunit A containing the catalytic nucleotide binding sites; protein precursor undergoes self-catalyzed splicing to yield the extein Tfp1p and the intein Vde (PI-SceI), which is a site-specific endonuclease" * 122805-Holinger-04_itms_8.06216.06216.2 1.7993 0.0914 91.1 854.56006 855.06836 2618.5 22 3.793 83.3 1 R.EVIKLPR.G * 122805-Holinger-03_itms_15.10130.10130.2 2.3176 0.2153 99.5 1447.6987 1448.627 6504.7 1 5.02 80.0 1 T.YDAFCPIWKTF.D * 122805-Holinger-03_itms_15.09901.09901.2 2.6301 0.1731 98.6 1284.6327 1285.451 7882.5 17 4.45 61.1 1 Y.DAFCPIWKTF.D Reverse_YLR240W 1 1 1.7% 875 100921 7.8 U VPS34 SGDID:S000004230, Chr XII from 617535-620162, Verified ORF, "Phosphatidylinositol 3-kinase responsible for the synthesis of phosphatidylinositol 3-phosphate; forms membrane-associated signal transduction complex with Vps15p to regulate protein sorting; similar to p110 subunit of mammalian PI 3-kinase" * 122805-Holinger-05_itms_9.07198.07198.2 3.2139 0.1941 95.5 1808.9366 1805.9385 5052.9 1 4.1 53.6 1 E.EIPDNNPQDPDYFKL.T YLR347C 1 1 1.7% 861 94776 4.6 U KAP95 SGDID:S000004339, Chr XII from 826412-823827, reverse complement, Verified ORF, "Karyopherin beta, forms a dimeric complex with Srp1p (Kap60p) that mediates nuclear import of cargo proteins via a nuclear localization signal (NLS), interacts with nucleoporins to guide transport across the nuclear pore complex" * 122805-Holinger-03_itms_15.10141.10141.2 2.8824 0.1603 98.4 1691.8774 1692.9702 5170.1 3 4.423 53.6 1 A.IADIELPHGAWPELM.K Reverse_YER171W 1 1 1.7% 778 89786 5.6 U RAD3 SGDID:S000000973, Chr V from 527077-529413, Verified ORF, "5' to 3' DNA helicase, involved in nucleotide excision repair and transcription; subunit of RNA polymerase II transcription initiation factor TFIIH; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein" * 122805-Holinger-06_itms_14.11844.11844.2 1.8166 0.1236 90.4 1408.1322 1410.6104 3985.8 6 3.765 54.2 1 S.ITGSTIIVSSFRE.F Reverse_YOR165W 1 1 1.7% 776 89432 5.3 U SEY1 SGDID:S000005691, Chr XV from 644566-646896, Verified ORF, "Protein of unknown function, contains two predicted GTP-binding motifs GXXXXGKS and DXXG near the N-terminus, homolog of the Arabidopsis gene RHD3 (Root Hair Defective)" * 122805-Holinger-04_itms_5.04662.04662.2 2.0333 0.1758 93.3 1400.7408 1401.6897 3826.6 83 3.932 41.7 1 E.KLKVLQSTLSGLN.G YBR142W 1 1 1.7% 773 87048 8.4 U MAK5 SGDID:S000000346, Chr II from 528311-530632, Verified ORF, "Essential nucleolar protein, putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits" * 122805-Holinger-03_itms_15.09948.09948.2 2.8578 0.157 99.3 1562.5172 1561.7313 7855.8 3 4.758 62.5 1 N.WKPVDIPDTLDDF.G YLR114C 1 1 1.7% 764 86426 4.5 U YLR114C SGDID:S000004104, Chr XII from 377239-374945, reverse complement, Uncharacterized ORF, "Mutation is syntheticly lethal with apl2 vps1 double mutant" * 122805-Holinger-05_itms_21.14344.14344.2 2.1893 0.0146 94.6 1364.2136 1362.3495 10169.0 2 3.995 62.5 1 K.DIEGGPESNKNSD.S YDR176W 1 1 1.7% 702 79282 5.1 U NGG1 SGDID:S000002583, Chr IV from 814447-816555, Verified ORF, "Transcriptional regulator involved in glucose repression of Gal4p-regulated genes; component of transcriptional adaptor and histone acetyltransferase complexes, the ADA complex, the SAGA complex, and the SLIK complex" * 122805-Holinger-05_itms_8.06990.06990.3 1.9565 0.0263 95.8 1374.255 1371.6664 5258.3 219 4.109 38.6 1 G.KSVRSIPNKKTL.L Reverse_YOR275C 1 1 1.7% 661 75947 5.9 U RIM20 SGDID:S000005801, Chr XV from 841066-839081, reverse complement, Verified ORF, "Protein involved in proteolytic activation of Rim101p in response to alkaline pH; member of the PalA/AIP1/Alix family; interacts with the ESCRT-III subunits Snf7p, suggesting a relationship between the response to pH and multivesicular body formation" * 122805-Holinger-04_itms_19.12703.12703.2 2.3246 0.2742 99.6 1293.1642 1291.4027 5690.6 150 5.162 50.0 1 L.IDSQFFSATQF.S Reverse_YGL107C 1 1 1.7% 646 74596 8.0 U RMD9 SGDID:S000003075, Chr VII from 306276-304336, reverse complement, Verified ORF, "Mitochondrial protein required for sporulation" * 122805-Holinger-04_itms_9.07247.07247.2 1.8329 0.1628 99.3 1143.6691 1146.3263 2470.5 187 4.904 50.0 1 S.VSVKGILIDDS.I YDR398W 1 1 1.7% 643 72002 4.9 U UTP5 SGDID:S000002806, Chr IV from 1267461-1269392, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-04_itms_5.04908.04908.2 2.5959 0.2129 97.5 1240.7228 1241.4331 5460.6 14 4.316 60.0 1 A.LDKQRVGVQPT.Q YDR129C 1 2 1.7% 642 71773 5.5 U SAC6 SGDID:S000002536, Chr IV from 715374-715354,715242-713335, reverse complement, Verified ORF, "Fimbrin, actin-bundling protein; cooperates with Scp1p (calponin/transgelin) in the organization and maintenance of the actin cytoskeleton" * 122805-Holinger-02_itms_15.10552.10552.2 2.8216 0.24 100.0 1261.7255 1262.4888 5991.7 14 5.616 75.0 2 S.LFDDLKDGLIL.L YHR114W 1 1 1.7% 633 71171 6.0 U BZZ1 SGDID:S000001156, Chr VIII from 338086-339987, Verified ORF, "SH3 domain protein implicated in the regulation of actin polymerization, able to recruit actin polymerization machinery through its SH3 domains, colocalizes with cortical actin patches and Las17p, interacts with type I myosins" * 122805-Holinger-04_itms_6.05457.05457.3 2.114 0.0075 92.2 1293.7494 1297.4937 4901.2 4 3.942 40.0 1 L.KEYLNVVSPFT.S Reverse_YGL023C 1 1 1.7% 635 70617 7.8 U PIB2 SGDID:S000002991, Chr VII from 452109-450202, reverse complement, Verified ORF, "Protein binding phosphatidylinositol 3-phosphate, involved in telomere-proximal repression of gene expression; similar to Fab1 and Vps27" * 122805-Holinger-05_itms_7.06299.06299.2 2.5959 0.0845 96.2 1295.7595 1298.6578 4928.0 52 4.16 60.0 1 V.KRLVAPIYLPK.K Reverse_YHL019C 1 1 1.7% 605 69990 6.9 U APM2 SGDID:S000001011, Chr VIII from 69545-67728, reverse complement, Verified ORF, "Protein of unknown function, homologous to the medium chain of mammalian clathrin-associated protein complex; involved in vesicular transport" * 122805-Holinger-04_itms_9.06901.06901.2 2.6198 0.1179 92.4 1272.7294 1274.5492 5745.6 140 3.863 61.1 1 L.KPKIEFDKLR.V YGR103W 1 1 1.7% 605 69877 5.6 U NOP7 SGDID:S000003335, Chr VII from 695421-697238, Verified ORF, "Nucleolar protein involved in rRNA processing and 60S ribosomal subunit biogenesis; constituent of several different pre-ribosomal particles" * 122805-Holinger-04_itms_13.09022.09022.2 2.1627 0.2065 94.3 1128.6877 1129.3849 6565.1 12 3.971 61.1 1 S.GLIYPPKLDL.K Reverse_YGR065C 1 1 1.7% 593 69083 8.9 U VHT1 SGDID:S000003297, Chr VII from 619862-618081, reverse complement, Verified ORF, "High-affinity plasma membrane H+-biotin (vitamin H) symporter; mutation results in fatty acid auxotrophy; 12 transmembrane domain containing major facilitator subfamily member; mRNA levels negatively regulated by iron deprivation and biotin" * 122805-Holinger-02_itms_14.09834.09834.2 2.3849 0.1047 94.2 1235.6372 1236.3787 4522.7 334 3.973 55.6 1 P.LDHRLNHPHP.E Reverse_YCR014C 1 1 1.7% 582 67527 8.0 U POL4 SGDID:S000000607, Chr III from 140930-139182, reverse complement, Verified ORF, "DNA polymerase IV, undergoes pair-wise interactions with Dnl4p-Lif1p and Rad27p to mediate repair of DNA double-strand breaks by non-homologous end joining (NHEJ); homologous to mammalian DNA polymerase beta" * 122805-Holinger-04_itms_17.11564.11564.2 1.7667 0.1186 90.1 1182.6621 1180.1272 6617.4 301 3.734 55.6 1 S.DDNRESEVDT.S YLR028C 1 1 1.7% 591 65283 6.6 U ADE16 SGDID:S000004018, Chr XII from 201316-199541, reverse complement, Verified ORF, "Enzyme of 'de novo' purine biosynthesis containing both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities, isozyme of Ade17p; ade16 ade17 mutants require adenine and histidine" YMR120C 1 1 1.7% 592 65263 6.6 U ADE17 SGDID:S000004727, Chr XIII from 509279-507501, reverse complement, Verified ORF, "Enzyme of 'de novo' purine biosynthesis containing both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities, isozyme of Ade16p; ade16 ade17 mutants require adenine and histidine" 122805-Holinger-03_itms_14.09618.09618.2 2.7504 0.014 95.4 1249.7194 1250.4833 8174.0 96 4.072 66.7 1 I.VYVENPIRLF.H Reverse_YDR497C 1 1 1.7% 584 63570 6.5 U ITR1 SGDID:S000002905, Chr IV from 1445457-1443703, reverse complement, Verified ORF, "Myo-inositol transporter with strong similarity to the minor myo-inositol transporter Itr2p, member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p " * 122805-Holinger-04_itms_8.06664.06664.2 2.1276 0.3112 99.8 1012.59625 1013.0947 5707.3 17 5.461 66.7 1 I.GWSSFGSSVV.V Reverse_YIL085C 1 1 1.7% 517 61438 5.3 U KTR7 SGDID:S000001347, Chr IX from 202040-200487, reverse complement, Verified ORF, "Putative mannosyltransferase involved in protein glycosylation; member of the KRE2/MNT1 mannosyltransferase family" * 122805-Holinger-05_itms_12.09150.09150.2 1.9704 0.1142 91.2 1058.7926 1057.1942 5498.3 136 3.799 68.8 1 N.VQGHNELLF.D YDL143W 1 1 1.7% 528 57604 7.9 U CCT4 SGDID:S000002302, Chr IV from 199997-201583, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo" * 122805-Holinger-03_itms_9.06787.06787.2 2.927 0.2123 99.4 1092.5957 1093.2278 5121.6 16 4.977 75.0 1 L.RIDDIAFSR.- YBR199W 1 1 1.7% 464 54556 4.8 U KTR4 SGDID:S000000403, Chr II from 618904-620298, Verified ORF, "Putative mannosyltransferase involved in protein glycosylation; member of the KRE2/MNT1 mannosyltransferase family" * 122805-Holinger-01_itms_19.13093.13093.2 1.1286 0.1918 90.2 809.5767 808.82043 1886.6 164 3.736 35.7 1 I.TGKTESAD.E YGL097W 1 1 1.7% 482 53014 6.1 U SRM1 SGDID:S000003065, Chr VII from 321785-323233, Verified ORF, "Nucleotide exchange factor for Gsp1p, localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; potentially phosphorylated by Cdc28p" * 122805-Holinger-06_itms_6.06424.06424.1 1.262 0.2729 90.5 777.1221 776.82465 2466.5 5 4.727 42.9 1 V.GALGRDTS.N YGR032W 3 3 1.6% 1895 216988 7.0 U GSC2 SGDID:S000003264, Chr VII from 548268-553955, Verified ORF, "Catalytic subunit of 1,3-beta-glucan synthase, has similarity to an alternate catalytic subunit, Fks1p (Gsc1p); Rho1p encodes the regulatory subunit; involved in cell wall synthesis and maintenance" * 122805-Holinger-05_itms_24.16279.16279.2 1.1934 0.184 92.2 1289.3821 1291.4032 5858.5 219 3.856 37.5 1 K.DTVYSTAAHVVGA.V 122805-Holinger-05_itms_11.08337.08337.2 2.1161 0.1437 95.1 952.54376 953.1289 6187.2 18 4.039 78.6 1 R.TLRAPTFF.V 122805-Holinger-04_itms_13.09263.09263.2 2.0775 0.1026 92.8 1104.6637 1105.3225 6432.2 319 3.879 61.1 1 F.ATSRIPFSIL.Y Reverse_YLR189C 1 1 1.6% 1198 136054 7.5 U ATG26 SGDID:S000004179, Chr XII from 534395-530799, reverse complement, Verified ORF, "UDP-glucose:sterol glucosyltransferase, conserved enzyme involved in synthesis of sterol glucoside membrane lipids, involved in autophagy" * 122805-Holinger-05_itms_15.10831.10831.3 2.6996 0.1567 99.2 2366.196 2365.6501 3221.0 15 4.409 33.3 1 P.KFTSKDDLFWYGTVRVWES.F YKL105C 1 1 1.6% 1132 125593 5.8 U YKL105C SGDID:S000001588, Chr XI from 242227-238829, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" * 122805-Holinger-04_itms_26.16618.16618.3 2.8238 0.2107 94.5 2018.4833 2018.1014 6956.9 180 4.059 30.9 1 E.KEPSTLSNQTQNIENAEN.I Reverse_YDR038C 1 1 1.6% 1091 120296 5.5 U ENA5 SGDID:S000002445, Chr IV from 530693-527418, reverse complement, Verified ORF, "Protein with similarity to P-type ATPase sodium pumps" Reverse_YDR040C 1 1 1.6% 1091 120357 5.6 U ENA1 SGDID:S000002447, Chr IV from 538463-535188, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ and Li+ efflux to allow salt tolerance" Reverse_YDR039C 1 1 1.6% 1091 120317 5.5 U ENA2 SGDID:S000002446, Chr IV from 534578-531303, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux" 122805-Holinger-05_itms_17.12273.12273.3 2.9544 0.1275 93.3 2032.9823 2035.1364 4787.7 9 4.014 34.4 1 S.EFAGKGYINYTENHNNY.Y YHR120W 1 1 1.6% 959 109408 8.7 U MSH1 SGDID:S000001162, Chr VIII from 349577-352456, Verified ORF, "DNA-binding protein of the mitochondria involved in repair of mitochondrial DNA, has ATPase activity and binds to DNA mismatches; has homology to E. coli MutS; transcription is induced during meiosis" * 122805-Holinger-05_itms_9.07304.07304.2 2.2206 0.1462 95.9 1735.1381 1736.9844 6952.0 11 4.119 46.4 1 G.CFVPCSKARVGIVDK.L YMR086W 1 1 1.6% 960 105874 9.7 U YMR086W SGDID:S000004692, Chr XIII from 439207-442089, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" * 122805-Holinger-03_itms_13.09041.09041.3 2.4576 0.1479 92.2 1606.5085 1604.8651 4444.1 105 3.94 35.7 1 R.PGKINSLTQRSSMGK.G Reverse_YGR150C 1 1 1.6% 864 101422 8.6 U YGR150C SGDID:S000003382, Chr VII from 793058-790464, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_11.07866.07866.2 2.4352 0.2077 97.8 1474.8071 1475.642 5698.3 14 4.346 57.7 1 L.LRLSDSKGESVVAN.S YOR141C 1 1 1.6% 881 100209 4.8 U ARP8 SGDID:S000005667, Chr XV from 592587-589942, reverse complement, Verified ORF, "Nuclear actin-related protein involved in chromatin remodeling, component of chromatin-remodeling enzyme complexes" * 122805-Holinger-03_itms_16.10512.10512.2 2.6748 0.1166 90.4 1592.8088 1593.7307 6799.2 16 3.758 46.2 1 V.VSFNENSKPEIISE.K YFR038W 1 1 1.6% 853 96965 6.3 U YFR038W SGDID:S000001934, Chr VI from 229367-231928, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_7.06223.06223.2 3.2585 0.176 96.2 1522.7924 1523.5559 8397.8 14 4.156 57.7 1 D.ESNIGFENGGQKEN.K Reverse_YFL050C 1 1 1.6% 858 96684 6.7 U ALR2 SGDID:S000001844, Chr VI from 35848-33272, reverse complement, Verified ORF, "Probable Mg(2+) transporter; overexpression confers increased tolerance to Al(3+) and Ga(3+) ions" * 122805-Holinger-04_itms_20.13077.13077.2 1.9126 0.1336 94.8 1515.5673 1513.7336 7509.9 18 4.02 46.2 1 R.IDEATLPHIGFTKA.I YOR217W 1 1 1.6% 861 94903 9.2 U RFC1 SGDID:S000005743, Chr XV from 749301-751886, Verified ORF, "Subunit of heteropentameric Replication factor C (RF-C), which is a DNA binding protein and ATPase that acts as a clamp loader of the proliferating cell nuclear antigen (PCNA) processivity factor for DNA polymerases delta and epsilon" * 122805-Holinger-05_itms_9.07422.07422.2 2.7413 0.1049 92.2 1427.8525 1425.6743 5463.0 200 3.851 46.2 1 R.SKKLAATRVSGGHL.E YLL034C 1 1 1.6% 837 93069 5.4 U RIX7 SGDID:S000003957, Chr XII from 73145-70632, reverse complement, Verified ORF, "Putative ATPase of the AAA family, required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions" * 122805-Holinger-04_itms_16.10922.10922.2 2.5571 0.2089 99.1 1490.8925 1491.8137 5422.8 20 4.669 54.2 1 M.ELIGLPILHPEIF.L Reverse_YDR258C 1 1 1.6% 811 91336 8.0 U HSP78 SGDID:S000002666, Chr IV from 974237-971802, reverse complement, Verified ORF, "Oligomeric mitochondrial matrix chaperone that cooperates with Ssc1p in mitochondrial thermotolerance after heat shock; prevents the aggregation of misfolded matrix proteins; component of the mitochondrial proteolysis system" * 122805-Holinger-06_itms_9.08275.08275.2 1.3147 0.1874 99.2 1350.747 1352.5885 4447.4 117 4.683 29.2 1 T.LETKGTGTPGLFM.F Reverse_YMR186W 1 1 1.6% 705 80900 4.8 U HSC82 SGDID:S000004798, Chr XIII from 632354-634471, Verified ORF, "Cytoplasmic chaperone of the Hsp90 family, redundant in function and nearly identical with Hsp82p, and together they are essential; expressed constitutively at 10-fold higher basal levels that HSP82 and induced 2-3 fold by heat shock" Reverse_YPL240C 1 1 1.6% 709 81406 4.9 U HSP82 SGDID:S000006161, Chr XVI from 98625-96496, reverse complement, Verified ORF, "Cytoplasmic chaperone (Hsp90 family) required for pheromone signaling and negative regulation of Hsf1p; docks with the mitochondrial import receptor Tom70p for preprotein delivery; interacts with co-chaperones Cns1p, Cpr6p, Cpr7p, and Sti1p" 122805-Holinger-05_itms_10.08171.08171.2 2.6457 0.1096 91.5 1315.7837 1314.6115 6859.5 306 3.808 60.0 1 Q.VEEKVKKTKPK.K YOR033C 1 1 1.6% 702 80162 8.4 U EXO1 SGDID:S000005559, Chr XV from 394523-392415, reverse complement, Verified ORF, "5'-3' exonuclease and flap-endonuclease involved in recombination, double-strand break repair and DNA mismatch repair; member of the Rad2p nuclease family, with conserved N and I nuclease domains" * 122805-Holinger-05_itms_11.08756.08756.2 2.0561 0.1469 97.9 1254.6857 1255.2805 6659.0 29 4.367 55.0 1 K.GDSIQDFKEDT.N YBL060W 1 1 1.6% 687 78768 6.4 U YBL060W SGDID:S000000156, Chr II from 107934-109997, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_14.09190.09190.2 2.053 0.1103 92.1 1240.6814 1241.5162 2796.2 36 3.849 55.0 1 I.VVSEWKPLLGL.E YOR243C 1 1 1.6% 676 77002 7.8 U PUS7 SGDID:S000005769, Chr XV from 792241-790211, reverse complement, Verified ORF, "Pseudouridine synthase, catalyzes pseudouridylation at position 35 in U2 snRNA, position 13 in cytoplasmic tRNAs, and position 35 in pre-tRNA(Tyr); Asp(256) mutation abolishes activity; conserved in archaea, some bacteria, and vertebrates" * 122805-Holinger-05_itms_12.09264.09264.2 2.5441 0.1764 90.1 1275.7344 1276.5211 6873.1 61 3.734 65.0 1 T.LFLSPELPGFR.G YKL126W 1 1 1.6% 680 76480 6.5 U YPK1 SGDID:S000001609, Chr XI from 205351-207393, Verified ORF, "Serine/threonine protein kinase required for receptor-mediated endocytosis; involved in sphingolipid-mediated and cell integrity signaling pathways; localized to the bud neck, cytosol and plasma membrane; homolog of mammalian kinase SGK" * 122805-Holinger-02_itms_11.07982.07982.3 2.0468 0.151 96.8 1255.6934 1254.3416 4136.8 283 4.21 30.0 1 G.WTYVGNEQLGS.S YJL034W 1 1 1.6% 682 74468 4.9 U KAR2 SGDID:S000003571, Chr X from 381243-383291, Verified ORF, "ATPase involved in protein import into the ER, also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p" 122805-Holinger-03_itms_6.04644.04644.2 2.0058 0.0412 90.7 1143.6208 1144.27 4668.8 275 3.777 55.0 1 V.NKDGKPAVEVS.V Reverse_YER088C 1 1 1.6% 670 73048 9.5 U DOT6 SGDID:S000000890, Chr V from 335184-333172, reverse complement, Verified ORF, "Protein of unknown function, involved in telomeric gene silencing and filamentation" * 122805-Holinger-03_itms_4.03668.03668.2 1.1417 0.1704 91.2 1054.5234 1055.9414 2114.9 449 3.795 45.0 1 R.SGADSTNSSDD.A YDL070W 1 1 1.6% 638 72513 6.1 U BDF2 SGDID:S000002228, Chr IV from 331025-332941, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p" * 122805-Holinger-02_itms_5.04520.04520.2 2.1705 0.081 94.7 1114.5913 1115.1852 3265.2 468 4.013 66.7 1 N.ENDITNPAIQ.Y YBL042C 1 1 1.6% 639 72165 7.5 U FUI1 SGDID:S000000138, Chr II from 140263-138344, reverse complement, Verified ORF, "High affinity uridine permease, localized to the plasma membrane; not involved in uracil transport" * 122805-Holinger-03_itms_11.07946.07946.2 2.4309 0.1332 98.6 972.62524 973.1576 6062.2 251 4.453 61.1 1 Q.ISATGLQLGL.N Reverse_YDL013W 1 1 1.6% 619 71071 6.7 U HEX3 SGDID:S000002171, Chr IV from 429064-430923, Verified ORF, "Ring finger protein involved in the DNA damage response with possible recombination role; genetically identified by synthetic lethality with SGS1 (DNA helicase) and TOP3 (DNA topoisomerase); sporulation role; interacts with Slx8p and Lin1p" * 122805-Holinger-04_itms_10.07437.07437.2 1.9242 0.1106 96.2 1077.66 1078.118 5213.6 5 4.153 66.7 1 E.EVITLGDDSE.N Reverse_YBR068C 1 1 1.6% 609 67670 8.1 U BAP2 SGDID:S000000272, Chr II from 375687-373858, reverse complement, Verified ORF, "High-affinity leucine permease, functions as a branched-chain amino acid permease involved in the uptake of leucine, isoleucine and valine; contains 12 predicted transmembrane domains" Reverse_YDR508C 1 1 1.5% 663 73598 7.7 U GNP1 SGDID:S000002916, Chr IV from 1468434-1466443, reverse complement, Verified ORF, "High-affinity glutamine permease, also transports Leu, Ser, Thr, Cys, Met and Asn; expression is fully dependent on Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino acids" Reverse_YDR046C 1 1 1.7% 604 67365 8.2 U BAP3 SGDID:S000002453, Chr IV from 550573-548759, reverse complement, Verified ORF, "Amino acid permease involved in the uptake of cysteine, leucine, isoleucine and valine" Reverse_YCL025C 1 1 1.7% 595 64866 7.5 U AGP1 SGDID:S000000530, Chr III from 77918-76131, reverse complement, Verified ORF, "Low-affinity amino acid permease with broad substrate range, involved in uptake of asparagine, glutamine, and other amino acids; expression is regulated by the SPS plasma membrane amino acid sensor system (Ssy1p-Ptr3p-Ssy5p)" Reverse_YBR069C 1 1 1.6% 619 68758 7.7 U TAT1 SGDID:S000000273, Chr II from 378430-376571, reverse complement, Verified ORF, "Amino acid transport protein for valine, leucine, isoleucine, and tyrosine, low-affinity tryptophan and histidine transporter; overexpression confers FK506 resistance" 122805-Holinger-04_itms_13.09389.09389.2 1.8847 0.0693 95.7 901.3203 902.0788 4375.3 48 4.105 61.1 1 V.LLGTGIGTGL.S YBR170C 1 1 1.6% 580 65782 5.7 U NPL4 SGDID:S000000374, Chr II from 578081-576339, reverse complement, Verified ORF, "Endoplasmic reticulum and nuclear membrane protein, forms a complex with Cdc48p and Ufd1p that recognizes ubiquitinated proteins in the endoplasmic reticulum and delivers them to the proteasome for degradation" * 122805-Holinger-02_itms_22.14153.14153.2 1.3865 0.1118 90.7 1077.7421 1075.2158 3240.7 321 3.776 50.0 1 F.FSSKFVTCV.I Reverse_YGR124W 1 1 1.6% 572 64593 5.9 U ASN2 SGDID:S000003356, Chr VII from 739949-741667, Verified ORF, "Asparagine synthetase, isozyme of Asn1p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" Reverse_YPR145W 1 1 1.6% 572 64470 6.1 U ASN1 SGDID:S000006349, Chr XVI from 822616-824334, Verified ORF, "Asparagine synthetase, isozyme of Asn2p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" 122805-Holinger-02_itms_14.10119.10119.1 1.7391 0.1859 90.0 868.56635 867.9774 4535.7 4 4.759 50.0 1 L.DPANPLGIA.F YPR145W 1 1 1.6% 572 64470 6.1 U ASN1 SGDID:S000006349, Chr XVI from 822616-824334, Verified ORF, "Asparagine synthetase, isozyme of Asn2p; catalyzes the synthesis of L-asparagine from L-aspartate in the asparagine biosynthetic pathway" * 122805-Holinger-03_itms_14.09678.09678.2 2.1093 0.131 99.3 1135.6366 1136.336 5630.2 76 4.698 62.5 1 R.VPFLDREFL.Q Reverse_YHR037W 1 1 1.6% 575 64435 7.0 U PUT2 SGDID:S000001079, Chr VIII from 181970-183697, Verified ORF, "Delta-1-pyrroline-5-carboxylate dehydrogenase, nuclear-encoded mitochondrial protein involved in utilization of proline as sole nitrogen source; deficiency of the human homolog causes HPII, an autosomal recessive inborn error of metabolism" * 122805-Holinger-03_itms_8.06286.06286.2 1.7446 0.0431 95.1 961.63434 963.134 5766.8 231 4.04 56.2 1 P.LGAEELVTM.L YLL058W 1 1 1.6% 575 64223 7.0 U YLL058W SGDID:S000003981, Chr XII from 23569-25296, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_6.05894.05894.2 1.6134 0.0079 91.7 906.5212 907.01105 2874.5 110 3.818 50.0 1 R.ELEAGVFAA.K YMR145C 1 1 1.6% 560 62774 9.3 U NDE1 SGDID:S000004753, Chr XIII from 556474-554792, reverse complement, Verified ORF, "Mitochondrial external NADH dehydrogenase, catalyzes the oxidation of cytosolic NADH; Nde1p and Nde2p are involved in providing the cytosolic NADH to the mitochondrial respiratory chain" * 122805-Holinger-03_itms_14.09330.09330.2 1.9542 0.0496 90.6 1139.5851 1140.3732 5029.8 71 3.775 75.0 1 D.WAKVYFLGR.D YER082C 1 1 1.6% 554 62317 9.4 U UTP7 SGDID:S000000884, Chr V from 325932-324268, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-03_itms_5.04471.04471.2 2.0982 0.2619 99.5 1122.6356 1123.2944 5251.5 39 5.041 68.8 1 K.KIDEQYKKA.V Reverse_YNL241C 1 1 1.6% 505 57522 6.3 U ZWF1 SGDID:S000005185, Chr XIV from 197944-196427, reverse complement, Verified ORF, "Glucose-6-phosphate dehydrogenase (G6PD), catalyzes the first step of the pentose phosphate pathway; involved in adapting to oxidatve stress; homolog of the human G6PD which is deficient in patients with hemolytic anemia" * 122805-Holinger-04_itms_11.08370.08370.2 1.8996 0.0593 94.1 979.4521 981.0068 7523.1 15 3.957 78.6 1 T.RLEDFGED.T YFL022C 1 1 1.6% 503 57511 5.8 U FRS2 SGDID:S000001872, Chr VI from 95008-93497, reverse complement, Verified ORF, "Alpha subunit of cytoplasmic phenylalanyl-tRNA synthetase, forms a tetramer with Frs1p to form active enzyme; evolutionarily distant from mitochondrial phenylalanyl-tRNA synthetase based on protein sequence, but substrate binding is similar" * 122805-Holinger-03_itms_14.09438.09438.2 1.6892 0.1446 95.4 936.5373 937.18524 4942.1 12 4.074 78.6 1 T.LGDLIKFM.E YBR126C 1 1 1.6% 495 56148 6.1 U TPS1 SGDID:S000000330, Chr II from 490386-488899, reverse complement, Verified ORF, "Synthase subunit of trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; also found in a monomeric form; expression is induced by the stress response and repressed by the Ras-cAMP pathway" * 122805-Holinger-04_itms_9.06810.06810.1 1.7008 0.2837 97.5 913.5636 914.09283 2821.1 177 5.203 57.1 1 S.NRLPVTIT.K YDL112W 1 1 1.5% 1436 165047 6.1 U TRM3 SGDID:S000002270, Chr IV from 258915-263225, Verified ORF, "2'-O-ribose methyltransferase, catalyzes the ribose methylation of the guanosine nucleotide at position 18 of tRNAs" * 122805-Holinger-06_itms_12.10436.10436.3 2.6086 0.0486 93.1 2606.4893 2605.159 7834.8 352 4.004 23.8 1 L.HLMLIKGLFHPVILYFGSNQYI.D YBL101C 1 1 1.5% 1117 123609 6.9 U ECM21 SGDID:S000000197, Chr II from 28299-24946, reverse complement, Verified ORF, "Non-essential protein of unknown function; promoter contains several Gcn4p binding elements" * 122805-Holinger-04_itms_20.13476.13476.2 1.7908 0.0265 91.9 2010.3121 2008.4177 7934.1 47 3.836 34.4 1 T.IYLPSARVSYRLRLATK.A YKR064W 1 1 1.5% 863 101825 6.9 U YKR064W SGDID:S000001772, Chr XI from 562189-564780, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; detectable in highly purified mitochondria" * 122805-Holinger-05_itms_11.08744.08744.2 2.9375 0.0768 91.2 1391.8914 1393.7532 5450.4 65 3.798 54.2 1 I.VEIVANKVLVIVP.A YKL188C 1 1 1.5% 853 97126 8.9 U PXA2 SGDID:S000001671, Chr XI from 88791-86230, reverse complement, Verified ORF, "Subunit of a heterodimeric peroxisomal ATP-binding cassette transporter complex (Pxa1p-Pxa2p), required for import of long-chain fatty acids into peroxisomes; similarity to human adrenoleukodystrophy transporter and ALD-related proteins" * 122805-Holinger-06_itms_14.11805.11805.2 1.7001 0.1432 96.4 1504.85 1504.7661 4881.6 1 4.171 50.0 1 A.IYDVATAFVIKYT.W YER162C 1 1 1.5% 754 87204 7.8 U RAD4 SGDID:S000000964, Chr V from 502889-500625, reverse complement, Verified ORF, "Protein that recognizes and binds damaged DNA (with Rad23p) during nucleotide excision repair; subunit of Nuclear Excision Repair Factor 2 (NEF2); homolog of human XPC protein" * 122805-Holinger-02_itms_7.06158.06158.2 2.0612 0.111 90.5 1322.6935 1320.5742 4417.0 162 3.767 55.0 1 K.FSKKWITVDPV.N Reverse_YOR080W 1 1 1.5% 746 86801 9.1 U DIA2 SGDID:S000005606, Chr XV from 474553-476793, Verified ORF, "Protein of unknown function, involved in invasive and pseudohyphal growth" * 122805-Holinger-05_itms_17.12270.12270.2 1.6882 0.2307 91.7 1005.10736 1004.1028 3654.8 217 3.82 45.0 1 I.AVGSNGPSSMP.T Reverse_YBL067C 1 1 1.5% 747 83865 6.2 U UBP13 SGDID:S000000163, Chr II from 95884-93641, reverse complement, Verified ORF, "Putative ubiquitin-specific protease" * 122805-Holinger-04_itms_5.04775.04775.2 2.7178 0.0419 90.4 1276.679 1277.2842 5901.8 32 3.751 65.0 1 L.IEQIDTEEDGQ.V YBR172C 1 1 1.5% 740 81397 8.8 U SMY2 SGDID:S000000376, Chr II from 581367-579145, reverse complement, Verified ORF, "Protein of unknown function that interacts with Myo2p; has similarity to S. pombe Mpd2" * 122805-Holinger-01_itms_23.15372.15372.2 1.5495 0.1467 91.8 1077.7427 1080.1827 3297.7 356 3.826 50.0 1 A.ASVNTVPGSTF.R Reverse_YLR083C 1 1 1.5% 667 75963 6.9 U EMP70 SGDID:S000004073, Chr XII from 296095-294092, reverse complement, Verified ORF, "Protein whose 24kDa cleavage product is found in endosome-enriched membrane fractions, predicted to be a transmembrane protein" * 122805-Holinger-05_itms_20.14042.14042.2 1.61 0.1483 96.6 1093.6014 1091.209 2462.6 3 4.193 61.1 1 R.GDYVERAAPL.G Reverse_YKL079W 1 1 1.5% 656 73799 6.9 U SMY1 SGDID:S000001562, Chr XI from 286247-288217, Verified ORF, "Protein that interacts with Myo2p, proposed to be involved in exocytosis; N-terminal domain is related to the motor domain of kinesins" * 122805-Holinger-04_itms_5.04800.04800.2 1.6472 0.0472 90.0 1193.7372 1196.3551 4687.8 189 3.733 50.0 1 V.HAPCIDKIEL.D YLR401C 1 1 1.5% 609 69817 7.8 U DUS3 SGDID:S000004393, Chr XII from 924447-922618, reverse complement, Uncharacterized ORF, "Dihydrouridine synthase, member of a widespread family of conserved proteins including Smm1p, Dus1p, and Dus4p; contains a consensus oleate response element (ORE) in its promoter region" * 122805-Holinger-04_itms_18.12199.12199.2 1.4878 0.0543 91.3 954.8854 954.0679 2465.8 451 3.799 62.5 1 R.KLGADVTYS.E Reverse_YCR023C 1 1 1.5% 611 69218 7.4 U YCR023C SGDID:S000000617, Chr III from 160368-158533, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_10.07700.07700.2 2.1466 0.0659 92.2 1113.686 1115.4341 3803.4 2 3.855 68.8 1 V.VYPVMVYMI.P YGL125W 1 1 1.5% 600 68560 5.8 U MET13 SGDID:S000003093, Chr VII from 272526-274328, Verified ORF, "Isozyme of methylenetetrahydrofolate reductase, catalyzes the reduction of 5,10-methylenetetrahydrofolate to 5-methyltetrahydrofolate in the methionine biosynthesis pathway" * 122805-Holinger-05_itms_3.03969.03969.2 1.5327 0.1409 91.8 930.5547 930.11005 3927.2 62 3.822 56.2 1 V.RAAGMDVPI.I Reverse_YCR088W 1 1 1.5% 592 65576 4.7 U ABP1 SGDID:S000000684, Chr III from 265064-266842, Verified ORF, "Actin-binding protein of the cortical actin cytoskeleton, important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization" * 122805-Holinger-05_itms_20.13892.13892.2 1.5677 0.3176 99.6 882.0319 882.0067 2753.1 215 5.165 56.2 1 N.AVAAFNAAF.S YML123C 1 1 1.5% 587 64382 6.4 U PHO84 SGDID:S000004592, Chr XIII from 25801-24038, reverse complement, Verified ORF, "High-affinity inorganic phosphate (Pi) transporter and low-affinity manganese transporter; regulated by Pho4p and Spt7p; mutation confers resistance to arsenate; exit from the ER during maturation requires Pho86p" * 122805-Holinger-03_itms_20.12878.12878.2 1.8247 0.1992 96.5 982.3458 980.02203 2103.5 179 4.182 68.8 1 F.QNFGPNTTT.F YML070W 1 1 1.5% 584 62207 5.4 U DAK1 SGDID:S000004535, Chr XIII from 133475-135229, Verified ORF, "Dihydroxyacetone kinase, required for detoxification of dihydroxyacetone (DHA); involved in stress adaptation" * 122805-Holinger-05_itms_9.07358.07358.2 1.699 0.0625 98.7 885.5211 888.0086 4029.6 90 4.496 62.5 1 I.TPVQTIAGT.L YDR057W 1 1 1.5% 542 61258 4.6 U YOS9 SGDID:S000002464, Chr IV from 565924-567552, Verified ORF, "Lectin; soluble lumenal ER protein; member of the OS-9 protein family; similar to mannose-6-phosphate receptors (MPRs); serves as a receptor that recognizes misfolded N-glycosylated proteins and participates in their targeting to ERAD" * 122805-Holinger-04_itms_15.10588.10588.2 1.6997 0.0928 94.6 962.03394 963.1364 4348.4 69 3.994 71.4 1 V.WLAEVVDM.K YFL040W 1 1 1.5% 540 60610 8.5 U YFL040W SGDID:S000001854, Chr VI from 51350-52972, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_7.05551.05551.1 1.6022 0.1232 98.6 792.413 792.7837 1854.8 249 5.295 42.9 1 S.NSNGGSTR.S Reverse_YDL038C 1 1 1.5% 583 58523 4.4 U YDL038C SGDID:S000002196, Chr IV from 384078-382327, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_7.05715.05715.2 2.0381 0.1835 96.4 904.4869 905.0361 3380.8 16 4.166 68.8 1 S.TSIVVSTTP.D YGR002C 1 1 1.5% 476 55213 9.3 U SWC4 SGDID:S000003234, Chr VII from 499910-498480, reverse complement, Verified ORF, "Protein of unknown function, component of the Swr1p complex that incorporates Htz1p into chromatin; component of the NuA4 histone acetyltransferase complex" * 122805-Holinger-04_itms_5.04768.04768.2 1.7571 0.0108 93.1 827.45374 826.94275 2519.8 320 3.919 58.3 1 S.QGMSQLY.N YOR341W 2 2 1.4% 1664 186431 7.1 U RPA190 SGDID:S000005868, Chr XV from 960982-965976, Verified ORF, "RNA polymerase I subunit; largest subunit of RNA polymerase I" * 122805-Holinger-03_itms_13.08820.08820.2 2.5285 0.166 95.5 1234.7003 1235.4258 6902.6 1 4.099 77.8 1 K.NILDTVFRKE.Q * 122805-Holinger-02_itms_14.09557.09557.2 2.1981 0.1558 92.8 1704.715 1706.7982 5772.9 21 3.881 50.0 1 A.YNADFDGDEMNMHF.P Reverse_YHR120W 1 1 1.4% 959 109408 8.7 U MSH1 SGDID:S000001162, Chr VIII from 349577-352456, Verified ORF, "DNA-binding protein of the mitochondria involved in repair of mitochondrial DNA, has ATPase activity and binds to DNA mismatches; has homology to E. coli MutS; transcription is induced during meiosis" * 122805-Holinger-05_itms_4.04279.04279.2 1.2004 0.2328 99.4 1357.6547 1355.6206 2457.0 34 4.985 41.7 1 D.IKKLSSATGTVHL.A Reverse_YNL243W 1 1 1.4% 968 108996 5.5 U SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" * 122805-Holinger-04_itms_11.07924.07924.2 2.0559 0.1364 92.8 1465.3677 1464.6616 4937.2 12 3.904 53.8 1 I.AEALASPHGEQIIK.H YNL243W 1 1 1.4% 968 108996 5.5 U SLA2 SGDID:S000005187, Chr XIV from 188052-190958, Verified ORF, "Transmembrane actin-binding protein involved in membrane cytoskeleton assembly and cell polarization; adaptor protein that links actin to clathrin and endocytosis; present in the actin cortical patch of the emerging bud tip; dimer in vivo" * 122805-Holinger-04_itms_13.09497.09497.2 2.3176 0.2042 98.7 1510.8809 1511.8015 6830.7 51 4.564 46.2 1 L.VTIPKLPVDAPDVF.L YMR205C 1 1 1.4% 959 104618 6.7 U PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" * 122805-Holinger-05_itms_9.07404.07404.2 2.7221 0.0206 97.6 1460.8263 1461.6982 5455.8 1 4.325 66.7 1 M.KTTDTYPSLPKPL.N YKR021W 1 1 1.4% 915 102540 6.0 U YKR021W SGDID:S000001729, Chr XI from 478877-481624, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" * 122805-Holinger-05_itms_16.11327.11327.2 1.6831 0.1175 92.8 1416.7197 1415.5864 5388.3 270 3.901 41.7 1 I.KVVRLPSDGSVEE.T YGR204W 1 1 1.4% 946 102205 6.8 U ADE3 SGDID:S000003436, Chr VII from 905939-908779, Verified ORF, "Cytoplasmic trifunctional enzyme C1-tetrahydrofolate synthase, involved in single carbon metabolism and required for biosynthesis of purines, thymidylate, methionine, and histidine" * 122805-Holinger-03_itms_12.08304.08304.2 3.0176 0.3212 100.0 1397.8126 1398.6396 8252.2 1 6.485 58.3 1 L.KLLTPVPSDIDIS.R Reverse_YLR166C 1 1 1.4% 871 100342 6.3 U SEC10 SGDID:S000004156, Chr XII from 498046-495431, reverse complement, Verified ORF, "Essential 100kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeting of secretory vesicles to active sites of exocytosis" * 122805-Holinger-03_itms_13.08942.08942.2 2.7356 0.1107 93.6 1456.0017 1455.7837 6609.6 35 3.94 45.5 1 I.KLIELIYLHAKN.P YLR386W 1 1 1.4% 880 99773 5.5 U VAC14 SGDID:S000004378, Chr XII from 893628-896270, Verified ORF, "Protein involved in regulated synthesis of PtdIns(3,5)P(2), in control of trafficking of some proteins to the vacuole lumen via the MVB, and in maintenance of vacuole size and acidity; activator of Fab1p" * 122805-Holinger-03_itms_21.13373.13373.2 1.9147 0.1825 96.9 1146.7555 1146.3501 5102.2 15 4.209 63.6 1 A.RNAGLMGLAATA.I YBR179C 1 1 1.4% 855 97808 7.0 U FZO1 SGDID:S000000383, Chr II from 589109-586542, reverse complement, Verified ORF, "Mitochondrial integral membrane protein involved in mitochondrial fusion and maintenance of the mitochondrial genome; contains N-terminal GTPase domain" * 122805-Holinger-02_itms_14.09559.09559.2 2.248 0.0433 90.5 1365.766 1366.4705 7482.7 37 3.769 59.1 1 R.DLSPETYKRAAD.F YDR422C 1 1 1.4% 863 96259 6.6 U SIP1 SGDID:S000002830, Chr IV from 1317907-1315316, reverse complement, Verified ORF, "Alternate beta-subunit of the Snf1p kinase complex, may confer substrate specificity; vacuolar protein containing KIS (Kinase-Interacting Sequence) and ASC (Association with Snf1 kinase Complex) domains involved in protein interactions" * 122805-Holinger-04_itms_13.09356.09356.2 2.4235 0.1696 98.4 1459.823 1460.716 5928.8 458 4.416 50.0 1 S.RYPVPDLPIYLN.S YJL078C 1 1 1.4% 881 89152 4.6 U PRY3 SGDID:S000003614, Chr X from 293897-291252, reverse complement, Verified ORF, "Protein of unknown function, has similarity to Pry1p and Pry2p and to the plant PR-1 class of pathogen related proteins" * 122805-Holinger-02_itms_18.12135.12135.2 2.1345 0.1819 99.0 1192.7976 1194.3269 4062.0 88 4.619 59.1 1 T.VVPASSFPSTTT.T Reverse_YNL186W 1 1 1.4% 792 88517 5.5 U UBP10 SGDID:S000005130, Chr XIV from 289500-291878, Verified ORF, "Ubiquitin-specific protease that deubiquitinates ubiquitin-protein moieties; may regulate silencing by acting on Sir4p; involved in posttranscriptionally regulating Gap1p and possibly other transporters; primarily located in the nucleus" * 122805-Holinger-05_itms_7.06165.06165.2 1.9457 0.202 97.0 1221.6782 1223.4148 6078.8 1 4.256 60.0 1 S.EILKHGKPVSD.E Reverse_YLR266C 1 1 1.4% 701 81274 6.8 U PDR8 SGDID:S000004256, Chr XII from 677726-675621, reverse complement, Verified ORF, "Transcription factor; targets include ATP-binding cassette (ABC) transporters, major facilitator superfamily transporters, and other genes involved in the pleiotropic drug resistance (PDR) phenomenon" * 122805-Holinger-03_itms_8.06327.06327.2 2.3976 0.0586 94.6 1176.6581 1178.3275 5221.6 415 4.012 61.1 1 D.LLSLIDDQNF.I YOL095C 1 1 1.4% 706 80576 8.6 U HMI1 SGDID:S000005455, Chr XV from 141346-139226, reverse complement, Verified ORF, "Mitochondrial inner membrane localized ATP-dependent DNA helicase, required for the maintenance of the mitochondrial genome; not required for mitochondrial transcription" * 122805-Holinger-03_itms_4.03609.03609.2 1.8073 0.1935 91.6 1023.57715 1025.9556 4286.0 24 3.81 61.1 1 L.ELDSSDSDAS.S YGL066W 1 1 1.4% 657 72878 8.9 U SGF73 SGDID:S000003034, Chr VII from 377612-379585, Verified ORF, "Probable 73 kDa subunit of SAGA histone acetyltransferase complex" * 122805-Holinger-02_itms_4.04175.04175.2 2.0798 0.1204 91.7 1060.5011 1061.1019 3965.0 19 3.819 62.5 1 Q.QQQHHSPQA.Q YDR390C 1 1 1.4% 636 71259 5.1 U UBA2 SGDID:S000002798, Chr IV from 1256837-1254927, reverse complement, Verified ORF, "Nuclear protein that acts as a heterodimer with Aos1p to activate Smt3p (SUMO) before its conjugation to proteins (sumoylation), which may play a role in protein targeting; essential for viability" * 122805-Holinger-04_itms_7.05976.05976.2 1.7449 0.1059 94.6 981.5338 983.1527 4921.9 397 3.995 62.5 1 M.QPIIPGKTE.C Reverse_YMR227C 1 1 1.4% 590 67556 4.6 U TAF7 SGDID:S000004840, Chr XIII from 724384-722612, reverse complement, Verified ORF, "TFIID subunit (67 kDa), involved in RNA polymerase II transcription initiation" * 122805-Holinger-02_itms_9.07121.07121.1 2.0539 0.1492 91.7 909.4 909.89703 4649.7 235 4.838 57.1 1 E.EEMGEEGE.E Reverse_YPR137W 1 1 1.4% 573 65054 5.7 U RRP9 SGDID:S000006341, Chr XVI from 802355-804076, Verified ORF, "Protein involved in pre-rRNA processing, associated with U3 snRNP; component of small ribosomal subunit (SSU) processosome; ortholog of the human U3-55k protein" * 122805-Holinger-02_itms_18.12228.12228.2 1.6944 0.1719 91.4 1011.2563 1013.17847 4039.8 309 3.807 64.3 1 G.YLIELQSF.Q Reverse_YBL034C 1 1 1.3% 1513 174176 6.3 U STU1 SGDID:S000000130, Chr II from 158392-153851, reverse complement, Verified ORF, "Component of the mitotic spindle that binds to interpolar microtubules via its association with beta-tubulin (Tub2p); required for interpolar microtubules to provide an outward force on the spindle poles" * 122805-Holinger-05_itms_13.09950.09950.2 1.2105 0.1225 94.3 1787.9415 1786.0385 1905.6 224 3.975 27.8 1 L.KNSLKSAIVSGGATVAPAN.L YGL131C 1 1 1.3% 1403 163203 8.6 U SNT2 SGDID:S000003099, Chr VII from 265864-261653, reverse complement, Verified ORF, "DNA binding protein with similarity to the S. pombe Snt2 protein" * 122805-Holinger-05_itms_14.10316.10316.2 2.1091 0.2148 90.6 1821.7069 1821.939 5923.2 335 5.237 38.2 1 S.IKTGGSSSGS*VSVDKGFK.F YDR216W 1 1 1.3% 1323 150941 6.7 U ADR1 SGDID:S000002624, Chr IV from 895029-899000, Verified ORF, "Carbon source-responsive zinc-finger transcription factor, required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization" * 122805-Holinger-03_itms_16.10663.10663.2 2.001 0.1692 97.4 1755.2404 1752.8779 5869.1 1 4.301 43.8 1 R.SAHFLSDTGLEGINFSG.L YER176W 1 1 1.3% 1121 126970 9.4 U ECM32 SGDID:S000000978, Chr V from 541685-545050, Verified ORF, "DNA dependent ATPase/DNA helicase belonging to the Dna2p- and Nam7p-like family of helicases that is involved in modulating translation termination; interacts with the translation termination factors, localized to polysomes" * 122805-Holinger-05_itms_20.13873.13873.2 1.7168 0.108 97.6 1637.4465 1638.7318 5645.0 1 4.322 50.0 1 K.KENSTIQSSSSSNLR.N YNR065C 1 1 1.3% 1116 125200 5.1 U YNR065C SGDID:S000005348, Chr XIV from 753700-750350, reverse complement, Uncharacterized ORF, "Sortilin homolog, interacts with proteins of the endocytic machinery" * 122805-Holinger-03_itms_14.09640.09640.3 3.0249 0.1705 95.8 1656.8193 1660.7892 5614.4 50 4.106 37.5 1 L.FGSKGNIFSTHDRGH.S YIL112W 1 1 1.3% 1083 123556 5.7 U HOS4 SGDID:S000001374, Chr IX from 151592-154843, Uncharacterized ORF, "Subunit of the Set3 complex, which is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate" * 122805-Holinger-06_itms_11.09958.09958.2 1.8601 0.1866 98.8 1384.8585 1387.3562 7478.2 262 4.53 42.3 1 T.DDVGSDDPTAPNSP.I YDL077C 1 1 1.3% 1049 122881 7.1 U VAM6 SGDID:S000002235, Chr IV from 320120-316971, reverse complement, Verified ORF, "Vacuolar protein that plays a critical role in the tethering steps of vacuolar membrane fusion by facilitating guanine nucleotide exchange on small guanosine triphosphatase Ypt7p" * 122805-Holinger-03_itms_13.09127.09127.2 3.0726 0.2475 99.3 1567.8406 1568.7698 6015.8 1 4.815 61.5 1 Q.NAKNDPLPPVIENF.Y Reverse_YER075C 1 1 1.3% 928 105251 7.2 U PTP3 SGDID:S000000877, Chr V from 311195-308409, reverse complement, Verified ORF, "Phosphotyrosine-specific protein phosphatase involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm" * 122805-Holinger-03_itms_13.08774.08774.2 2.6986 0.0951 93.8 1382.7905 1384.6182 9245.7 65 3.948 59.1 1 N.LLTGLDPWNKVQ.I YER075C 1 1 1.3% 928 105251 7.2 U PTP3 SGDID:S000000877, Chr V from 311195-308409, reverse complement, Verified ORF, "Phosphotyrosine-specific protein phosphatase involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm" * 122805-Holinger-06_itms_9.08618.08618.2 1.3645 0.0719 91.8 1241.8005 1239.3304 4744.2 424 3.824 36.4 1 G.IKHSHSTSDGGI.L Reverse_YHR098C 1 1 1.3% 929 103950 6.3 U SFB3 SGDID:S000001140, Chr VIII from 301937-299148, reverse complement, Verified ORF, "Member of the Sec24p family; forms a complex, with Sec23p, that is involved in sorting of Pma1p into COPII vesicles; peripheral ER membrane protein; potential Cdc28p substrate" * 122805-Holinger-04_itms_10.07394.07394.2 2.8477 0.1728 97.5 1461.9102 1459.765 7626.4 119 4.322 59.1 1 V.DKIMIRMVPNQN.I YDR074W 1 1 1.3% 896 102976 8.1 U TPS2 SGDID:S000002481, Chr IV from 593889-596579, Verified ORF, "Phosphatase subunit of the trehalose-6-phosphate synthase/phosphatase complex, which synthesizes the storage carbohydrate trehalose; expression is induced by stress conditions and repressed by the Ras-cAMP pathway" * 122805-Holinger-05_itms_10.08229.08229.2 1.9675 0.1581 92.8 1466.7355 1468.5627 4730.9 19 3.898 54.5 1 P.YKIQLGESNDDW.K Reverse_YNR013C 1 1 1.3% 894 99490 8.0 U PHO91 SGDID:S000005296, Chr XIV from 651714-649030, reverse complement, Verified ORF, "Low-affinity phosphate transporter; deletion of pho84, pho87, pho89, pho90, and pho91 causes synthetic lethality; transcription independent of Pi and Pho4p activity; overexpression results in vigorous growth" * 122805-Holinger-03_itms_19.12105.12105.2 1.7638 0.1401 97.8 1091.7396 1093.2836 4512.8 11 4.344 54.5 1 S.SVAKGLTTGGMA.L Reverse_YJL047C 1 1 1.3% 842 99326 7.6 U RTT101 SGDID:S000003583, Chr X from 352024-349496, reverse complement, Verified ORF, "Cullin subunit of a Roc1p-dependent E3 ubiquitin ligase complex; deletion phenotype suggests a role in anaphase progression; interacts with Mms22p and implicated in Mms22-dependent DNA repair; modified by the ubiquitin-like protein, Rub1p" * 122805-Holinger-04_itms_9.06843.06843.3 3.219 0.1835 96.7 1288.6895 1290.4154 5417.8 3 4.236 52.5 1 L.TLHDSENFLTL.V YJL047C 1 1 1.3% 842 99326 7.6 U RTT101 SGDID:S000003583, Chr X from 352024-349496, reverse complement, Verified ORF, "Cullin subunit of a Roc1p-dependent E3 ubiquitin ligase complex; deletion phenotype suggests a role in anaphase progression; interacts with Mms22p and implicated in Mms22-dependent DNA repair; modified by the ubiquitin-like protein, Rub1p" * 122805-Holinger-04_itms_11.08071.08071.2 2.7766 0.088 90.2 1350.7924 1351.6287 7913.2 18 3.738 65.0 1 S.FIKDILPVYKD.S YLR057W 1 2 1.3% 849 96997 5.7 U YLR057W SGDID:S000004047, Chr XII from 255307-257856, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_10.07991.07991.2 2.5496 0.1821 91.8 1314.7316 1316.407 3603.2 35 3.835 65.0 2 N.DLFQSSYDILD.G Reverse_YOL155C 1 1 1.3% 967 94706 4.3 U YOL155C SGDID:S000005515, Chr XV from 31605-28702, reverse complement, Uncharacterized ORF, "ORF" * 122805-Holinger-04_itms_19.12501.12501.2 1.4244 0.0179 94.5 1196.3236 1199.3031 4163.5 42 3.991 50.0 1 I.LTSATSGTVSAGF.S YMR089C 1 1 1.3% 825 93276 7.6 U YTA12 SGDID:S000004695, Chr XIII from 448085-445608, reverse complement, Verified ORF, "Component, with Afg3p, of the mitochondrial inner membrane m-AAA protease that mediates degradation of misfolded or unassembled proteins and is also required for correct assembly of mitochondrial enzyme complexes" * 122805-Holinger-04_itms_11.07843.07843.2 2.3376 0.0686 98.0 1378.7366 1377.5454 3861.6 246 4.369 50.0 1 G.KRPFPERNDAF.D Reverse_YDL239C 1 1 1.3% 790 91740 8.6 U ADY3 SGDID:S000002398, Chr IV from 28775-26403, reverse complement, Verified ORF, "Protein required for spore wall formation, thought to mediate assembly of a Don1p-containing structure at the leading edge of the prospore membrane via interaction with spindle pole body components; potentially phosphorylated by Cdc28p" * 122805-Holinger-03_itms_9.06591.06591.2 3.0049 0.0705 96.7 1273.6865 1274.4166 6087.8 243 4.194 72.2 1 E.QIRDDKEELK.Q YMR212C 1 1 1.3% 782 89190 7.5 U EFR3 SGDID:S000004825, Chr XIII from 693042-690694, reverse complement, Verified ORF, "Non-essential protein of unknown function; exhibits synthetic lethal genetic interactions with PHO85; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery" * 122805-Holinger-05_itms_10.08274.08274.2 2.2559 0.0225 93.7 1056.659 1057.2786 6262.3 2 3.945 72.2 1 N.SLRLAPISSL.S YJL033W 1 1 1.3% 770 87193 7.4 U HCA4 SGDID:S000003570, Chr X from 383753-386065, Verified ORF, "Putative nucleolar DEAD box RNA helicase; high-copy number suppression of a U14 snoRNA processing mutant suggests an involvement in 18S rRNA synthesis" * 122805-Holinger-03_itms_15.10020.10020.2 2.854 0.1771 95.4 1128.725 1129.4282 4539.4 9 4.074 72.2 1 L.AFLVPVIEKL.Y YCL045C 1 1 1.3% 760 87181 5.3 U YCL045C SGDID:S000000550, Chr III from 46905-44623, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_10.07333.07333.2 1.3428 0.1003 92.3 1016.6079 1016.1417 2777.3 35 3.857 50.0 1 I.VLTHDGFIGG.L Reverse_YBR142W 1 1 1.3% 773 87048 8.4 U MAK5 SGDID:S000000346, Chr II from 528311-530632, Verified ORF, "Essential nucleolar protein, putative DEAD-box RNA helicase required for maintenance of M1 dsRNA virus; involved in biogenesis of large (60S) ribosomal subunits" * 122805-Holinger-03_itms_11.07656.07656.2 1.9296 0.0839 96.8 1216.6559 1219.4882 8045.7 329 4.199 55.6 1 E.LSKLRNKQTM.S YDR490C 1 1 1.3% 766 86253 9.2 U PKH1 SGDID:S000002898, Chr IV from 1434258-1431958, reverse complement, Verified ORF, "Serine/threonine protein kinase involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; redundant with Pkh2p" * 122805-Holinger-05_itms_10.08095.08095.2 2.0266 0.1157 91.9 1055.7903 1057.2815 8298.1 4 3.832 72.2 1 E.RGAAKIVKDV.V YKR067W 1 1 1.3% 743 83645 9.5 U GPT2 SGDID:S000001775, Chr XI from 567560-569791, Verified ORF, "Glycerol-3-phosphate acyltransferase located in both lipid particles and the ER; involved in the stepwise acylation of glycerol-3-phosphate and dihydroxyacetone, which are intermediate steps in lipid biosynthesis" * 122805-Holinger-04_itms_20.13270.13270.2 2.1471 0.1308 90.4 1203.0594 1202.4019 3823.8 68 3.753 55.6 1 I.QAARRLYQPV.K YEL011W 1 1 1.3% 704 81116 6.2 U GLC3 SGDID:S000000737, Chr V from 133120-135234, Verified ORF, "Glycogen branching enzyme, involved in glycogen accumulation; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-05_itms_18.12796.12796.2 1.8103 0.1125 90.4 1095.6791 1093.1908 6496.0 95 3.762 68.8 1 E.KVVAYCESH.D Reverse_YHR074W 1 1 1.3% 714 80686 6.5 U QNS1 SGDID:S000001116, Chr VIII from 246195-248339, Verified ORF, "Glutamine-dependent NAD(+) synthetase, essential for the formation of NAD(+) from nicotinic acid adenine dinucleotide" * 122805-Holinger-02_itms_7.05742.05742.2 2.2598 0.1969 99.0 1109.5854 1111.2549 4057.8 105 4.628 68.8 1 S.QVYDKTMPE.L YDR108W 1 1 1.3% 698 80495 6.4 U GSG1 SGDID:S000002515, Chr IV from 671264-673360, Verified ORF, "Subunit of TRAPP (transport protein particle), a multi-subunit complex involved in targeting and/or fusion of ER-to-Golgi transport vesicles with their acceptor compartment; protein has late meiotic role, following DNA replication" * 122805-Holinger-05_itms_5.05298.05298.2 2.3185 0.0635 98.1 1105.7565 1104.4246 5574.7 102 4.382 62.5 1 L.AKKLKKQLF.V Reverse_YNL103W 1 1 1.3% 672 74373 5.8 U MET4 SGDID:S000005047, Chr XIV from 427737-429755, Verified ORF, "Lecine-zipper transcriptional activator, responsible for the regulation of the sulfur amino acid pathway, requires different combinations of the auxiliary factors Cbf1p, Met28p, Met31p and Met32p" * 122805-Holinger-05_itms_10.08118.08118.2 2.1544 0.2214 99.3 970.4978 972.0856 7518.3 6 4.685 75.0 1 D.FGASILSNY.A YDR425W 1 1 1.3% 625 70741 7.0 U SNX41 SGDID:S000002833, Chr IV from 1320054-1321931, Verified ORF, "Sorting nexin, involved in the retrieval of late-Golgi SNAREs from the post-Golgi endosome to the trans-Golgi network; forms a complex with Snx4p and Atg20p" * 122805-Holinger-02_itms_21.13827.13827.2 1.4175 0.0358 96.9 799.5692 796.81244 2218.8 133 4.217 50.0 1 S.RASTSSST.S Reverse_YDL153C 1 1 1.3% 610 70260 4.7 U SAS10 SGDID:S000002312, Chr IV from 183019-181187, reverse complement, Verified ORF, "Component of the small (ribosomal) subunit (SSU) processosome required for pre-18S rRNa processing; essential nucleolar protein that, when overproduced, disrupts silencing" * 122805-Holinger-02_itms_10.07741.07741.1 2.0703 0.2155 94.5 864.4607 865.0605 5408.9 1 4.971 78.6 1 L.YSGLAILK.L YJL045W 1 1 1.3% 634 69383 7.4 U YJL045W SGDID:S000003581, Chr X from 355940-357844, Uncharacterized ORF, "Similar to SDH1" YKL148C 1 1 1.2% 640 70229 7.5 U SDH1 SGDID:S000001631, Chr XI from 171134-169212, reverse complement, Verified ORF, "Flavoprotein subunit of succinate dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p), which couples the oxidation of succinate to the transfer of electrons to ubiquinone" 122805-Holinger-03_itms_11.07483.07483.2 2.2844 0.19 97.0 939.5082 939.9543 5427.7 89 4.246 71.4 1 A.YNQEDGTI.H Reverse_YDR144C 1 1 1.3% 596 64269 4.8 U MKC7 SGDID:S000002551, Chr IV from 746096-744306, reverse complement, Verified ORF, "GPI-anchored aspartyl protease (yapsin) involved in protein processing; shares functions with Yap3p and Kex2p" * 122805-Holinger-04_itms_23.14981.14981.1 1.4024 0.1867 95.4 726.9793 725.90656 4566.7 3 4.989 71.4 1 L.GPLGIGLV.G Reverse_YNL029C 1 1 1.3% 522 61728 5.7 U KTR5 SGDID:S000004974, Chr XIV from 578774-577206, reverse complement, Verified ORF, "Putative mannosyltransferase involved in protein glycosylation; member of the KRE2/MNT1 mannosyltransferase family" * 122805-Holinger-03_itms_7.05672.05672.2 1.9599 0.3031 98.7 848.4806 850.0519 4360.2 26 4.585 75.0 1 Y.KQVLPHK.Y Reverse_YDL088C 1 1 1.3% 528 58793 7.9 U ASM4 SGDID:S000002246, Chr IV from 300003-298417, reverse complement, Verified ORF, "Nuclear pore complex subunit, part of a subcomplex also containing Nup53p, Nup170p, and Pse1p" * 122805-Holinger-03_itms_13.08998.08998.2 1.5407 0.1235 94.0 829.4969 830.87537 3533.9 6 3.955 83.3 1 P.NNVWSPN.N Reverse_YOL081W 2 2 1.2% 3079 351669 7.1 U IRA2 SGDID:S000005441, Chr XV from 171069-180308, Verified ORF, "GTPase-activating protein that negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, has similarity to Ira1p and human neurofibromin" * 122805-Holinger-04_itms_18.12163.12163.2 1.7926 0.138 95.2 2526.5696 2524.9028 8024.5 292 4.045 23.8 1 K.VHFHNKVGLNVESHQLASFMKT.M * 122805-Holinger-05_itms_16.11202.11202.2 2.2069 0.11 90.8 1422.7783 1423.6952 6623.0 3 3.782 53.8 1 I.FLIGSLSALIGAFN.R YJL039C 2 2 1.2% 1683 191534 5.3 U NUP192 SGDID:S000003576, Chr X from 373715-368664, reverse complement, Verified ORF, "Essential structural subunit of the nuclear pore complex (NPC), localizes to the nuclear periphery of nuclear pores, homologous to human p205" * 122805-Holinger-04_itms_8.06673.06673.2 2.6045 0.1705 94.6 1031.5012 1030.0789 4363.3 129 3.993 75.0 1 K.ESNAYGFIE.W * 122805-Holinger-05_itms_11.08358.08358.3 2.2803 0.273 98.4 1314.8021 1315.6011 3683.1 56 4.3 42.5 1 V.LGFLQLFHNLI.S YCL014W 1 1 1.2% 1636 184718 6.2 U BUD3 SGDID:S000000520, Chr III from 96280-101190, Verified ORF, "Protein involved in bud-site selection and required for axial budding pattern; localizes with septins to bud neck in mitosis and may constitute an axial landmark for next round of budding" * 122805-Holinger-05_itms_10.07828.07828.3 2.6552 0.1376 92.6 1934.0753 1931.0233 5667.6 292 3.954 29.2 1 D.AETDDQIIGKATNSSSVHG.N Reverse_YDR159W 1 1 1.2% 1301 149568 8.9 U SAC3 SGDID:S000002566, Chr IV from 771872-775777, Verified ORF, "Nuclear pore-associated protein, forms a complex with Thp1p that is involved in transcription and in mRNA export from the nucleus" * 122805-Holinger-05_itms_7.06406.06406.2 2.2806 0.0424 90.8 1954.9968 1956.3041 5101.6 295 3.782 33.3 1 K.HKKNLTHSLARLAYFR.I YMR076C 1 1 1.2% 1277 147041 6.3 U PDS5 SGDID:S000004681, Chr XIII from 420028-416195, reverse complement, Verified ORF, "Protein required for establishment and maintenance of sister chromatid condensation and cohesion, colocalizes with cohesin on chromosomes in an interdependent manner, may function as a protein-protein interaction scaffold" * 122805-Holinger-04_itms_5.04876.04876.3 3.0315 0.1095 93.6 1657.9427 1658.9781 3126.0 329 4.017 32.1 1 M.KLFFYLIASGGELIS.E YKR096W 1 1 1.2% 1195 137491 5.4 U YKR096W SGDID:S000001804, Chr XI from 626435-630022, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_9.07484.07484.2 2.4757 0.1134 98.1 1513.8654 1514.7648 6007.3 22 4.389 50.0 1 A.LLPSQPPHDLVIGQ.E YDL145C 1 1 1.2% 1201 135607 6.0 U COP1 SGDID:S000002304, Chr IV from 198177-194572, reverse complement, Verified ORF, "Alpha subunit of COPI vesicle coatomer complex, which surrounds transport vesicles in the early secretory pathway" * 122805-Holinger-04_itms_11.08322.08322.2 2.992 0.0962 97.3 1745.9238 1746.9672 6321.6 1 4.284 60.7 1 C.RTYIPSTPCELPAQL.G Reverse_YPL006W 1 1 1.2% 1170 132645 5.2 U NCR1 SGDID:S000005927, Chr XVI from 544628-548140, Verified ORF, "Vacuolar membrane protein that transits through the biosynthetic vacuolar protein sorting pathway, involved in sphingolipid metabolism; glycoprotein and functional orthologue of human Niemann Pick C1 (NPC1) protein" * 122805-Holinger-04_itms_10.07393.07393.2 2.1764 0.1404 99.3 1531.7833 1531.856 6297.5 2 4.779 53.8 1 A.FNHVAPMTVFAAIL.F Reverse_YIL031W 1 1 1.2% 1034 116882 6.8 U ULP2 SGDID:S000001293, Chr IX from 292632-295736, Verified ORF, "Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins, plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate" * 122805-Holinger-01_itms_25.16412.16412.2 1.9905 0.1036 95.8 1263.8268 1265.4087 4342.9 169 4.114 54.5 1 K.KNSASSATSWIL.I YDL149W 1 1 1.2% 997 115403 6.0 U ATG9 SGDID:S000002308, Chr IV from 184926-187919, Verified ORF, "Transmembrane protein involved in formation of Cvt and autophagic vesicles; cycles between the pre-autophagosomal structure and other cytosolic punctate structures, not found in autophagosomes" * 122805-Holinger-02_itms_10.07837.07837.2 2.1543 0.0238 94.4 1383.669 1384.3984 6138.8 68 3.977 54.5 1 N.NDGFDDDTPLFQ.K Reverse_YIL002C 1 1 1.2% 946 108430 6.7 U INP51 SGDID:S000001264, Chr IX from 353428-350588, reverse complement, Verified ORF, "Phosphatidylinositol 4,5-bisphosphate 5-phosphatase, synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth" * 122805-Holinger-05_itms_14.10448.10448.2 1.9496 0.1489 91.9 1083.7142 1083.143 6583.8 28 3.836 60.0 1 P.TPSHTPGAISD.S YMR266W 1 1 1.2% 953 107672 8.6 U YMR266W SGDID:S000004879, Chr XIII from 798517-801378, Uncharacterized ORF, "Membrane protein of unknown function; overexpression suppresses NaCl sensitivity of sro7 mutant" * 122805-Holinger-03_itms_11.07960.07960.2 2.0914 0.0795 92.6 1225.6624 1226.4583 7310.8 4 3.873 65.0 1 P.FGFSKLLISDV.S YPL195W 1 1 1.2% 932 106924 5.1 U APL5 SGDID:S000006116, Chr XVI from 176222-179020, Verified ORF, "Delta adaptin-like subunit of the clathrin associated protein complex (AP-3); functions in transport of alkaline phosphatase to the vacuole via the alternate pathway, suppressor of loss of casein kinase 1 function" * 122805-Holinger-02_itms_17.11292.11292.2 2.3346 0.0947 92.0 1335.7109 1336.614 3679.3 1 3.846 75.0 1 P.FIQLSPLLYEI.L YMR066W 1 1 1.2% 898 104748 8.6 U SOV1 SGDID:S000004670, Chr XIII from 401540-404236, Uncharacterized ORF, "Mitochondrial protein of unknown function" * 122805-Holinger-03_itms_5.04266.04266.3 2.4 0.1775 99.5 1260.8341 1256.4875 3977.4 109 4.56 37.5 1 Y.KAAYSLFITNK.D YIL075C 1 1 1.2% 945 104232 6.2 U RPN2 SGDID:S000001337, Chr IX from 220697-217860, reverse complement, Verified ORF, "Subunit of the 26S proteasome, substrate of the N-acetyltransferase Nat1p" * 122805-Holinger-05_itms_24.15987.15987.2 1.738 0.0607 96.5 1241.8032 1241.3867 7089.5 26 4.176 60.0 1 T.EKLNPQVADIN.K Reverse_YKR079C 1 1 1.2% 838 96816 5.9 U TRZ1 SGDID:S000001787, Chr XI from 588947-586431, reverse complement, Uncharacterized ORF, "tRNase Z, involved in RNA processing, has two putative nucleotide triphosphate-binding motifs (P-loop) and a conserved histidine motif, homolog of the human candidate prostate cancer susceptibility gene ELAC2" * 122805-Holinger-03_itms_7.05609.05609.2 2.5559 0.1429 96.5 1162.653 1163.1863 5077.7 8 4.184 72.2 1 R.NSEQNSNEKL.I Reverse_YDL132W 1 1 1.2% 815 93944 8.4 U CDC53 SGDID:S000002290, Chr IV from 224304-226751, Verified ORF, "Cullin, structural protein of SCF complexes (which also contain Skp1p, Cdc34p, and an F-box protein) involved in ubiquitination; SCF promotes the G1-S transition by targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for degradation" * 122805-Holinger-05_itms_8.06655.06655.2 2.1787 0.0792 92.8 1052.6643 1051.2921 4025.2 18 3.885 61.1 1 F.PVMAAAIHQI.T Reverse_YER144C 1 1 1.2% 805 92260 8.3 U UBP5 SGDID:S000000946, Chr V from 460218-457801, reverse complement, Verified ORF, "Putative ubiquitin-specific protease that does not associate with the proteasome" * 122805-Holinger-03_itms_7.05724.05724.3 2.4521 0.1766 94.8 1209.8976 1206.2634 4545.7 135 4.097 41.7 1 C.KPCSWQEDVG.L YPL153C 1 1 1.2% 821 91962 7.8 U RAD53 SGDID:S000006074, Chr XVI from 264191-261726, reverse complement, Verified ORF, "Protein kinase, required for cell-cycle arrest in response to DNA damage; activated by trans autophosphorylation when interacting with hyperphosphorylated Rad9p" * 122805-Holinger-03_itms_11.07495.07495.2 1.7819 0.0329 97.4 1084.5133 1086.19 5557.7 17 4.302 61.1 1 I.HSVSLSQSQI.D YGL086W 1 1 1.2% 749 87651 5.4 U MAD1 SGDID:S000003054, Chr VII from 347122-349371, Verified ORF, "Coiled-coil protein involved in the spindle-assembly checkpoint; phosphorylated by Mps1p upon checkpoint activation which leads to inhibition of the activity of the anaphase promoting complex; forms a complex with Mad2p" * 122805-Holinger-05_itms_4.04251.04251.2 2.6393 0.1825 95.4 1221.7166 1222.43 6054.2 2 4.083 81.2 1 M.KYEKEIKRQ.S Reverse_YJL033W 1 1 1.2% 770 87193 7.4 U HCA4 SGDID:S000003570, Chr X from 383753-386065, Verified ORF, "Putative nucleolar DEAD box RNA helicase; high-copy number suppression of a U14 snoRNA processing mutant suggests an involvement in 18S rRNA synthesis" * 122805-Holinger-03_itms_15.09998.09998.2 2.0551 0.09 91.8 950.561 951.03625 3166.0 387 3.824 75.0 1 N.DIDAMVASE.K YMR167W 1 1 1.2% 769 87062 7.0 U MLH1 SGDID:S000004777, Chr XIII from 594885-597194, Verified ORF, "Protein required for mismatch repair in mitosis and meiosis, postmeiotic segregation, and spore viability; forms a complex with Pms1p and Msh2p to repair mismatched DNA; human homolog is associated with hereditary non-polyposis colon cancer" * 122805-Holinger-05_itms_8.06662.06662.2 1.7623 0.0486 92.8 991.55 992.13214 3841.8 24 3.882 68.8 1 D.MVPKVDTSD.A Reverse_YGR245C 1 1 1.2% 767 86618 6.9 U SDA1 SGDID:S000003477, Chr VII from 982073-979770, reverse complement, Verified ORF, "Highly conserved nuclear protein required for actin cytoskeleton organization and passage through Start, plays a critical role in G1 events, binds Nap1p, also involved in 60S ribosome biogenesis" * 122805-Holinger-03_itms_10.07203.07203.2 2.0015 0.0843 90.7 986.52374 987.14417 5603.2 233 3.777 68.8 1 C.IERITNIGA.A Reverse_YLR274W 1 1 1.2% 775 86411 5.7 U CDC46 SGDID:S000004264, Chr XII from 691557-693884, Verified ORF, "Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase" * 122805-Holinger-02_itms_18.12240.12240.2 1.4182 0.0051 91.8 1181.636 1182.1829 1908.9 25 3.831 81.2 1 L.QLFEEEEEE.T Reverse_YPL222W 1 1 1.2% 688 78313 5.4 U YPL222W SGDID:S000006143, Chr XVI from 130161-132227, Uncharacterized ORF, "The authentic, non-tagged protein was localized to the mitochondria." * 122805-Holinger-03_itms_12.08126.08126.2 2.9615 0.0962 92.0 898.5745 900.1063 4335.2 1 3.846 92.9 1 S.LQILGKLD.H Reverse_YGL113W 1 1 1.2% 668 77298 9.7 U SLD3 SGDID:S000003081, Chr VII from 295935-297941, Verified ORF, "Protein involved in the initiation of DNA replication, required for proper assembly of replication proteins at the origins of replication; interacts with Cdc45p" * 122805-Holinger-05_itms_8.06779.06779.2 2.4061 0.0055 96.2 933.5319 935.02203 4444.7 82 4.16 71.4 1 K.LSRTESEL.F YKR036C 1 1 1.2% 659 74709 5.5 U CAF4 SGDID:S000001744, Chr XI from 510323-508344, reverse complement, Verified ORF, "WD40 repeat-containing protein associated with the CCR4-NOT complex, interacts in a Ccr4p-dependent manner with Ssn2p" * 122805-Holinger-05_itms_7.06315.06315.2 1.4768 0.2201 98.6 800.4806 800.9916 3784.2 18 4.478 64.3 1 E.APMIGALQ.C YBL051C 1 1 1.2% 668 73776 6.2 U PIN4 SGDID:S000000147, Chr II from 124762-122756, reverse complement, Verified ORF, "Protein involved in G2/M phase progression and response to DNA damage, interacts with Rad53p; contains an RNA recognition motif, a nuclear localization signal, and several SQ/TQ cluster domains; hyperphosphorylated in response to DNA damage" * 122805-Holinger-02_itms_22.14173.14173.2 1.1464 0.0634 91.6 853.6329 850.92194 2659.5 88 3.811 42.9 1 Q.QQGQMTSA.H Reverse_YKL088W 1 1 1.2% 571 65238 5.0 U YKL088W SGDID:S000001571, Chr XI from 274927-276642, Uncharacterized ORF, "Predicted phosphopantothenoylcysteine decarboxylase, may be involved in coenzyme A biosynthesis; interacts with Sis2p and Vhs3p" * 122805-Holinger-05_itms_8.06806.06806.2 1.435 0.1351 90.3 826.48376 829.005 7083.1 53 3.749 83.3 1 P.MHVISNK.E Reverse_YLR134W 1 1 1.2% 563 61912 6.4 U PDC5 SGDID:S000004124, Chr XII from 410724-412415, Verified ORF, "Minor isoform of pyruvate decarboxylase, key enzyme in alcoholic fermentation, decarboxylates pyruvate to acetaldehyde, regulation is glucose- and ethanol-dependent, repressed by thiamine, involved in amino acid catabolism" * 122805-Holinger-03_itms_8.06014.06014.2 1.9746 0.0494 91.4 806.4415 805.9732 5521.0 17 3.806 83.3 1 N.GAWRMGK.V YDR093W 1 1 1.1% 1612 182617 6.2 U DNF2 SGDID:S000002500, Chr IV from 631277-636115, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport; potential Cdc28p substrate" * 122805-Holinger-06_itms_11.09673.09673.2 1.9505 0.0769 96.1 1723.9938 1725.9396 5997.0 152 4.152 37.5 1 D.RLQDGVPDSIALLAEAG.I YBL017C 1 1 1.1% 1579 177777 4.9 U PEP1 SGDID:S000000113, Chr II from 191586-186847, reverse complement, Verified ORF, "Type I transmembrane sorting receptor for multiple vacuolar hydrolases; cycles between the late-Golgi and prevacuolar endosome-like compartments" * 122805-Holinger-05_itms_8.07022.07022.2 2.0553 0.222 91.6 1858.9338 1857.033 2356.7 28 3.812 37.5 1 G.RDFGNLLKSNSNGTSFV.T YDR406W 1 1 1.1% 1529 172255 7.9 U PDR15 SGDID:S000002814, Chr IV from 1279200-1283789, Verified ORF, "ATP binding cassette (ABC) transporter of the plasma membrane; general stress response factor implicated in cellular detoxification; target of Pdr1p, Pdr3p and Pdr8p transcription regulators; promoter contains a PDR responsive element" * 122805-Holinger-04_itms_12.08480.08480.2 2.0861 0.0909 90.9 1937.2788 1936.0916 5845.2 5 3.783 40.6 1 K.EGKLQEKHRPGDIENNA.G YLR272C 1 1 1.1% 1176 132967 5.6 U YCS4 SGDID:S000004262, Chr XII from 687204-683674, reverse complement, Verified ORF, "Non-SMC subunit of the condensin complex (Smc2p-Smc4p-Ycs4p-Brn1p-Ycg1p); required for establishment and maintenance of chromosome condensation, chromosome segregation, chromatin binding of condensin and silencing at the mating type locus" * 122805-Holinger-05_itms_9.07385.07385.2 3.1838 0.1872 99.6 1289.8335 1288.4406 5838.8 31 5.159 58.3 1 I.GASIADLASLEQL.L YKL092C 1 1 1.1% 1104 126663 8.8 U BUD2 SGDID:S000001575, Chr XI from 269103-265789, reverse complement, Verified ORF, "GTPase activating factor for Rsr1p/Bud1p required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types" * 122805-Holinger-04_itms_7.05722.05722.3 2.1374 0.0844 94.5 1483.712 1486.717 3650.3 12 4.058 36.4 1 R.INHIRKRLSGYE.C YJR109C 1 1 1.1% 1118 123915 5.3 U CPA2 SGDID:S000003870, Chr X from 632856-629500, reverse complement, Verified ORF, "Large subunit of carbamoyl phosphate synthetase, which catalyzes a step in the synthesis of citrulline, an arginine precursor" * 122805-Holinger-04_itms_11.08112.08112.2 2.2511 0.1888 99.2 1323.7736 1324.5602 3117.8 80 4.674 54.5 1 Y.TLPELPNPITKT.T Reverse_YJL084C 1 1 1.1% 1046 117216 6.9 U YJL084C SGDID:S000003620, Chr X from 277918-274778, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function that interacts with Pcl7p, phosphorylated in vitro; potential Cdc28p substrate" * 122805-Holinger-04_itms_10.07482.07482.2 2.42 0.0451 94.0 1295.7262 1296.4661 6286.4 4 3.956 72.7 1 A.KSLNADNPLNPL.K Reverse_YFR030W 1 1 1.1% 1035 114829 5.3 U MET10 SGDID:S000001926, Chr VI from 213300-216407, Verified ORF, "Subunit alpha of assimilatory sulfite reductase, which is responsible for the conversion of sulfite into sulfide" * 122805-Holinger-02_itms_16.10917.10917.2 1.9753 0.2791 98.0 1149.5742 1149.1992 3258.9 237 4.372 55.0 1 K.DLVDDFAADPA.I YOR363C 1 1 1.1% 996 114710 7.6 U PIP2 SGDID:S000005890, Chr XV from 1023208-1020218, reverse complement, Verified ORF, "Autoregulatory oleate-specific transcriptional activator of peroxisome proliferation, contains Zn(2)-Cys(6) cluster domain, forms heterodimer with Oaf1p, binds oleate response elements (OREs), activates beta-oxidation genes" * 122805-Holinger-04_itms_17.11303.11303.2 2.2151 0.1698 95.5 1224.3263 1223.3804 4552.8 10 4.094 55.0 1 V.ARQAAPRNPNK.D YGL238W 1 1 1.1% 960 109356 5.2 U CSE1 SGDID:S000003207, Chr VII from 49552-52434, Verified ORF, "Nuclear envelope protein that mediates the nuclear export of importin alpha (Srp1p), homolog of metazoan CAS protein, required for accurate chromosome segregation" * 122805-Holinger-05_itms_18.12557.12557.2 2.0244 0.1841 92.9 1274.8972 1275.5114 5583.3 22 3.892 55.0 1 T.IMAKNPSNPRF.T YJL070C 1 1 1.1% 888 104264 5.5 U YJL070C SGDID:S000003606, Chr X from 310553-307887, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_26.16640.16640.2 1.9424 0.1491 95.7 1074.7311 1075.0764 5219.1 18 4.11 61.1 1 H.YGNGESDSFV.S Reverse_YMR273C 1 1 1.1% 915 103358 6.4 U ZDS1 SGDID:S000004886, Chr XIII from 813979-811232, reverse complement, Verified ORF, "Protein that interacts with silencing proteins at the telomere, involved in transcriptional silencing; has a role in localization of Bcy1p, a regulatory subunit of protein kinase A; implicated in mRNA nuclear export" * 122805-Holinger-03_itms_5.04365.04365.2 2.1752 0.1054 95.1 1071.3427 1074.176 3806.4 407 4.04 72.2 1 I.ENDLSQAAIL.V YFL024C 1 1 1.1% 832 96738 8.7 U EPL1 SGDID:S000001870, Chr VI from 90343-87845, reverse complement, Verified ORF, "Component of NuA4, which is an essential histone H4/H2A acetyltransferase complex; homologous to Drosophila Enhancer of Polycomb" * 122805-Holinger-03_itms_15.09814.09814.2 2.7184 0.0062 92.8 1177.6469 1178.3733 6810.3 1 3.902 87.5 1 N.WINDELKIF.D YMR257C 1 1 1.1% 800 94523 8.8 U PET111 SGDID:S000004870, Chr XIII from 782030-779628, reverse complement, Verified ORF, "Specific translational activator for the COX2 mRNA, located in the mitochondrial inner membrane" * 122805-Holinger-02_itms_11.08024.08024.2 2.1643 0.1953 93.2 1167.6802 1168.2944 6592.5 9 3.922 75.0 1 K.WEIISNYRS.F Reverse_YDL056W 1 1 1.1% 833 93908 9.3 U MBP1 SGDID:S000002214, Chr IV from 352877-355378, Verified ORF, "Transcription factor involved in regulation of cell cycle progression from G1 to S phase, forms a complex with Swi6p that binds to MluI cell cycle box regulatory element in promoters of DNA synthesis genes" * 122805-Holinger-03_itms_13.09015.09015.2 1.9453 0.061 92.4 1051.5756 1052.098 4697.9 64 3.865 68.8 1 V.EEINMETGE.R Reverse_YBR284W 1 1 1.1% 797 92904 6.7 U YBR284W SGDID:S000000488, Chr II from 771235-773628, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_8.07139.07139.2 1.4673 0.1385 96.3 952.6101 954.21576 2665.1 162 4.16 50.0 1 S.NLPAVVMPI.Q YOR178C 1 1 1.1% 793 88533 5.7 U GAC1 SGDID:S000005704, Chr XV from 670241-667860, reverse complement, Verified ORF, "Regulatory subunit for Glc7p type-1 protein phosphatase (PP1), tethers Glc7p to Gsy2p glycogen synthase, binds Hsf1p heat shock transcription factor, required for induction of some HSF-regulated genes under heat shock" * 122805-Holinger-04_itms_11.08205.08205.2 2.1094 0.075 93.3 1080.6486 1082.2598 4699.5 189 3.928 68.8 1 N.SLNNMFKLD.L Reverse_YER109C 1 1 1.1% 798 86648 9.3 U FLO8 SGDID:S000000911, Chr V from 377610-375211, reverse complement, Verified ORF, "Transcription factor required for flocculation, diploid filamentous growth, and haploid invasive growth; genome reference strain S288C and most laboratory strains have a mutation in this gene" * 122805-Holinger-04_itms_3.03645.03645.2 1.8567 0.0826 98.1 1043.5929 1046.1312 4516.1 30 4.395 62.5 1 S.RQKQADGSR.P YJR042W 1 1 1.1% 744 84898 4.6 U NUP85 SGDID:S000003803, Chr X from 513969-516203, Verified ORF, "Subunit of the Nup84p subcomplex of the nuclear pore complex (NPC), required for assembly of the subcomplex and also for formation of the nucleocytoplasmic Gsp1p concentration gradient that plays a role in nuclear trafficking" * 122805-Holinger-03_itms_13.08977.08977.2 1.9142 0.0283 93.3 1015.54254 1016.1846 4506.7 180 3.927 64.3 1 A.ELLPHYPF.V Reverse_YJL082W 1 1 1.1% 731 82536 6.6 U IML2 SGDID:S000003618, Chr X from 281101-283296, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus" * 122805-Holinger-04_itms_7.05651.05651.2 2.7496 0.123 90.4 1035.6278 1034.163 5982.9 3 3.759 85.7 1 M.NNFQQVKR.L Reverse_YDL214C 1 1 1.1% 699 78939 6.7 U PRR2 SGDID:S000002373, Chr IV from 76546-74447, reverse complement, Verified ORF, "Protein kinase with a possible role in MAP kinase signaling in the pheromone response pathway" * 122805-Holinger-04_itms_26.16841.16841.2 1.5185 0.0546 98.8 867.14594 865.9684 2998.9 73 4.589 57.1 1 E.KLSSSIAC.D YMR037C 1 1 1.1% 704 77861 6.6 U MSN2 SGDID:S000004640, Chr XIII from 346516-344402, reverse complement, Verified ORF, "Transcriptional activator related to Msn4p; activated in stress conditions, which results in translocation from the cytoplasm to the nucleus; binds DNA at stress response elements of responsive genes, inducing gene expression" * 122805-Holinger-05_itms_6.05823.05823.2 1.6485 0.0552 96.0 810.5026 810.9689 3686.5 25 4.136 57.1 1 L.NLGLPPLS.F YHR161C 1 1 1.1% 637 71660 7.0 U YAP1801 SGDID:S000001204, Chr VIII from 422289-420376, reverse complement, Verified ORF, "Protein involved in clathrin cage assembly; binds Pan1p and clathrin; homologous to Yap1802p, member of the AP180 protein family" * 122805-Holinger-03_itms_4.03511.03511.2 1.852 0.0957 95.9 907.05597 909.93097 4209.6 76 4.119 91.7 1 N.QTYNQQQ.F YBR069C 1 1 1.1% 619 68758 7.7 U TAT1 SGDID:S000000273, Chr II from 378430-376571, reverse complement, Verified ORF, "Amino acid transport protein for valine, leucine, isoleucine, and tyrosine, low-affinity tryptophan and histidine transporter; overexpression confers FK506 resistance" * 122805-Holinger-05_itms_8.06785.06785.2 1.4544 0.1932 98.6 854.4702 854.9432 5069.6 272 4.487 66.7 1 Y.WHNPGPF.A Reverse_YJR138W 1 1 1.0% 1584 181948 8.8 U IML1 SGDID:S000003899, Chr X from 684482-689236, Verified ORF, "Protein of unknown function, green fluorescent protein (GFP)-fusion protein localizes to the vacuolar membrane" * 122805-Holinger-03_itms_18.11719.11719.2 1.9878 0.264 98.8 1949.7722 1949.2281 7708.3 2 4.6 40.0 1 I.FNYLPGTYFMVEPQIE.E YGR270W 1 1 1.0% 1379 157406 5.2 U YTA7 SGDID:S000003502, Chr VII from 1027376-1031515, Verified ORF, "Protein of unknown function, member of CDC48/PAS1/SEC18 family of ATPases, potentially phosphorylated by Cdc28p" * 122805-Holinger-05_itms_11.08691.08691.2 3.059 0.1676 95.3 1475.876 1476.7563 6756.9 8 4.058 57.7 1 T.GSSPQPLPELIKPL.L YOR086C 1 1 1.0% 1186 133576 7.2 U TCB1 SGDID:S000005612, Chr XV from 486780-483220, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" * 122805-Holinger-03_itms_11.07494.07494.2 2.3426 0.0751 92.9 1247.6848 1245.4642 6156.6 5 3.905 63.6 1 N.SVAYTPPIGAIR.V Reverse_YLR272C 1 1 1.0% 1176 132967 5.6 U YCS4 SGDID:S000004262, Chr XII from 687204-683674, reverse complement, Verified ORF, "Non-SMC subunit of the condensin complex (Smc2p-Smc4p-Ycs4p-Brn1p-Ycg1p); required for establishment and maintenance of chromosome condensation, chromosome segregation, chromatin binding of condensin and silencing at the mating type locus" * 122805-Holinger-03_itms_21.13271.13271.3 2.5652 0.0833 94.3 1341.5555 1340.4938 2670.5 4 4.052 36.4 1 L.MPDSFRSSNSVI.E Reverse_YJR090C 1 1 1.0% 1151 132734 6.5 U GRR1 SGDID:S000003850, Chr X from 594241-590786, reverse complement, Verified ORF, "F-box protein component of the SCF ubiquitin-ligase complex, required for Cln1p and Cln2p degradation; involved in carbon catabolite repression, glucose-dependent divalent cation transport, high-affinity glucose transport, and morphogenesis" * 122805-Holinger-04_itms_10.07821.07821.3 2.4972 0.1172 91.7 1309.7246 1312.2487 6105.2 15 3.925 47.7 1 N.NNNDDFDGSSNL.W Reverse_YHR077C 1 1 1.0% 1089 126747 5.1 U NMD2 SGDID:S000001119, Chr VIII from 255758-255753,255639-252376, reverse complement, Verified ORF, "Protein involved in the nonsense-mediated mRNA decay (NMD) pathway; interacts with Nam7p and Upf3p" * 122805-Holinger-03_itms_12.08261.08261.2 2.186 0.0283 97.9 1332.7245 1332.4625 8060.6 37 4.367 55.0 1 D.DNKNLVNLLCE.T YPR030W 1 1 1.0% 1121 124848 8.3 U CSR2 SGDID:S000006234, Chr XVI from 627877-631242, Verified ORF, "Nuclear protein with a potential regulatory role in utilization of galactose and nonfermentable carbon sources; overproduction suppresses the lethality at high temperature of a chs5 spa2 double null mutation; potential Cdc28p substrate" * 122805-Holinger-04_itms_5.04439.04439.2 1.9818 0.0444 96.8 1071.3445 1071.2212 3732.3 97 4.206 60.0 1 T.EGPGPIIHPGP.E YNR067C 1 1 1.0% 1117 121064 4.5 U DSE4 SGDID:S000005350, Chr XIV from 759099-755746, reverse complement, Verified ORF, "Daughter cell-specific secreted protein with similarity to glucanases, degrades cell wall from the daughter side causing daughter to separate from mother" * 122805-Holinger-05_itms_12.09133.09133.2 1.8709 0.024 90.5 1202.6759 1203.3806 5195.4 29 3.764 60.0 1 G.NAEYLVNPLGI.A Reverse_YFL034W 1 1 1.0% 1073 119496 5.2 U YFL034W SGDID:S000001860, Chr VI from 65475-68696, Uncharacterized ORF, "Possible integral membrane protein that interacts with Rpp0p, which is a component of the ribosomal stalk" * 122805-Holinger-04_itms_26.16850.16850.2 1.4531 0.1812 97.0 1238.8116 1238.3921 6305.5 66 4.247 50.0 1 A.GHDVLAADRRK.Q YJR151C 1 1 1.0% 1161 118359 4.4 U DAN4 SGDID:S000003912, Chr X from 715655-712170, reverse complement, Verified ORF, "Cell wall mannoprotein with similarity to Tir1p, Tir2p, Tir3p, and Tir4p; expressed under anaerobic conditions, completely repressed during aerobic growth" * 122805-Holinger-02_itms_21.13935.13935.2 2.0142 0.2079 97.6 1121.7708 1120.115 3090.4 470 4.318 50.0 1 T.SSTFSTSSASAS.S YDR310C 1 1 1.0% 1062 118201 6.2 U SUM1 SGDID:S000002718, Chr IV from 1084310-1081122, reverse complement, Verified ORF, "Transcriptional repressor required for repression of middle sporulation-specific genes during mitosis; regulated by the pachytene checkpoint; a dominant mutation acts as a suppressor of silencing defects of SIR2 mutations" * 122805-Holinger-02_itms_6.05479.05479.2 1.5353 0.1397 90.7 1209.5785 1209.2523 4296.6 88 3.776 60.0 1 S.KDTSLTDSVQD.L YIL128W 1 1 1.0% 1032 117882 5.9 U MET18 SGDID:S000001390, Chr IX from 113806-116904, Verified ORF, "DNA repair and TFIIH regulator, required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription; possible role in assembly of a multiprotein complex(es) required for NER and RNAP II transcription" * 122805-Holinger-03_itms_19.12402.12402.2 1.7457 0.0607 90.6 1150.546 1149.4956 3686.0 146 3.773 55.6 1 I.IMILSMALTR.S YGR258C 1 1 1.0% 1031 117838 5.2 U RAD2 SGDID:S000003490, Chr VII from 1010772-1007677, reverse complement, Verified ORF, "Single-stranded DNA endonuclease, cleaves single-stranded DNA during nucleotide excision repair to excise damaged DNA; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPG protein" * 122805-Holinger-05_itms_8.06858.06858.2 2.3495 0.2034 99.3 1119.6248 1120.2908 4812.4 241 4.703 61.1 1 I.EVIAEFGNLK.N Reverse_YLR389C 1 1 1.0% 1027 117579 6.7 U STE23 SGDID:S000004381, Chr XII from 902660-899577, reverse complement, Verified ORF, "Metalloprotease involved, with homolog Axl1p, in N-terminal processing of pro-a-factor to the mature form; member of the insulin-degrading enzyme family" * 122805-Holinger-05_itms_10.08269.08269.2 1.7371 0.0652 95.8 1008.56824 1010.0917 5406.3 21 4.116 61.1 1 V.TSSPSGAQKF.K YIL031W 1 1 1.0% 1034 116882 6.8 U ULP2 SGDID:S000001293, Chr IX from 292632-295736, Verified ORF, "Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins, plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate" * 122805-Holinger-05_itms_10.07949.07949.2 2.4955 0.124 99.0 1060.5352 1059.1643 7156.8 1 4.656 77.8 1 S.SPNNTNIVIS.D YDR060W 1 1 1.0% 1025 116676 5.0 U MAK21 SGDID:S000002467, Chr IV from 570645-573722, Verified ORF, "Constituent of 66S pre-ribosomal particles, required for large (60S) ribosomal subunit biogenesis; involved in nuclear export of pre-ribosomes; required for maintenance of dsRNA virus; homolog of human CAATT-binding protein" * 122805-Holinger-03_itms_13.08905.08905.2 2.125 0.2022 97.3 1101.6501 1102.3188 3634.8 154 4.286 72.2 1 E.QIAKPDLGLF.T Reverse_YOR048C 1 1 1.0% 1006 115934 6.8 U RAT1 SGDID:S000005574, Chr XV from 421650-418630, reverse complement, Verified ORF, "Nuclear 5' to 3' single-stranded RNA exonuclease, involved in RNA metabolism, including rRNA and snRNA processing as well as mRNA transcription termination" * 122805-Holinger-03_itms_18.11440.11440.2 1.6902 0.1096 90.3 1151.8381 1150.3201 3058.0 2 3.74 61.1 1 E.YNANKNSILL.V Reverse_YFR040W 1 1 1.0% 1002 114989 4.7 U SAP155 SGDID:S000001936, Chr VI from 234229-237237, Verified ORF, "Protein that forms a complex with the Sit4p protein phosphatase and is required for its function; member of a family of similar proteins including Sap4p, Sap185p, and Sap190p" * 122805-Holinger-02_itms_27.17585.17585.2 1.6788 0.0765 91.7 1191.5725 1194.5028 4526.8 2 3.824 61.1 1 S.KLNFLSLVLF.S YDR379W 1 1 1.0% 1009 113291 7.9 U RGA2 SGDID:S000002787, Chr IV from 1230157-1233186, Verified ORF, "GTPase-activating protein for the polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth" * 122805-Holinger-04_itms_6.05530.05530.2 2.2749 0.0764 94.6 1111.6301 1113.2993 3198.8 1 4.007 72.2 1 D.QQLTPQVLVS.Q YDL031W 1 1 1.0% 995 113158 9.3 U DBP10 SGDID:S000002189, Chr IV from 394214-397201, Verified ORF, "Putative ATP-dependent RNA helicase of the DEAD-box protein family, constituent of 66S pre-ribosomal particles; essential protein involved in ribosome biogenesis" * 122805-Holinger-05_itms_11.08885.08885.2 2.454 0.2714 100.0 1079.7144 1080.3591 6999.4 1 5.922 77.8 1 A.GLVNPVLVRL.D Reverse_YDL035C 1 1 1.0% 961 110709 7.1 U GPR1 SGDID:S000002193, Chr IV from 392054-389169, reverse complement, Verified ORF, "Plasma membrane G protein coupled receptor (GPCR) that interacts with the heterotrimeric G protein alpha subunit, Gpa2p, and with Plc1p; sensor that integrates nutritional signals with the modulation of cell fate via PKA and cAMP synthesis" * 122805-Holinger-01_itms_12.09250.09250.2 1.5116 0.0758 93.1 1081.6842 1084.1919 3409.8 4 3.913 50.0 1 K.YLGGEMNGSR.K YHR027C 1 1 1.0% 993 109492 4.6 U RPN1 SGDID:S000001069, Chr VIII from 164704-161723, reverse complement, Verified ORF, "Non-ATPase base subunit of the 19S regulatory particle of the 26S proteasome; may participate in the recognition of several ligands of the proteasome; contains a leucine-rich repeat (LRR) domain, a site for protein?protein interactions" * 122805-Holinger-04_itms_10.07773.07773.2 2.2347 0.1399 98.7 1281.6545 1282.448 6121.6 29 4.581 66.7 1 K.FLRPTYPDLC.S Reverse_YBR055C 1 1 1.0% 899 104229 8.0 U PRP6 SGDID:S000000259, Chr II from 347299-344600, reverse complement, Verified ORF, "Splicing factor, component of the U4/U6-U5 snRNP complex" * 122805-Holinger-02_itms_4.03628.03628.2 2.1816 0.0705 93.3 1032.5306 1033.1265 4354.7 65 3.926 75.0 1 G.KDDNSVVQK.E YMR273C 1 1 1.0% 915 103358 6.4 U ZDS1 SGDID:S000004886, Chr XIII from 813979-811232, reverse complement, Verified ORF, "Protein that interacts with silencing proteins at the telomere, involved in transcriptional silencing; has a role in localization of Bcy1p, a regulatory subunit of protein kinase A; implicated in mRNA nuclear export" * 122805-Holinger-05_itms_7.06443.06443.2 1.8268 0.0523 91.9 895.5626 893.0739 3157.2 219 3.839 62.5 1 T.QAPAAPPLK.H YKL073W 1 1 1.0% 881 99572 5.3 U LHS1 SGDID:S000001556, Chr XI from 296074-298719, Verified ORF, "Molecular chaperone of the endoplasmic reticulum lumen, involved in polypeptide translocation and folding; member of the Hsp70 family; localizes to the lumen of the ER; regulated by the unfolded protein response pathway" * 122805-Holinger-03_itms_12.08136.08136.2 2.0145 0.1727 98.6 977.5474 977.19183 6288.2 263 4.476 68.8 1 M.SVAVNFVLK.Q Reverse_YML029W 1 1 1.0% 838 96653 5.1 U USA1 SGDID:S000004491, Chr XIII from 217362-219878, Verified ORF, "Protein that interacts in the two-hybrid system with the U1 snRNP-specific protein, Snp1p; may have a role in pre-mRNA splicing" * 122805-Holinger-04_itms_4.04073.04073.2 1.4047 0.0276 90.3 829.4472 827.96204 2790.8 202 3.74 57.1 1 E.GRIAAPSR.G Reverse_YMR089C 1 1 1.0% 825 93276 7.6 U YTA12 SGDID:S000004695, Chr XIII from 448085-445608, reverse complement, Verified ORF, "Component, with Afg3p, of the mitochondrial inner membrane m-AAA protease that mediates degradation of misfolded or unassembled proteins and is also required for correct assembly of mitochondrial enzyme complexes" * 122805-Holinger-05_itms_6.05867.05867.2 1.9544 0.0291 91.3 915.512 915.17914 4504.1 116 3.805 71.4 1 I.MLVTPLIQ.F Reverse_YLR176C 1 1 1.0% 811 90584 8.8 U RFX1 SGDID:S000004166, Chr XII from 510234-507799, reverse complement, Verified ORF, "Protein involved in DNA damage and replication checkpoint pathway; recruits repressors Tup1p and Cyc8p to promoters of DNA damage-inducible genes; similar to a family of mammalian DNA binding RFX1-4 proteins" * 122805-Holinger-04_itms_4.04189.04189.2 1.8403 0.0041 98.3 981.51056 983.1582 2799.1 4 4.415 78.6 1 A.YQAFIKGR.P Reverse_YFL009W 1 1 1.0% 779 86090 7.1 U CDC4 SGDID:S000001885, Chr VI from 116139-118478, Verified ORF, "F-box protein required for G1/S and G2/M transition, associates with Skp1p and Cdc53p to form a complex, SCFCdc4, which acts as ubiquitin-protein ligase directing ubiquitination of the phosphorylated CDK inhibitor Sic1p" * 122805-Holinger-02_itms_12.08789.08789.2 1.9212 0.0044 97.5 950.49713 951.0642 4032.9 32 4.312 78.6 1 G.LSNIIDEF.Q Reverse_YNL183C 1 1 1.0% 790 85990 8.4 U NPR1 SGDID:S000005127, Chr XIV from 295511-293139, reverse complement, Verified ORF, "Protein kinase that stabilizes several plasma membrane amino acid transporters by antagonizing their ubiquitin-mediated degradation" * 122805-Holinger-02_itms_26.16628.16628.1 1.4283 0.2455 90.6 712.5258 711.75256 2801.7 183 4.768 57.1 1 F.PIGSGGHS.H YFL047W 1 1 1.0% 714 82208 5.8 U RGD2 SGDID:S000001847, Chr VI from 40421-42565, Verified ORF, "GTPase-activating protein (RhoGAP) for Cdc42p and Rho5p" * 122805-Holinger-03_itms_13.08907.08907.2 2.0499 0.0098 91.7 821.49097 822.89014 4088.0 5 3.817 83.3 1 N.EGEIFDI.L Reverse_YDR172W 1 1 1.0% 685 76551 7.0 U SUP35 SGDID:S000002579, Chr IV from 808319-810376, Verified ORF, "Translation termination factor eRF3; altered protein conformation creates the [PSI(+)] prion, a dominant cytoplasmically inherited protein aggregate that alters translational fidelity and creates a nonsense suppressor phenotype" * 122805-Holinger-02_itms_16.11020.11020.2 1.1899 0.161 93.4 858.4766 860.09033 3016.7 225 3.934 41.7 1 K.HLLKVIH.V Reverse_YHL009W-B 1 1 0.9% 1802 207969 8.4 U YHL009W-B SGDID:S000007372, Chr VIII from 85905-86990,86992-91314, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YJL113W 1 1 0.9% 1803 207708 8.0 U YJL113W SGDID:S000003649, Chr X from 197834-198919,198921-203246, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-04_itms_20.13072.13072.2 1.8356 0.0991 90.7 1982.9781 1980.3141 6855.0 204 3.776 34.4 1 D.STVIKNKSPIFFKYGYS.N YDR127W 1 1 0.9% 1588 174754 6.3 U ARO1 SGDID:S000002534, Chr IV from 704479-709245, Verified ORF, "Pentafunctional arom protein, catalyzes steps 2 through 6 in the biosynthesis of chorismate, which is a precursor to aromatic amino acids" * 122805-Holinger-04_itms_16.10959.10959.2 2.9752 0.2003 97.7 1696.8762 1697.8822 6601.4 1 4.335 53.8 1 L.GYKLVDLDELFEQQ.H Reverse_YDL112W 1 1 0.9% 1436 165047 6.1 U TRM3 SGDID:S000002270, Chr IV from 258915-263225, Verified ORF, "2'-O-ribose methyltransferase, catalyzes the ribose methylation of the guanosine nucleotide at position 18 of tRNAs" * 122805-Holinger-04_itms_9.07046.07046.2 2.3351 0.0415 98.3 1471.6322 1471.7058 5908.4 7 4.407 54.2 1 N.LSTDLAIMEYLTT.F YCR042C 1 1 0.9% 1407 161470 5.7 U TAF2 SGDID:S000000638, Chr III from 205392-201169, reverse complement, Verified ORF, "TFIID subunit (150 kDa), involved in RNA polymerase II transcription initiation" * 122805-Holinger-02_itms_18.11894.11894.2 1.8236 0.065 91.9 1236.8271 1236.3392 2280.5 77 3.832 54.5 1 A.MSGDLPNNSLTS.S Reverse_YBR115C 1 1 0.9% 1392 155345 5.9 U LYS2 SGDID:S000000319, Chr II from 473920-469742, reverse complement, Verified ORF, "Alpha aminoadipate reductase, catalyzes the reduction of alpha-aminoadipate to alpha-aminoadipate 6-semialdehyde, which is the fifth step in biosynthesis of lysine; activation requires posttranslational phosphopantetheinylation by Lys5p" * 122805-Holinger-02_itms_18.11954.11954.2 1.717 0.0493 92.8 1253.8536 1251.2926 5173.4 202 3.905 45.8 1 N.EVVEGQSSGGSSK.I Reverse_YHR155W 1 1 0.9% 1228 143583 8.1 U YSP1 SGDID:S000001198, Chr VIII from 407106-410792, Uncharacterized ORF, "Mitochondrial protein with a potential role in promoting mitochondrial fragmentation during programmed cell death in response to high levels of alpha-factor mating pheromone or the drug amiodarone" * 122805-Holinger-04_itms_4.04077.04077.2 2.0582 0.0808 96.1 1289.3964 1291.4924 4441.8 1 4.144 65.0 1 V.QSKDGFLVHFL.T YKL215C 1 1 0.9% 1286 140427 6.8 U YKL215C SGDID:S000001698, Chr XI from 30688-26828, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm" * 122805-Holinger-04_itms_7.05609.05609.2 2.1621 0.1827 92.8 1205.5925 1208.2731 2298.3 1 3.903 55.0 1 A.GLSHAEDTHIQ.F YGL140C 1 1 0.9% 1219 137476 8.1 U YGL140C SGDID:S000003108, Chr VII from 245017-241358, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.09106.09106.2 2.1419 0.1163 94.6 979.0018 977.14844 5913.6 116 4.01 55.0 1 L.AVGYGGGVALI.V YMR109W 1 1 0.9% 1219 136899 9.3 U MYO5 SGDID:S000004715, Chr XIII from 486586-490245, Verified ORF, "One of two type I myosins; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization" * 122805-Holinger-04_itms_17.11681.11681.2 1.8672 0.1213 95.2 1146.2986 1143.3286 5712.6 8 4.044 55.0 1 A.DAVRDALAKAI.Y YJL080C 1 1 0.9% 1222 134809 5.8 U SCP160 SGDID:S000003616, Chr X from 289142-285474, reverse complement, Verified ORF, "Essential RNA-binding G protein effector of mating response pathway, predominantly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins" * 122805-Holinger-04_itms_5.04643.04643.2 2.3033 0.1844 95.5 1238.7845 1238.3861 5217.4 44 4.092 65.0 1 L.KGLEESHPNVK.I YDL231C 1 1 0.9% 1125 129725 9.0 U BRE4 SGDID:S000002390, Chr IV from 42245-38868, reverse complement, Verified ORF, "Zinc finger protein containing five transmembrane domains; null mutant exhibits strongly fragmented vacuoles and sensitivity to brefeldin A, a drug which is known to affect intracellular transport" * 122805-Holinger-05_itms_6.06020.06020.2 2.0183 0.1722 93.2 972.601 974.05865 3438.7 74 3.921 55.6 1 A.GSPQQSVASL.S Reverse_YDL185W 1 1 0.9% 1071 118637 6.2 U TFP1 SGDID:S000002344, Chr IV from 126788-130003, Verified ORF, "Vacuolar ATPase V1 domain subunit A containing the catalytic nucleotide binding sites; protein precursor undergoes self-catalyzed splicing to yield the extein Tfp1p and the intein Vde (PI-SceI), which is a site-specific endonuclease" * 122805-Holinger-02_itms_6.05354.05354.2 2.0979 0.0602 93.5 967.4636 968.0514 7394.6 465 3.935 61.1 1 F.VSGYIDGGSI.H Reverse_YKL197C 1 1 0.9% 1043 117276 7.0 U PEX1 SGDID:S000001680, Chr XI from 73870-70739, reverse complement, Verified ORF, "AAA-family ATPase peroxin required for peroxisome biogenesis, contains two 230 amino acid ATP-binding AAA cassettes, upregulated in anaerobiosis; Pex1p and Pex6p interact via their N-terminal AAA-cassettes" * 122805-Holinger-05_itms_7.06485.06485.2 2.4319 0.0114 90.3 987.4804 990.1039 3781.4 12 3.747 56.2 1 G.DNAQPKGFL.A YML010W 1 1 0.9% 1063 115650 5.2 U SPT5 SGDID:S000004470, Chr XIII from 247677-250868, Verified ORF, "Protein that forms a complex with Spt4p and mediates both activation and inhibition of transcription elongation; Spt4p-Spt5p complex also plays a role in pre-mRNA processing" * 122805-Holinger-03_itms_14.09647.09647.2 1.8373 0.1877 94.4 1155.6826 1153.354 4680.4 17 3.98 61.1 1 D.NMLSNKMDLS.K YBR079C 1 2 0.9% 964 110344 6.3 U RPG1 SGDID:S000000283, Chr II from 398271-395377, reverse complement, Verified ORF, "Subunit of the core complex of translation initiation factor 3(eIF3), essential for translation; part of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and tRNA(i)Met to ribosomes" * 122805-Holinger-03_itms_15.10083.10083.2 2.5143 0.2198 99.8 1099.5674 1100.2592 6320.4 1 5.236 81.2 2 T.FAKDPFDIF.A Reverse_YMR205C 1 1 0.9% 959 104618 6.7 U PFK2 SGDID:S000004818, Chr XIII from 674765-671886, reverse complement, Verified ORF, "Beta subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes" * 122805-Holinger-04_itms_7.05655.05655.2 1.9879 0.2209 94.7 921.53076 921.9799 4367.1 240 4.017 62.5 1 V.AATDSITKD.D YIL109C 1 1 0.9% 926 103635 6.2 U SEC24 SGDID:S000001371, Chr IX from 160162-157382, reverse complement, Verified ORF, "Component of the Sec23p-Sec24p heterodimeric complex of the COPII vesicle coat; involved in ER to Golgi transport, cargo selection and autophagy; required for the binding of the Sec13 complex to ER membranes; homologous to Lst1p and Lss1p" * 122805-Holinger-04_itms_12.08591.08591.2 2.376 0.1873 98.9 959.60986 960.20465 7319.9 23 4.608 78.6 1 L.LTKIPQIF.Q YDL117W 1 1 0.9% 885 100621 9.0 U CYK3 SGDID:S000002275, Chr IV from 248581-251238, Verified ORF, "SH3-domain protein located in the mother-bud neck and the cytokinetic actin ring; mutant phenotype and genetic interactions suggest a role in cytokinesis" * 122805-Holinger-03_itms_19.12550.12550.2 1.0935 0.1919 90.8 1057.7828 1058.2688 2634.9 333 3.78 57.1 1 L.RILVNKEW.R YHR182W 1 1 0.9% 785 90109 6.4 U YHR182W SGDID:S000001225, Chr VIII from 468219-470576, Uncharacterized ORF, "Protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery and cytoplasm" * 122805-Holinger-03_itms_20.13116.13116.2 1.464 0.057 91.9 849.15955 848.97736 4400.6 261 3.832 58.3 1 D.RIGNEFI.Q YJR143C 1 1 0.9% 762 87966 6.9 U PMT4 SGDID:S000003904, Chr X from 700529-698241, reverse complement, Verified ORF, "Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; appears to form homodimers in vivo and does not complex with other Pmt proteins; target for new antifungals" * 122805-Holinger-05_itms_9.07571.07571.2 1.8712 0.0428 94.6 799.5234 800.0318 3276.5 54 3.992 66.7 1 K.VVKPLPF.L Reverse_YJL090C 1 1 0.9% 764 87241 9.0 U DPB11 SGDID:S000003626, Chr X from 264967-262673, reverse complement, Verified ORF, "Essential BRCT repeat protein, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control" * 122805-Holinger-01_itms_1.00148.00148.1 1.0114 0.224 97.3 868.1992 867.9927 3652.7 146 5.244 41.7 1 D.KHGRPCI.I YLR274W 1 1 0.9% 775 86411 5.7 U CDC46 SGDID:S000004264, Chr XII from 691557-693884, Verified ORF, "Component of the hexameric MCM complex, which is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase" * 122805-Holinger-02_itms_4.03636.03636.2 1.8192 0.0096 91.6 912.43005 913.02075 3892.1 22 3.809 83.3 1 E.FRLDSQF.I YHL035C 1 1 0.8% 1592 180925 8.5 U YHL035C SGDID:S000001027, Chr VIII from 32754-27976, reverse complement, Uncharacterized ORF, "Protein of unknown function, member of the ATP-binding cassette (ABC) family, potential Cdc28p substrate" * 122805-Holinger-02_itms_16.10957.10957.2 2.2856 0.087 92.9 1462.8005 1463.8212 4818.1 2 3.897 50.0 1 V.MFPLNFLLANLLG.K Reverse_YER166W 1 1 0.8% 1571 177797 6.0 U DNF1 SGDID:S000000968, Chr V from 512739-517454, Verified ORF, "Non-essential P-type ATPase that is a potential aminophospholipid translocase, localizes to the plasma membrane and late exocytic or early endocytic membranes, likely involved in protein transport" * 122805-Holinger-04_itms_15.10430.10430.2 2.0219 0.1656 94.1 1317.7681 1315.4691 5371.8 9 3.957 58.3 1 S.AANTVGPLDLSTR.A YLR256W 1 1 0.8% 1502 166107 7.4 U HAP1 SGDID:S000004246, Chr XII from 646417-650925, Verified ORF, "Zinc finger transcription factor involved in the complex regulation of gene expression in response to levels of heme and oxygen; the S288C sequence differs from other strain backgrounds due to a Ty1 insertion in the carboxy terminus" * 122805-Holinger-05_itms_13.09753.09753.2 2.0838 0.1864 99.0 1229.1721 1227.4032 6300.0 1 4.651 63.6 1 P.KPSNGLSSVQPL.L YBR115C 1 1 0.8% 1392 155345 5.9 U LYS2 SGDID:S000000319, Chr II from 473920-469742, reverse complement, Verified ORF, "Alpha aminoadipate reductase, catalyzes the reduction of alpha-aminoadipate to alpha-aminoadipate 6-semialdehyde, which is the fifth step in biosynthesis of lysine; activation requires posttranslational phosphopantetheinylation by Lys5p" * 122805-Holinger-02_itms_9.07250.07250.2 1.6142 0.1472 94.5 1129.6082 1131.2737 5651.8 30 3.991 65.0 1 F.FDLGGHSILAT.K Reverse_YBL047C 1 1 0.8% 1381 150783 4.7 U EDE1 SGDID:S000000143, Chr II from 132043-127898, reverse complement, Verified ORF, "Key endocytic protein involved in a network of interactions with other endocytic proteins, binds membranes in a ubiquitin-dependent manner, may also bind ubiquitinated membrane-associated proteins" * 122805-Holinger-05_itms_18.12563.12563.2 1.8289 0.1121 98.3 1175.1196 1173.2278 5946.5 351 4.403 50.0 1 N.TSAKKSNGENH.S YPL016W 1 1 0.8% 1314 147937 8.8 U SWI1 SGDID:S000005937, Chr XVI from 521011-524955, Verified ORF, "One of 11 subunits of the SWI/SNF chromatin remodeling complex that regulates transcription by remodeling chromosomes; required for transcription of many genes, including ADH1, ADH2, GAL1, HO, INO1 and SUC2" * 122805-Holinger-03_itms_14.09574.09574.2 3.2793 0.3119 100.0 1289.762 1290.5425 7527.7 1 5.684 75.0 1 S.LVKYPELLDSL.A YGR090W 1 1 0.8% 1237 140484 8.5 U UTP22 SGDID:S000003322, Chr VII from 662362-666075, Uncharacterized ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data" * 122805-Holinger-04_itms_14.09702.09702.2 2.0819 0.2345 99.1 1255.7083 1256.49 4259.7 137 4.658 55.6 1 Y.QFYSPVVRLF.K YDR293C 1 1 0.8% 1250 139954 7.6 U SSD1 SGDID:S000002701, Chr IV from 1049386-1045634, reverse complement, Verified ORF, "Protein with a role in maintenance of cellular integrity, interacts with components of the TOR pathway; ssd1 mutant of a clinical S. cerevisiae strain displays elevated virulence" * 122805-Holinger-03_itms_12.08591.08591.2 2.1253 0.1902 98.2 1156.9259 1156.3672 7162.9 26 4.401 66.7 1 K.EKPSFQPLPL.T YKL201C 1 1 0.8% 1178 139380 6.5 U MNN4 SGDID:S000001684, Chr XI from 67467-63931, reverse complement, Verified ORF, "Putative positive regulator of mannosylphosphate transferase (Mnn6p), involved in mannosylphosphorylation of N-linked oligosaccharides; expression increases in late-logarithmic and stationary growth phases" * 122805-Holinger-03_itms_17.11094.11094.2 1.5293 0.0163 90.3 1099.3875 1097.2126 3732.1 4 3.744 66.7 1 L.NSYGLDLFAP.T YCR033W 1 1 0.8% 1226 138397 9.1 U SNT1 SGDID:S000000629, Chr III from 186484-190164, Verified ORF, "Subunit of the Set3C deacetylase complex; putative DNA-binding protein" * 122805-Holinger-04_itms_17.11320.11320.2 1.9239 0.1481 91.8 1146.294 1146.2859 6658.7 31 3.83 61.1 1 C.DVNNLVTDKK.L YKR082W 1 1 0.8% 1157 133320 5.1 U NUP133 SGDID:S000001790, Chr XI from 592467-595940, Verified ORF, "Subunit of the Nup84p subcomplex of the nuclear pore complex (NPC), localizes to both sides of the NPC, required to establish a normal nucleocytoplasmic concentration gradient of the GTPase Gsp1p" * 122805-Holinger-02_itms_16.11187.11187.1 1.8329 0.2475 90.1 1020.5622 1021.20105 4008.3 18 4.714 56.2 1 N.SPDVFPVIF.K YOR188W 1 1 0.8% 1137 129971 8.9 U MSB1 SGDID:S000005714, Chr XV from 685767-689180, Verified ORF, "Protein involved in positive regulation of both 1,3-beta-glucan synthesis and the Pkc1p-MAPK pathway, potential Cdc28p substrate; multicopy suppressor of temperature-sensitive mutations in CDC24 and CDC42, and of mutations in BEM4" * 122805-Holinger-02_itms_13.09143.09143.2 1.7411 0.1375 91.2 1101.6271 1102.2291 6003.0 76 3.795 62.5 1 A.ETFESLTKF.D YGL156W 1 1 0.8% 1083 124499 7.3 U AMS1 SGDID:S000003124, Chr VII from 210421-213672, Verified ORF, "Vacuolar alpha mannosidase, involved in free oligosaccharide (fOS) degradation; delivered to the vacuole in a novel pathway separate from the secretory pathway" * 122805-Holinger-05_itms_4.04412.04412.2 2.5649 0.1427 96.8 877.5061 877.9701 4005.1 373 4.199 62.5 1 R.GALSSDTVK.L YPL160W 1 1 0.8% 1090 124141 5.8 U CDC60 SGDID:S000006081, Chr XVI from 246989-250261, Verified ORF, "Cytosolic leucyl tRNA synthetase, ligates leucine to the appropriate tRNA" * 122805-Holinger-03_itms_10.07114.07114.2 2.235 0.1105 95.3 1177.6123 1178.33 5052.1 1 4.055 81.2 1 K.DLLHKPEYY.G YGR188C 1 1 0.8% 1021 117868 6.7 U BUB1 SGDID:S000003420, Chr VII from 875114-872049, reverse complement, Verified ORF, "Protein kinase that forms a complex with Mad1p and Bub3p that is crucial in the checkpoint mechanism required to prevent cell cycle progression into anaphase in the presence of spindle damage, associates with centromere DNA via Skp1p" * 122805-Holinger-02_itms_8.06602.06602.2 1.8344 0.1157 90.4 958.4775 960.0746 6541.5 3 3.75 85.7 1 P.FLTQPEPQ.A YOR160W 1 1 0.8% 972 110745 4.8 U MTR10 SGDID:S000005686, Chr XV from 633839-636757, Verified ORF, "Nuclear import receptor, mediates the nuclear localization of proteins involved in mRNA-nucleus export" * 122805-Holinger-04_itms_7.05584.05584.2 1.8034 0.0572 95.5 906.79755 906.0263 3542.2 24 4.095 85.7 1 L.ELNIFAAQ.T YMR080C 1 1 0.8% 971 109430 6.5 U NAM7 SGDID:S000004685, Chr XIII from 429626-426711, reverse complement, Verified ORF, "ATP-dependent RNA helicase of the SFI superfamily, required for nonsense mediated mRNA decay and for efficient translation termination at nonsense codons" * 122805-Holinger-05_itms_9.07518.07518.2 2.7554 0.2201 99.4 945.56647 946.1374 4368.8 2 4.947 92.9 1 Y.IVRLPNSF.Q YNL118C 1 1 0.8% 970 108667 5.9 U DCP2 SGDID:S000005062, Chr XIV from 405566-402654, reverse complement, Verified ORF, "Protein required for the decapping of mRNAs, functions to allow the production of active Dcp1p, contains a pyrophosphatase MutT motif and several alpha-helical leucine-rich motifs" * 122805-Holinger-03_itms_8.05882.05882.2 1.8872 0.1572 94.6 852.497 850.92194 4889.4 189 4.005 64.3 1 K.QNSSVGMQ.N Reverse_YBL014C 1 1 0.8% 894 102034 5.2 U RRN6 SGDID:S000000110, Chr II from 201751-199067, reverse complement, Verified ORF, "Protein involved in the transcription of 35S rRNA genes by RNA polymerase I; component of the core factor (CF) complex also composed of Rrn11p, Rrn7p and TATA-binding protein" * 122805-Holinger-05_itms_5.05260.05260.2 2.1336 0.1353 94.8 799.5308 799.98895 4873.5 211 4.025 75.0 1 A.GVIIIER.S YOR371C 1 1 0.8% 897 100940 6.7 U GPB1 SGDID:S000005898, Chr XV from 1034178-1031485, reverse complement, Verified ORF, "Proposed beta subunit of the heterotrimeric G protein that interacts with the receptor Grp1p, has signaling role in response to nutrients; involved in regulation of pseudohyphal growth through cAMP levels; homolog of Gpb2p" * 122805-Holinger-04_itms_8.06627.06627.2 2.2737 0.0040 97.3 815.4301 815.9225 3782.4 12 4.283 83.3 1 S.GRDSMHI.S Reverse_YMR165C 1 1 0.8% 862 95031 5.0 U SMP2 SGDID:S000004775, Chr XIII from 592627-590039, reverse complement, Verified ORF, "Protein of unknown function involved in respiration and plasmid maintenance; proposed to be involved in cell wall integrity" * 122805-Holinger-02_itms_23.14642.14642.2 1.8633 0.128 92.7 840.57996 841.8962 2298.5 52 3.877 75.0 1 R.LYSRTSD.A Reverse_YLR347C 1 1 0.8% 861 94776 4.6 U KAP95 SGDID:S000004339, Chr XII from 826412-823827, reverse complement, Verified ORF, "Karyopherin beta, forms a dimeric complex with Srp1p (Kap60p) that mediates nuclear import of cargo proteins via a nuclear localization signal (NLS), interacts with nucleoporins to guide transport across the nuclear pore complex" * 122805-Holinger-02_itms_5.04979.04979.2 1.8179 0.0319 90.4 809.41766 808.9126 5160.2 17 3.749 91.7 1 S.FLQGSRT.R Reverse_YLR430W 1 1 0.7% 2231 252495 8.6 U SEN1 SGDID:S000004422, Chr XII from 993430-1000125, Verified ORF, "Nuclear protein, putative helicase required for processing of tRNAs, rRNAs, and small nuclear RNAs; potential Cdc28p substrate" * 122805-Holinger-04_itms_10.07760.07760.3 2.7191 0.0354 92.1 1784.9923 1787.9677 4648.7 454 3.946 35.7 1 M.EDRDRGLENIIKSLE.R YLR422W 1 1 0.7% 1932 221562 7.8 U YLR422W SGDID:S000004414, Chr XII from 965893-971691, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-05_itms_16.11705.11705.2 1.6618 0.0133 90.6 1531.394 1529.8578 5676.5 52 3.77 42.3 1 Y.LVVVLKETIAITTE.T Reverse_YJL109C 1 1 0.7% 1769 200080 6.5 U UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-04_itms_18.12264.12264.2 1.7322 0.0564 91.2 1351.5009 1348.5388 6050.1 1 3.803 59.1 1 A.LLLYANIANDLD.K YFL033C 1 1 0.7% 1770 196530 6.5 U RIM15 SGDID:S000001861, Chr VI from 74425-69113, reverse complement, Verified ORF, "Glucose-repressible protein kinase involved in signal transduction during cell proliferation in response to nutrients, specifically the establishment of stationary phase; originally identified as a regulator of IME2" * 122805-Holinger-03_itms_2.01214.01214.3 1.7096 0.0513 95.7 1412.0079 1410.6276 2459.1 78 4.11 25.0 1 E.MVPDLYHSLSTF.P Reverse_YDR420W 1 7 0.7% 1802 188947 4.8 U HKR1 SGDID:S000002828, Chr IV from 1306257-1311665, Verified ORF, "Serine/threonine rich cell surface protein that contains an EF hand motif; involved in the regulation of cell wall beta-1,3 glucan synthesis and bud site selection; overexpression confers resistance to Hansenula mrakii killer toxin, HM-1" 122805-Holinger-02_itms_6.05468.05468.2 1.6713 0.0183 97.5 1179.5471 1180.3 2686.8 112 4.317 50.0 7 S.TYTSSVAVPASP.S Reverse_YML103C 1 1 0.7% 1655 188576 5.6 U NUP188 SGDID:S000004571, Chr XIII from 67549-62582, reverse complement, Verified ORF, "Subunit of the nuclear pore complex (NPC), involved in the structural organization of the complex and of the nuclear envelope, also involved in nuclear envelope permeability, interacts with Pom152p and Nic96p" * 122805-Holinger-05_itms_8.06747.06747.2 2.3827 0.0634 98.5 1230.711 1232.3826 4505.8 297 4.443 55.0 1 A.AIPEISCLESI.F YOR191W 1 1 0.7% 1619 184404 7.5 U RIS1 SGDID:S000005717, Chr XV from 692475-697334, Verified ORF, "Member of the SWI/SNF family of DNA-dependent ATPases, plays a role in antagonizing silencing during mating-type switching, contains an N-terminal domain that interacts with Sir4p and a C-terminal SNF2 domain" * 122805-Holinger-02_itms_19.12548.12548.2 1.9555 0.1555 96.1 1157.705 1159.4729 3236.6 59 4.141 55.0 1 G.LGKTIQAIALM.L Reverse_YOR328W 1 1 0.7% 1564 176460 7.9 U PDR10 SGDID:S000005855, Chr XV from 931798-936492, Verified ORF, "ABC (ATP-binding cassette) membrane pump involved in the pleiotropic drug resistance network, regulated by Pdr1p and Pdr3p, similar to Pdr5p" * 122805-Holinger-03_itms_18.11644.11644.2 2.2083 0.1229 92.4 1544.7714 1545.6973 5518.1 65 3.863 55.0 1 G.ENYECFFLYLF.L Reverse_YDR127W 1 1 0.7% 1588 174754 6.3 U ARO1 SGDID:S000002534, Chr IV from 704479-709245, Verified ORF, "Pentafunctional arom protein, catalyzes steps 2 through 6 in the biosynthesis of chorismate, which is a precursor to aromatic amino acids" * 122805-Holinger-01_itms_15.10816.10816.1 1.3929 0.2652 96.6 1018.5884 1017.272 4499.9 89 5.906 50.0 1 G.IVGGGIAVMVT.D YPL058C 1 1 0.7% 1511 171064 6.8 U PDR12 SGDID:S000005979, Chr XVI from 450374-445839, reverse complement, Verified ORF, "Plasma membrane weak-acid-inducible ATP-binding cassette (ABC) transporter, required for weak organic acid resistance, strongly induced by sorbate and benzoate, regulated by War1p, mutants exhibit sorbate hypersensitivity" * 122805-Holinger-02_itms_22.14366.14366.2 1.4611 0.0649 91.6 1043.6844 1045.0911 2819.4 118 3.813 55.6 1 Q.LEQGIEPGDS.G YGR116W 1 1 0.7% 1451 168291 5.0 U SPT6 SGDID:S000003348, Chr VII from 720413-724768, Verified ORF, "Essential protein that interacts with histones and is involved in nucleosome disassembly and reassembly during transcription elongation" * 122805-Holinger-04_itms_9.06991.06991.2 1.5927 0.1076 92.8 968.6056 967.06964 6509.4 139 3.879 61.1 1 P.NAIGINGPNP.K YGL197W 1 1 0.7% 1487 167074 7.7 U MDS3 SGDID:S000003165, Chr VII from 124703-129166, Verified ORF, "Protein with an N-terminal kelch-like domain, putative negative regulator of early meiotic gene expression; required, with Pmd1p, for growth under alkaline conditions" * 122805-Holinger-02_itms_5.04669.04669.2 2.4182 0.1079 94.4 1097.4929 1098.204 8525.0 96 3.982 61.1 1 R.FSRSARSSIS.Y Reverse_YNL102W 1 1 0.7% 1468 166809 6.2 U POL1 SGDID:S000005046, Chr XIV from 430089-434495, Verified ORF, "Catalytic subunit of the DNA polymerase alpha-primase complex, required for the initiation of DNA replication during mitotic DNA synthesis and premeiotic DNA synthesis" * 122805-Holinger-04_itms_8.06638.06638.2 2.1846 0.0991 90.9 1098.6124 1099.2291 3641.3 317 3.786 60.0 1 L.SQASPPNALLT.D YCR089W 1 1 0.7% 1609 166036 4.9 U FIG2 SGDID:S000000685, Chr III from 267430-272259, Verified ORF, "Cell wall adhesin, expressed specifically during mating; may be involved in maintenance of cell wall integrity during mating" * 122805-Holinger-01_itms_23.15283.15283.2 2.0833 0.0174 91.8 1060.7168 1063.063 5173.1 22 3.824 55.0 1 T.SSSSSFSTTTA.S YAL017W 1 1 0.7% 1356 152330 5.7 U PSK1 SGDID:S000000015, Chr I from 120226-124296, Verified ORF, "One of two (see also PSK2) PAS domain containing S/T protein kinases; coordinately regulates protein synthesis and carbohydrate metabolism and storage in response to a unknown metabolite that reflects nutritional status" * 122805-Holinger-03_itms_6.05110.05110.2 2.0993 0.0963 95.3 1275.7406 1276.4034 4329.4 19 4.061 66.7 1 I.EFKTNMTEFE.A Reverse_YDR216W 1 1 0.7% 1323 150940 6.7 U ADR1 SGDID:S000002624, Chr IV from 895029-899000, Verified ORF, "Carbon source-responsive zinc-finger transcription factor, required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization" * 122805-Holinger-03_itms_11.07804.07804.2 1.7272 0.247 95.3 1060.6189 1062.2571 5965.1 16 4.058 56.2 1 N.LHIRPLEPS.N YMR128W 1 1 0.7% 1267 144954 6.3 U ECM16 SGDID:S000004735, Chr XIII from 523695-527498, Verified ORF, "Essential DEAH-box ATP-dependent RNA helicase specific to the U3 snoRNP, predominantly nucleolar in distribution, required for 18S rRNA synthesis" * 122805-Holinger-05_itms_11.08492.08492.2 2.0898 0.2305 99.5 1058.6199 1059.2535 7292.4 1 5.108 75.0 1 A.RIQLPVFGE.E YOR227W 1 1 0.7% 1246 139457 8.9 U YOR227W SGDID:S000005753, Chr XV from 762825-766565, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-02_itms_22.14427.14427.2 1.1759 0.0881 91.6 999.6569 1000.24744 3205.3 306 3.812 68.8 1 P.KNPIRLGMA.N Reverse_YDL145C 1 1 0.7% 1201 135607 6.0 U COP1 SGDID:S000002304, Chr IV from 198177-194572, reverse complement, Verified ORF, "Alpha subunit of COPI vesicle coatomer complex, which surrounds transport vesicles in the early secretory pathway" * 122805-Holinger-02_itms_13.09425.09425.2 1.8221 0.1477 94.2 1018.58496 1019.05023 4429.4 219 3.963 62.5 1 P.LEEGVDLDE.D Reverse_YLR084C 1 1 0.7% 1220 133959 4.6 U RAX2 SGDID:S000004074, Chr XII from 300252-296590, reverse complement, Verified ORF, "N-glycosylated protein involved in the maintenance of bud site selection during bipolar budding; localization requires Rax1p" * 122805-Holinger-03_itms_6.04700.04700.2 1.7466 0.0096 91.9 897.43243 895.00006 4434.7 158 3.844 64.3 1 F.SLQTIEGF.I YGR218W 1 1 0.7% 1084 124104 5.5 U CRM1 SGDID:S000003450, Chr VII from 932544-935798, Verified ORF, "Major karyopherin, involved in export of proteins, RNAs, and ribosomal subunits from the nucleus" * 122805-Holinger-03_itms_9.06852.06852.2 2.7389 0.0018 96.2 883.54004 884.1069 3185.2 246 4.154 85.7 1 P.QGVILILQ.S Reverse_YML075C 1 1 0.7% 1054 115625 8.0 U HMG1 SGDID:S000004540, Chr XIII from 118898-115734, reverse complement, Verified ORF, "One of two isozymes of HMG-CoA reductase that catalyzes the conversion of HMG-CoA to mevalonate, which is a rate-limiting step in sterol biosynthesis; localizes to the nuclear envelope; overproduction induces the formation of karmellae" * 122805-Holinger-05_itms_14.10500.10500.2 1.9497 0.1621 98.7 903.2634 906.0293 4840.0 31 4.51 75.0 1 Y.NKYPLRD.S Reverse_YBR112C 1 1 0.7% 966 107202 5.0 U CYC8 SGDID:S000000316, Chr II from 465764-462864, reverse complement, Verified ORF, "General transcriptional co-repressor, acts together with Tup1p; also acts as part of a transcriptional co-activator complex that recruits the SWI/SNF and SAGA complexes to promoters" * 122805-Holinger-03_itms_8.05848.05848.2 1.4588 0.1847 96.9 838.43726 837.96356 4108.3 22 4.214 75.0 1 E.KVTEMTE.L Reverse_YGR271W 1 1 0.6% 1967 224828 6.5 U SLH1 SGDID:S000003503, Chr VII from 1031797-1037700, Verified ORF, "Putative RNA helicase related to Ski2p, involved in translation inhibition of non-poly(A) mRNAs; required for repressing propagation of dsRNA viruses" * 122805-Holinger-04_itms_4.04311.04311.2 2.6007 0.055 94.9 1284.5947 1286.578 7381.3 339 4.03 50.0 1 P.SHQKIAMFVPK.N YDL058W 1 1 0.6% 1790 206450 4.9 U USO1 SGDID:S000002216, Chr IV from 345665-351037, Verified ORF, "Essential protein involved in intracellular protein transport, coiled-coil protein necessary for transport from ER to Golgi; required for assembly of the ER-to-Golgi SNARE complex" * 122805-Holinger-04_itms_18.12089.12089.2 1.8341 0.1266 91.9 1323.5725 1325.5076 5365.2 425 3.834 50.0 1 D.IKNLQHEKSDL.I Reverse_YLR227W-B 1 2 0.6% 1755 198404 7.9 U YLR227W-B SGDID:S000007376, Chr XII from 593440-594744,594746-598708, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" Reverse_YPR158C-D 1 2 0.6% 1755 198373 7.9 U YPR158C-D SGDID:S000007362, Chr XVI from 856253-854949,854947-850985, reverse complement, transposable_element_gene, "TyB Gag-Pol protein; proteolytically processed to make the Gag, RT, PR, and IN proteins that are required for retrotransposition" 122805-Holinger-01_itms_24.16252.16252.2 2.0847 0.1163 92.2 1280.8527 1282.2224 6835.8 26 3.857 60.0 2 N.THNTENNSYSD.S YOR290C 1 1 0.6% 1703 194050 7.0 U SNF2 SGDID:S000005816, Chr XV from 860255-855144, reverse complement, Verified ORF, "Catalytic subunit of the 11-subunit SWI/SNF chromatin remodeling complex involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p" * 122805-Holinger-02_itms_20.12996.12996.2 2.0272 0.1019 97.2 1148.7727 1150.231 3165.3 110 4.274 55.0 1 T.LDKNSQTVSGT.P YJR140C 1 1 0.6% 1648 191679 6.2 U HIR3 SGDID:S000003901, Chr X from 695611-690665, reverse complement, Verified ORF, "Transcriptional corepressor involved in the cell cycle-regulated transcription of histone genes HTA1, HTB1, HHT1, and HHT2; involved in position-dependent gene silencing and nucleosome reassembly" * 122805-Holinger-03_itms_27.16979.16979.2 1.4359 0.167 90.3 1112.0253 1114.2438 3680.8 88 3.742 50.0 1 K.LRTPAEQGIE.T YOR093C 1 1 0.6% 1648 186906 8.5 U YOR093C SGDID:S000005619, Chr XV from 502452-497506, reverse complement, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_13.09278.09278.2 2.3889 0.1221 99.2 1166.7042 1167.3013 8912.8 1 4.672 72.2 1 G.ENISIYLLSD.Y YLL015W 1 1 0.6% 1559 176873 7.7 U BPT1 SGDID:S000003938, Chr XII from 116431-121110, Verified ORF, "ABC type transmembrane transporter of MRP/CFTR family, found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p" * 122805-Holinger-02_itms_15.10647.10647.2 1.7013 0.1578 95.0 1127.6042 1128.248 3357.5 14 4.031 62.5 1 L.NHVRNDMEL.K YGL150C 1 1 0.6% 1489 171454 5.7 U INO80 SGDID:S000003118, Chr VII from 225578-221109, reverse complement, Verified ORF, "ATPase that forms a large complex, containing actin and several actin-related proteins, that has chromatin remodeling activity and 3' to 5' DNA helicase activity in vitro; shows similarity to the Snf2p family of ATPases" * 122805-Holinger-02_itms_7.05817.05817.2 2.0222 0.142 93.7 1000.5603 1001.168 5649.9 7 3.942 75.0 1 M.ILDEAQAIK.S YML072C 1 1 0.6% 1545 171075 7.1 U TCB3 SGDID:S000004537, Chr XIII from 129367-124730, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; localized to the bud; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; mRNA is targeted to the bud via the mRNA transport system involving She2p; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" * 122805-Holinger-02_itms_14.10003.10003.2 1.7379 0.0276 90.6 905.4926 906.9707 3663.6 345 3.773 50.0 1 K.ANNDGVAVF.D YLR419W 1 1 0.6% 1435 163044 9.1 U YLR419W SGDID:S000004411, Chr XII from 958424-962731, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_5.04716.04716.2 1.9133 0.0735 90.5 1017.5031 1018.26276 3033.6 119 3.769 64.3 1 T.RMIVERLT.E YLR425W 1 1 0.6% 1307 149112 6.9 U TUS1 SGDID:S000004417, Chr XII from 982890-986813, Verified ORF, "Guanine nucleotide exchange factor (GEF) that functions to modulate Rhop1 activity as part of the cell integrity signaling pathway; multicopy suppressor of tor2 mutation and ypk1 ypk2 double mutation; potential Cdc28p substrate" * 122805-Holinger-02_itms_15.10438.10438.1 1.5174 0.1852 96.8 796.381 796.8986 3801.8 253 5.073 50.0 1 V.NLPVAPEG.S Reverse_YML081W 1 1 0.6% 1251 141465 7.8 U YML081W SGDID:S000004546, Chr XIII from 104777-108532, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-04_itms_8.06407.06407.2 1.5628 0.1342 92.6 853.5366 853.9475 3137.4 294 3.873 57.1 1 N.ALFLSSSE.R Reverse_YOR086C 1 1 0.6% 1186 133576 7.2 U TCB1 SGDID:S000005612, Chr XV from 486780-483220, reverse complement, Verified ORF, "Contains three calcium and lipid binding domains; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery; C-terminal portion of Tcb1p, Tcb2p and Tcb3p interact" * 122805-Holinger-01_itms_7.06605.06605.1 1.4133 0.2252 93.8 722.3495 720.8591 3521.3 1 4.917 66.7 1 D.MVVVDSA.T YPR117W 1 1 0.5% 2489 285902 8.3 U YPR117W SGDID:S000006321, Chr XVI from 760023-767492, Uncharacterized ORF, "Hypothetical protein" * 122805-Holinger-03_itms_6.05023.05023.2 2.117 0.1467 92.1 1443.7678 1443.7478 2569.1 178 3.848 50.0 1 K.KKTSMEIHRLLS.P Reverse_YPL231W 1 1 0.5% 1887 206945 5.4 U FAS2 SGDID:S000006152, Chr XVI from 108652-114315, Verified ORF, "Alpha subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains beta-ketoacyl reductase and beta-ketoacyl synthase activities" * 122805-Holinger-02_itms_5.04351.04351.2 2.3893 0.1197 97.9 1093.5234 1094.1234 3801.3 11 4.347 66.7 1 A.SENKDNAKTS.T Reverse_YBR208C 1 1 0.5% 1835 201831 5.6 U DUR1,2 SGDID:S000000412, Chr II from 642205-636698, reverse complement, Verified ORF, "Urea amidolyase, contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation" * 122805-Holinger-04_itms_8.06602.06602.2 1.3684 0.0021 94.6 953.58203 952.18207 4887.1 207 4.005 50.0 1 I.LLSGPVLPVG.A YJL109C 1 1 0.5% 1769 200080 6.5 U UTP10 SGDID:S000003645, Chr X from 217226-211917, reverse complement, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA" * 122805-Holinger-02_itms_16.10893.10893.2 2.5117 0.0134 94.3 1056.6493 1057.2755 3924.8 1 3.974 81.2 1 L.NDLLDIIKL.L Reverse_YDR141C 1 1 0.5% 1698 194686 5.7 U DOP1 SGDID:S000002548, Chr IV from 739992-734896, reverse complement, Verified ORF, "Protein of unknown function, essential for viability, involved in establishing cellular polarity and morphogenesis; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-05_itms_6.05845.05845.2 3.1731 0.1949 94.4 1165.6526 1166.3807 6690.1 57 3.989 81.2 1 T.KMIQENQKF.K YDR141C 1 1 0.5% 1698 194686 5.7 U DOP1 SGDID:S000002548, Chr IV from 739992-734896, reverse complement, Verified ORF, "Protein of unknown function, essential for viability, involved in establishing cellular polarity and morphogenesis; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm in a punctate pattern" * 122805-Holinger-05_itms_18.12759.12759.1 1.2408 0.2328 90.7 1022.4 1023.1362 4068.4 34 4.765 42.9 1 L.LRFSESHF.N Reverse_YGR281W 1 1 0.5% 1477 166727 7.7 U YOR1 SGDID:S000003513, Chr VII from 1052830-1057263, Verified ORF, "Plasma membrane transporter of the ATP-binding cassette (ABC) family, mediates export of many different organic anions including oligomycin" * 122805-Holinger-03_itms_7.05685.05685.2 1.7046 0.1151 96.0 927.52277 927.9891 3907.8 106 4.128 58.3 1 F.KNETWYS.L YAR050W 1 1 0.5% 1537 160667 4.2 U FLO1 SGDID:S000000084, Chr I from 203394-208007, Verified ORF, "Lectin-like protein involved in flocculation, cell wall protein that binds to mannose chains on the surface of other cells, confers floc-forming ability that is chymotrypsin sensitive and heat resistant; similar to Flo5p" YHR211W 1 1 0.7% 1075 111981 4.3 U FLO5 SGDID:S000001254, Chr VIII from 525392-528619, Verified ORF, "Lectin-like protein involved in flocculation, cell wall protein that binds to mannose chains on the surface of other cells, confers floc-forming ability that is chymotrypsin resistant but heat labile; similar to Flo1p" 122805-Holinger-04_itms_8.06451.06451.2 2.0983 0.023 92.8 845.47784 845.89386 4841.5 9 3.904 92.9 1 T.EACLPAGQ.R YGL195W 1 1 0.4% 2672 296697 5.3 U GCN1 SGDID:S000003163, Chr VII from 131531-139549, Verified ORF, "Positive regulator of the Gcn2p kinase activity, forms a complex with Gcn20p; proposed to stimulate Gcn2p activation by an uncharged tRNA" * 122805-Holinger-03_itms_14.09276.09276.2 2.7561 0.1782 99.0 1270.726 1271.4991 8304.6 8 4.622 70.0 1 K.AKPLEPILDQF.G YLR430W 1 1 0.4% 2231 252495 8.6 U SEN1 SGDID:S000004422, Chr XII from 993430-1000125, Verified ORF, "Nuclear protein, putative helicase required for processing of tRNAs, rRNAs, and small nuclear RNAs; potential Cdc28p substrate" * 122805-Holinger-06_itms_12.10097.10097.2 1.9318 0.1413 92.4 1146.1583 1147.4032 5820.0 10 3.86 61.1 1 N.ALNQKFLLLS.T YMR207C 1 1 0.4% 2123 241784 8.0 U HFA1 SGDID:S000004820, Chr XIII from 683563-677192, reverse complement, Verified ORF, "Mitochondrial acetyl-coenzyme A carboxylase, catalyzes the production of malonyl-CoA in mitochondrial fatty acid biosynthesis" * 122805-Holinger-05_itms_5.05258.05258.2 1.5871 0.1803 96.9 853.5318 853.9969 2020.7 239 4.219 64.3 1 Y.KNGIAHLT.A Reverse_YKL182W 1 1 0.4% 2051 228689 5.9 U FAS1 SGDID:S000001665, Chr XI from 100676-106831, Verified ORF, "Beta subunit of fatty acid synthetase, which catalyzes the synthesis of long-chain saturated fatty acids; contains acetyltransacylase, dehydratase, enoyl reductase, malonyl transacylase, and palmitoyl transacylase activities" * 122805-Holinger-02_itms_27.17116.17116.2 1.1755 0.0767 98.6 1029.727 1031.1997 3979.2 305 4.465 62.5 1 K.YGNSLHVLK.L YKR054C 1 1 0.3% 4092 471351 6.3 U DYN1 SGDID:S000001762, Chr XI from 547567-535289, reverse complement, Verified ORF, "Cytoplasmic heavy chain dynein, microtubule motor protein, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p" * 122805-Holinger-02_itms_6.05112.05112.2 1.7686 0.1154 90.9 1210.5779 1212.4349 5880.4 11 3.784 55.0 1 E.PTILEAQRGVK.N Reverse_YDR457W 1 1 0.3% 3268 374185 5.2 U TOM1 SGDID:S000002865, Chr IV from 1369780-1379586, Verified ORF, "E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators" * 122805-Holinger-06_itms_6.06971.06971.2 1.1887 0.0703 94.5 1350.7474 1351.5907 4310.3 147 3.99 35.0 1 L.LKKHADTFPFF.L Reverse_YLL040C 1 1 0.3% 3144 357850 5.6 U VPS13 SGDID:S000003963, Chr XII from 63644-54210, reverse complement, Verified ORF, "Protein of unknown function; heterooligomeric or homooligomeric complex; peripherally associated with membranes; homologous to human COH1; involved in sporulation, vacuolar protein sorting and protein-Golgi retention" * 122805-Holinger-02_itms_4.04116.04116.2 2.1648 0.0599 95.3 939.41 940.14557 4875.8 11 4.066 78.6 1 N.KSAIMDKF.G Proteins Peptide IDs Spectra Unfiltered 11035 59039 87233 Filtered 998 2475 3592 Forward matches 683 2147 3252 Decoy matches 315 328 340 Forward FP rate 46.12 15.28 10.46 Classification Nonredundant Proteins Redundant Proteins Unclassified 0 0